F309913

General Info

Members Datasets Scaffolds Average Seq Length
202 158 404 279

Family's Representative Sequence

Representative Sequence 3300025292|Ga0209676_1033794|Ga0209676_10337941
Length 313
Sequence MSRIFKGMNCASTIQNPDTLFICSESEASATNRQGEIDFEKLEVLIMKKILFIGAGSMAEALIQGWIKQKVFTAQEIYVTNRSDKERLHFLHDTYGVNCNFSHDIYQQADLIILAMKPKDAVAAMRELKPKITEQSSVLSILAGIAITTITEQLGARPVARVMPNTSATIGMSASGIAFNDKVTAAQRSIFLQLLEAVGSVIEVNEDQLHAVTALSGSGPAYIYYLMEAFERVGTKVGLSKDTVRLLMTQTLAGTAEMLKQSVDEPDVLRRKVTSPGGTTEAGIKALEQYQFNEAIEACIKEAEARSRSLANS

Samples

Sample ID Description Type Environment
1 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
37 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
38 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
39 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
40 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
41 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
42 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
43 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
44 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
45 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
46 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
47 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
48 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
49 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
50 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
51 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
52 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
53 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
54 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
55 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
56 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
57 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
58 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
59 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
60 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
61 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
62 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
63 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
64 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
65 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
66 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
67 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
68 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
69 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
70 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
71 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
72 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
73 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
74 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
75 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
76 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
81 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
82 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
83 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
84 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
85 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
86 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
87 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
88 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
89 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
90 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
91 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
92 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
93 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
94 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
95 2671180694 Paenibacillus sp. A3 Isolate Unclassified
96 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
97 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
98 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
99 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
100 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
101 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
102 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
103 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
104 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
105 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
106 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
107 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
108 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
109 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
110 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
111 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
112 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
113 2857472729 Cohnella sp. R-74144 Isolate Unclassified
114 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
115 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
116 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
117 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
118 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
119 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
120 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
121 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
122 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
123 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
124 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
125 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
126 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
127 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
128 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
129 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
130 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
131 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
132 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
133 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
134 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
135 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
136 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
137 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
138 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
139 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
140 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
141 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
142 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
143 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
144 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
145 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
146 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
147 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
148 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
149 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
150 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
151 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
152 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
153 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
154 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
155 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
156 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
157 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
158 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 60.4
Metatranscriptomes 0.99
Isolates 38.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.38
Nodule 0.5
Rhizoplane 1.98
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209676_1033794 3300025292 Bacteria 1519
2 JGI25154J39366_1004004 3300002738 Bacteria 2804
3 JGI25151J46595_10018864 3300003187 Bacteria 2947
4 JGI25151J46595_10023282 3300003187 Bacteria 2554
5 Ga0006562J51391_1018455 3300003578 Bacteria 2248
6 Ga0055538_1000067 3300003751 Bacteria 97856
7 Ga0055538_1000236 3300003751 Bacteria 30703
8 Ga0055535_1001733 3300003761 Bacteria 9793
9 Ga0055536_1000688 3300003781 Bacteria 22741
10 Ga0055530_10005534 3300003791 Bacteria 5961
11 Ga0055541_1001040 3300003841 Bacteria 6449
12 Ga0070661_100002273 3300005344 Bacteria 13181
13 Ga0070661_100448752 3300005344 Bacteria 1026
14 Ga0068864_100245841 3300005618 Bacteria 1659
15 Ga0105244_10002039 3300009036 Bacteria 15561
16 Ga0105244_10004208 3300009036 Bacteria 10003
17 Ga0111539_10317944 3300009094 Bacteria 1812
18 Ga0105242_10001803 3300009176 Bacteria 16881
19 Ga0105237_10027413 3300009545 Bacteria 5816
20 Ga0105239_10016417 3300010375 Bacteria 8187
21 Ga0105246_10082583 3300011119 Bacteria 2293
22 Ga0105246_10290901 3300011119 Bacteria 1314
23 Ga0157371_10014547 3300013102 Bacteria 5934
24 Ga0157370_10021459 3300013104 Bacteria 6436
25 Ga0157369_10034397 3300013105 Bacteria 5561
26 Ga0157375_10129167 3300013308 Bacteria 2645
27 Ga0209784_100067 3300025224 Bacteria 153334
28 Ga0209784_100085 3300025224 Bacteria 122828
29 Ga0209566_100015 3300025225 Bacteria 457963
30 Ga0209258_100954 3300025242 Bacteria 13866
31 Ga0209675_1007187 3300025291 Bacteria 4315
32 Ga0209676_1000754 3300025292 Bacteria 43820
33 Ga0209676_1014561 3300025292 Bacteria 2951
34 Ga0209676_1039795 3300025292 Bacteria 1331
35 Ga0209025_1002402 3300025294 Bacteria 19979
36 Ga0209025_1004463 3300025294 Bacteria 12154
37 Ga0209025_1005015 3300025294 Bacteria 11054
38 Ga0209025_1008045 3300025294 Bacteria 7679
39 Ga0209025_1033740 3300025294 Bacteria 2357
40 Ga0209050_1001035 3300025298 Bacteria 34509
41 Ga0209051_1000024 3300025303 Bacteria 437007
42 Ga0209257_1000079 3300025304 Bacteria 316420
43 Ga0207655_1000346 3300025728 Bacteria 67352
44 Ga0207655_1008182 3300025728 Bacteria 6673
45 Ga0207655_1058077 3300025728 Bacteria 1515
46 Ga0207671_10000097 3300025914 Bacteria 135093
47 Ga0207649_10000012 3300025920 Bacteria 265674
48 Ga0207686_10000958 3300025934 Bacteria 17215
49 Ga0207679_10000015 3300025945 Bacteria 265674
50 Ga0207712_10284168 3300025961 Unclassified 1351
51 Ga0265316_10196522 3300031344 Unclassified 1497
52 Ga0307408_100062797 3300031548 Bacteria 2716
53 Ga0316576_10030926 3300031727 Bacteria 3795
54 Ga0316576_10176442 3300031727 Unclassified 1612
55 Ga0316578_10267937 3300031728 Bacteria 1024
56 Ga0307413_10400194 3300031824 Bacteria 1075
57 Ga0307413_10466314 3300031824 Bacteria 1006
58 Ga0307407_10103091 3300031903 Bacteria 1775
59 Ga0307412_10128419 3300031911 Bacteria 1837
60 Ga0307414_10137405 3300032004 Bacteria 1908
61 Ga0307415_100316022 3300032126 Bacteria 1300
62 Ga0316583_10004450 3300032133 Bacteria 4999
63 Ga0316580_10039812 3300032139 Bacteria 1452
64 Ga0316584_0305470 3300036712 Bacteria 1151
65 Ga0400487_63208 3300039110 Bacteria 1229
66 Ga0439466_0021197 3300041411 Bacteria 2307
67 Ga0439445_0108672 3300042004 Bacteria 790
68 Ga0439432_006379 3300042006 Bacteria 4217
69 Ga0439432_054735 3300042006 Bacteria 1239
70 Ga0439462_0050005 3300042015 Bacteria 1122
71 Ga0450911_000064 3300042115 Bacteria 43716
72 Ga0453684_0000010 3300044712 Bacteria 1133422
73 Ga0495590_0030671 3300046457 Bacteria 1884
74 Ga0495650_0006101 3300046471 Bacteria 7595
75 Ga0495583_0000670 3300046506 Bacteria 44793
76 Ga0495606_0010950 3300046507 Bacteria 7455
77 Ga0495610_0019038 3300046512 Bacteria 3855
78 Ga0495632_0001246 3300046519 Bacteria 21583
79 Ga0495637_0034441 3300046520 Bacteria 2218
80 Ga0495661_0000200 3300046665 Bacteria 69488
81 Ga0495626_0088070 3300048091 Bacteria 1369
82 Ga0496108_0157031 3300048911 Bacteria 1965
83 Ga0496116_0001229 3300048919 Bacteria 29859
84 Ga0496116_0005979 3300048919 Bacteria 11158
85 Ga0496116_0010434 3300048919 Bacteria 7781
86 Ga0496116_0011308 3300048919 Bacteria 7405
87 Ga0496116_0069825 3300048919 Bacteria 2232
88 Ga0496116_0083696 3300048919 Bacteria 1968
89 Ga0496116_0142291 3300048919 Bacteria 1347
90 Ga0496116_0204637 3300048919 Bacteria 1029
91 Ga0496116_0215859 3300048919 Bacteria 989
92 Ga0496117_0008289 3300048920 Bacteria 9890
93 Ga0496117_0159398 3300048920 Bacteria 1324
94 Ga0496117_0196652 3300048920 Bacteria 1143
95 Ga0496118_0011811 3300048921 Bacteria 8476
96 Ga0496119_0001600 3300048922 Bacteria 26910
97 Ga0496119_0011318 3300048922 Bacteria 7407
98 Ga0496120_0000045 3300048923 Bacteria 191663
99 Ga0496121_0004958 3300048924 Bacteria 17463
100 Ga0496121_0107101 3300048924 Bacteria 2141
101 Ga0496121_0243027 3300048924 Bacteria 1253
102 Ga0496121_0280596 3300048924 Bacteria 1140
103 Ga0496121_0308164 3300048924 Bacteria 1072
104 Ga0496122_0012520 3300048925 Bacteria 8432
105 Ga0496122_0014901 3300048925 Bacteria 7484
106 Ga0496122_0020644 3300048925 Bacteria 5936
107 Ga0496122_0261040 3300048925 Bacteria 961
108 Ga0496123_0039929 3300048926 Bacteria 3278
109 Ga0496123_0054322 3300048926 Bacteria 2638
110 Ga0496123_0074593 3300048926 Bacteria 2099
111 Ga0496124_0000572 3300048927 Bacteria 62388
112 Ga0496124_0035999 3300048927 Bacteria 4324
113 Ga0496124_0095341 3300048927 Bacteria 2419
114 Ga0496124_0134715 3300048927 Bacteria 1957
115 Ga0496125_0000351 3300048928 Bacteria 87146
116 Ga0496125_0012233 3300048928 Bacteria 8536
117 Ga0496126_0001866 3300048929 Bacteria 30684
118 Ga0496126_0002647 3300048929 Bacteria 23747
119 Ga0496126_0007508 3300048929 Bacteria 11943
120 Ga0501306_002162 3300049127 Bacteria 1977
121 Ga0501039_0559028 3300049575 Bacteria 898
122 Ga0501208_000481 3300049655 Bacteria 3185
123 nmdc:mga05p37_263705_c1 3300050507 Bacteria 2060
124 nmdc:mga08y16_649813_c1 3300050511 Bacteria 1059
125 2512734847 2512564039 Bacteria 8739048
126 2524186149 2524023129 Bacteria 6762600
127 2550906630 2548877040 Bacteria 7507281
128 2563929051 2563366752 Bacteria 4961801
129 2571527632 2571042143 Bacteria 6986194
130 2573037320 2571042588 Bacteria 5045676
131 2578337658 2576861424 Bacteria 5270569
132 2580934489 2579778775 Bacteria 5360914
133 2595316516 2593339198 Bacteria 7267884
134 2599878946 2599185288 Bacteria 6666191
135 2599950845 2599185303 Bacteria 6512725
136 2601638735 2600255286 Bacteria 5390125
137 2621275992 2619619294 Bacteria 5575484
138 2643738423 2643221543 Bacteria 6628015
139 2673821825 2671180694 Bacteria 7506943
140 2723604571 2721755693 Bacteria 6126117
141 2728530289 2728368933 Bacteria 7044283
142 2730135212 2728369359 Bacteria 5621728
143 2738807162 2738541294 Bacteria 6925949
144 2738894522 2738541309 Bacteria 6926455
145 2753809984 2751185905 Bacteria 6142767
146 2791214131 2788500588 Bacteria 4584915
147 2802436833 2802428803 Bacteria 5806948
148 2808976055 2808606385 Bacteria 6711065
149 2808993162 2808606388 Bacteria 6706662
150 2819626273 2818991451 Bacteria 4697364
151 2821114269 2821111986 Bacteria 6894338
152 2852616261 2852612431 Bacteria 6885235
153 2852671229 2852667396 Bacteria 6885555
154 2857453864 2857453340 Bacteria 8090534
155 2857462912 2857460504 Bacteria 5194327
156 2857467808 2857465823 Bacteria 6772595
157 2857474043 2857472729 Bacteria 6568124
158 2857594666 2857591370 Bacteria 6569758
159 2864737481 2864733723 Bacteria 6770668
160 2864999901 2864997549 Bacteria 5139696
161 2865004244 2865002811 Bacteria 6333767
162 2881636999 2881636855 Bacteria 5205297
163 2885527725 2885526491 Bacteria 7164189
164 2889046376 2889042446 Bacteria 7618936
165 2889280478 2889276214 Bacteria 5979355
166 2889296177 2889295896 Bacteria 4704906
167 2904163634 2904162308 Bacteria 7086713
168 2904493279 2904490793 Bacteria 7046938
169 2904595590 2904595352 Bacteria 6124848
170 2904608091 2904606771 Bacteria 4684500
171 2907202216 2907202186 Bacteria 6632024
172 2919162571 2919160200 Bacteria 6929020
173 2929188779 2929183550 Bacteria 6377511
174 2931389825 2931384279 Bacteria 7299545
175 2938651882 2938649242 Bacteria 7118381
176 2939597640 2939593269 Bacteria 4798695
177 2939680788 2939679117 Bacteria 6921672
178 2939705346 2939702853 Bacteria 5139229
179 2945966756 2945961074 Bacteria 7342064
180 2945991484 2945991243 Bacteria 7008369
181 2946054180 2946053406 Bacteria 6978655
182 2968560730 2968558590 Bacteria 6956864
183 2971407775 2971403814 Bacteria 7370929
184 2971417030 2971410472 Bacteria 8311090
185 2971512258 2971511577 Bacteria 5404012
186 2980125768 2980125574 Bacteria 5567337
187 2980177354 2980176882 Bacteria 5397533
188 2981287920 2981284811 Bacteria 4641497
189 2981292367 2981289755 Bacteria 4641509
190 2981983539 2981980479 Bacteria 4641628
191 2981988423 2981985349 Bacteria 4641497
192 2988231926 2988225383 Bacteria 7221625
193 2996638238 2996632988 Bacteria 6921523
194 2996710579 2996706504 Bacteria 5757485
195 648170612 648028048 Bacteria 5394884
196 8054469511 8054465665 Bacteria 7323556
197 8054798085 8054795415 Bacteria 9785225
198 8055535010 8055531788 Bacteria 5249694
199 8055635551 8055632911 Bacteria 5283357
200 8057473284 8057473075 Bacteria 5892720
201 8057739436 8057733483 Bacteria 6578323
202 8057980301 8057977335 Bacteria 5694872
203 Ga0209676_1033794
204 JGI25154J39366_1004004
205 JGI25151J46595_10018864
206 JGI25151J46595_10023282
207 Ga0006562J51391_1018455
208 Ga0055538_1000067
209 Ga0055538_1000236
210 Ga0055535_1001733
211 Ga0055536_1000688
212 Ga0055530_10005534
213 Ga0055541_1001040
214 Ga0070661_100002273
215 Ga0070661_100448752
216 Ga0068864_100245841
217 Ga0105244_10002039
218 Ga0105244_10004208
219 Ga0111539_10317944
220 Ga0105242_10001803
221 Ga0105237_10027413
222 Ga0105239_10016417
223 Ga0105246_10082583
224 Ga0105246_10290901
225 Ga0157371_10014547
226 Ga0157370_10021459
227 Ga0157369_10034397
228 Ga0157375_10129167
229 Ga0209784_100067
230 Ga0209784_100085
231 Ga0209566_100015
232 Ga0209258_100954
233 Ga0209675_1007187
234 Ga0209676_1000754
235 Ga0209676_1014561
236 Ga0209676_1039795
237 Ga0209025_1002402
238 Ga0209025_1004463
239 Ga0209025_1005015
240 Ga0209025_1008045
241 Ga0209025_1033740
242 Ga0209050_1001035
243 Ga0209051_1000024
244 Ga0209257_1000079
245 Ga0207655_1000346
246 Ga0207655_1008182
247 Ga0207655_1058077
248 Ga0207671_10000097
249 Ga0207649_10000012
250 Ga0207686_10000958
251 Ga0207679_10000015
252 Ga0207712_10284168
253 Ga0265316_10196522
254 Ga0307408_100062797
255 Ga0316576_10030926
256 Ga0316576_10176442
257 Ga0316578_10267937
258 Ga0307413_10400194
259 Ga0307413_10466314
260 Ga0307407_10103091
261 Ga0307412_10128419
262 Ga0307414_10137405
263 Ga0307415_100316022
264 Ga0316583_10004450
265 Ga0316580_10039812
266 Ga0316584_0305470
267 Ga0400487_63208
268 Ga0439466_0021197
269 Ga0439445_0108672
270 Ga0439432_006379
271 Ga0439432_054735
272 Ga0439462_0050005
273 Ga0450911_000064
274 Ga0453684_0000010
275 Ga0495590_0030671
276 Ga0495650_0006101
277 Ga0495583_0000670
278 Ga0495606_0010950
279 Ga0495610_0019038
280 Ga0495632_0001246
281 Ga0495637_0034441
282 Ga0495661_0000200
283 Ga0495626_0088070
284 Ga0496108_0157031
285 Ga0496116_0001229
286 Ga0496116_0005979
287 Ga0496116_0010434
288 Ga0496116_0011308
289 Ga0496116_0069825
290 Ga0496116_0083696
291 Ga0496116_0142291
292 Ga0496116_0204637
293 Ga0496116_0215859
294 Ga0496117_0008289
295 Ga0496117_0159398
296 Ga0496117_0196652
297 Ga0496118_0011811
298 Ga0496119_0001600
299 Ga0496119_0011318
300 Ga0496120_0000045
301 Ga0496121_0004958
302 Ga0496121_0107101
303 Ga0496121_0243027
304 Ga0496121_0280596
305 Ga0496121_0308164
306 Ga0496122_0012520
307 Ga0496122_0014901
308 Ga0496122_0020644
309 Ga0496122_0261040
310 Ga0496123_0039929
311 Ga0496123_0054322
312 Ga0496123_0074593
313 Ga0496124_0000572
314 Ga0496124_0035999
315 Ga0496124_0095341
316 Ga0496124_0134715
317 Ga0496125_0000351
318 Ga0496125_0012233
319 Ga0496126_0001866
320 Ga0496126_0002647
321 Ga0496126_0007508
322 Ga0501306_002162
323 Ga0501039_0559028
324 Ga0501208_000481
325 nmdc:mga05p37_263705_c1
326 nmdc:mga08y16_649813_c1
327 2512734847
328 2524186149
329 2550906630
330 2563929051
331 2571527632
332 2573037320
333 2578337658
334 2580934489
335 2595316516
336 2599878946
337 2599950845
338 2601638735
339 2621275992
340 2643738423
341 2673821825
342 2723604571
343 2728530289
344 2730135212
345 2738807162
346 2738894522
347 2753809984
348 2791214131
349 2802436833
350 2808976055
351 2808993162
352 2819626273
353 2821114269
354 2852616261
355 2852671229
356 2857453864
357 2857462912
358 2857467808
359 2857474043
360 2857594666
361 2864737481
362 2864999901
363 2865004244
364 2881636999
365 2885527725
366 2889046376
367 2889280478
368 2889296177
369 2904163634
370 2904493279
371 2904595590
372 2904608091
373 2907202216
374 2919162571
375 2929188779
376 2931389825
377 2938651882
378 2939597640
379 2939680788
380 2939705346
381 2945966756
382 2945991484
383 2946054180
384 2968560730
385 2971407775
386 2971417030
387 2971512258
388 2980125768
389 2980177354
390 2981287920
391 2981292367
392 2981983539
393 2981988423
394 2988231926
395 2996638238
396 2996710579
397 648170612
398 8054469511
399 8054798085
400 8055535010
401 8055635551
402 8057473284
403 8057739436
404 8057980301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14748

P5CR_dimer

Pyrroline-5-carboxylate reductase dimerisation

206

310

0.98

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

49

144

0.97

PF01488

Shikimate_DH

Shikimate / quinate 5-dehydrogenase

36

162

0.78

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

50

178

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tri-assembly1.cif.gz_B structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii 0.9626 2 266
2ag8-assembly1.cif.gz_A nadp complex of pyrroline-5-carboxylate reductase from neisseria meningitidis 0.9498 4 270
2ag8-assembly1.cif.gz_A nadp complex of pyrroline-5-carboxylate reductase from neisseria meningitidis 0.9429 4 270
3tri-assembly1.cif.gz_B structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii 0.9419 2 266
5bsh-assembly1.cif.gz_D crystal structure of medicago truncatula (delta)1-pyrroline-5-carboxylate reductase (mtp5cr) in complex with l-proline 0.937 3 266
ID Description Score Start End Superfamily
5bsfB02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9815 169 266 1.10.3730.10
5bshB02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9815 169 266 1.10.3730.10
5bshF02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9813 169 266 1.10.3730.10
5uaxB02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9808 169 266 1.10.3730.10
5uaxC02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9806 169 266 1.10.3730.10
ID Description Score Start End GO Terms
AF-A0A3M3WY97-F1-model_v4 Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR) (EC 1.5.1.2) (PCA reductase) 0.9933 68 272 GO:0004735
GO:0005737
GO:0055129
AF-A0A8A5VYR7-F1-model_v4 deleted 0.9903 150 271
AF-A0A7V2W922-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9889 1 174 GO:0004735
GO:0055129
AF-A0A3B9XNG7-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9878 3 166 GO:0004735
GO:0055129
AF-A0A3B9BAU3-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9862 159 268 GO:0004735
GO:0055129

Map