F309883

General Info

Members Datasets Scaffolds Average Seq Length
202 157 197 309

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10036436|Ga0182008_100364362
Length 338
Sequence LRASHDWRHGIEQTAKERLHMKRLFVTGQSGFVGLAFERMRAHIAAAHGWELISAGSPYDLLEPAALDLVIQQARPDAVIHLAGQTFIPEAFRDPAHTLDVNLKGTLHLLQALQRNSFNGTFLYVSSGDVYGKVDPDSLPISEQMPVRPQNPYAVSKAAAELLCYQWSCNQPWRILVARPFNHIGPGQRDDFVVSSVARQLARIRQGLQEPRIQVGDVDVSRDFLDVEDVISAYLALLENGLNGETYNVCSGKEYLIRDLISSMLYLTEIDAQIEQDPTRLRPSDLRRVKGCNQKITQATAWRPGIPMQQTLLNVLSNWESRVAAEHAAKIHLRDGKN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
3 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
4 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
5 2818991436 Collimonas arenae 515 Isolate Unclassified
6 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
108 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
109 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
153 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
156 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
157 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 1.49
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.86
Nodule 0
Rhizoplane 1.98
Rhizosphere 79.21
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3350539 2162886007 Bacteria 12396
2 JGI25162J39368_1000001 3300002737 Bacteria 740113
3 JGI25165J46597_1000001 3300003214 Bacteria 1111887
4 rootL2_10261658 3300003322 Bacteria 2528
5 Ga0055538_1000001 3300003751 Bacteria 1111887
6 Ga0055539_1000001 3300003752 Bacteria 1111887
7 Ga0055533_1000003 3300003756 Bacteria 1111887
8 Ga0055525_1000003 3300003759 Bacteria 962094
9 Ga0055535_1000279 3300003761 Bacteria 53696
10 Ga0055542_1000139 3300003762 Bacteria 90228
11 Ga0055541_1000001 3300003841 Bacteria 1111887
12 Ga0065704_10070432 3300005289 Bacteria 25018
13 Ga0070658_10001681 3300005327 Bacteria 18684
14 Ga0070683_100246840 3300005329 Bacteria 1698
15 Ga0070682_100004217 3300005337 Bacteria 7978
16 Ga0070660_100000565 3300005339 Bacteria 24858
17 Ga0070660_100001715 3300005339 Bacteria 15024
18 Ga0070660_100018389 3300005339 Bacteria 5107
19 Ga0070660_100159721 3300005339 Bacteria 1816
20 Ga0070661_100417913 3300005344 Bacteria 1063
21 Ga0070668_100248756 3300005347 Unclassified 1475
22 Ga0070659_100001127 3300005366 Bacteria 19494
23 Ga0070659_100003938 3300005366 Bacteria 10566
24 Ga0070667_100161824 3300005367 Unclassified 1972
25 Ga0070714_100015164 3300005435 Bacteria 6197
26 Ga0070663_100177686 3300005455 Bacteria 1649
27 Ga0070662_100202679 3300005457 Bacteria 1575
28 Ga0070681_10001450 3300005458 Bacteria 20901
29 Ga0070681_10199362 3300005458 Bacteria 1920
30 Ga0070698_100489174 3300005471 Bacteria 1168
31 Ga0070696_100006153 3300005546 Bacteria 8019
32 Ga0070665_100000339 3300005548 Bacteria 71205
33 Ga0070665_100065870 3300005548 Bacteria 3633
34 Ga0068855_100005501 3300005563 Bacteria 15459
35 Ga0068855_100023118 3300005563 Bacteria 7449
36 Ga0070664_100104004 3300005564 Bacteria 2472
37 Ga0068854_100348375 3300005578 Bacteria 1211
38 Ga0068856_100010424 3300005614 Bacteria 9023
39 Ga0068852_100362742 3300005616 Bacteria 1417
40 Ga0068858_100049264 3300005842 Bacteria 3901
41 Ga0068860_100186670 3300005843 Bacteria 2005
42 Ga0068871_100097508 3300006358 Bacteria 2457
43 Ga0105237_10329147 3300009545 Bacteria 1532
44 Ga0105238_10076968 3300009551 Bacteria 3328
45 Ga0105238_10083814 3300009551 Bacteria 3177
46 Ga0105238_10242879 3300009551 Bacteria 1778
47 Ga0105239_10268257 3300010375 Bacteria 1919
48 Ga0157373_10001895 3300013100 Bacteria 15874
49 Ga0157371_10006733 3300013102 Bacteria 9394
50 Ga0157371_10009702 3300013102 Bacteria 7555
51 Ga0157370_10025065 3300013104 Bacteria 5904
52 Ga0157369_10003308 3300013105 Bacteria 19156
53 Ga0157369_10006769 3300013105 Bacteria 13227
54 Ga0157369_10416166 3300013105 Bacteria 1393
55 Ga0157372_10020856 3300013307 Bacteria 7074
56 Ga0157372_10038837 3300013307 Bacteria 5253
57 Ga0157372_10170266 3300013307 Bacteria 2520
58 Ga0182008_10000209 3300014497 Bacteria 46251
59 Ga0182008_10004934 3300014497 Bacteria 7689
60 Ga0182008_10008788 3300014497 Bacteria 5490
61 Ga0182008_10019748 3300014497 Bacteria 3475
62 Ga0182008_10036436 3300014497 Bacteria 2462
63 Ga0182006_1003878 3300015261 Bacteria 7496
64 Ga0182007_10000393 3300015262 Bacteria 27064
65 Ga0182007_10003153 3300015262 Bacteria 7910
66 Ga0182007_10008147 3300015262 Bacteria 4324
67 Ga0182007_10012843 3300015262 Bacteria 3212
68 Ga0182007_10014042 3300015262 Bacteria 3033
69 Ga0209784_100004 3300025224 Bacteria 1378156
70 Ga0209566_100004 3300025225 Bacteria 1531866
71 Ga0209674_100006 3300025226 Bacteria 1531866
72 Ga0209672_100297 3300025228 Bacteria 34485
73 Ga0209563_100009 3300025230 Bacteria 1378156
74 Ga0207427_100606 3300025231 Bacteria 17832
75 Ga0209437_100004 3300025233 Bacteria 1378156
76 Ga0209258_100057 3300025242 Bacteria 334259
77 Ga0209677_100005 3300025253 Bacteria 1378156
78 Ga0209148_1000068 3300025254 Bacteria 335510
79 Ga0209759_1001656 3300025256 Bacteria 11716
80 Ga0209233_1000005 3300025261 Bacteria 1531866
81 Ga0209455_1002165 3300025272 Bacteria 7790
82 Ga0209673_1023413 3300025273 Bacteria 2103
83 Ga0209564_1002215 3300025295 Bacteria 16182
84 Ga0209256_1001987 3300025299 Bacteria 18387
85 Ga0207705_10003672 3300025909 Bacteria 11674
86 Ga0207707_10013368 3300025912 Bacteria 7155
87 Ga0207695_10036608 3300025913 Bacteria 5304
88 Ga0207671_10030435 3300025914 Bacteria 4026
89 Ga0207657_10000309 3300025919 Bacteria 51811
90 Ga0207657_10004562 3300025919 Bacteria 14646
91 Ga0207657_10028360 3300025919 Bacteria 5108
92 Ga0207657_10192738 3300025919 Bacteria 1643
93 Ga0207649_10067120 3300025920 Bacteria 2276
94 Ga0207694_10023575 3300025924 Bacteria 4672
95 Ga0207694_10042854 3300025924 Bacteria 3492
96 Ga0207694_10047080 3300025924 Bacteria 3335
97 Ga0207664_10185536 3300025929 Bacteria 1788
98 Ga0207690_10000875 3300025932 Bacteria 19226
99 Ga0207690_10010419 3300025932 Bacteria 5523
100 Ga0207690_10024891 3300025932 Bacteria 3753
101 Ga0207706_10092890 3300025933 Bacteria 2653
102 Ga0207691_10087606 3300025940 Bacteria 2793
103 Ga0207691_10209668 3300025940 Bacteria 1693
104 Ga0207667_10003022 3300025949 Bacteria 20871
105 Ga0207667_10016060 3300025949 Bacteria 8479
106 Ga0207658_10096637 3300025986 Bacteria 2304
107 Ga0207677_10260288 3300026023 Bacteria 1414
108 Ga0207678_10237604 3300026067 Bacteria 1560
109 Ga0207702_10009095 3300026078 Bacteria 8361
110 Ga0207674_10046372 3300026116 Bacteria 4462
111 Ga0207674_10337841 3300026116 Bacteria 1456
112 Ga0207698_10339227 3300026142 Bacteria 1415
113 Ga0207428_10150190 3300027907 Bacteria 1774
114 Ga0268266_10000004 3300028379 Bacteria 1495817
115 Ga0265338_10000643 3300028800 Bacteria 60461
116 Ga0307408_100284815 3300031548 Bacteria 1378
117 Ga0316576_10095760 3300031727 Bacteria 2215
118 Ga0316577_10091101 3300031733 Unclassified 1707
119 Ga0307410_10037060 3300031852 Bacteria 3182
120 Ga0307406_10088236 3300031901 Bacteria 2081
121 Ga0307412_10000422 3300031911 Bacteria 25696
122 Ga0307416_100223067 3300032002 Bacteria 1810
123 Ga0316593_10039024 3300032168 Bacteria 1574
124 Ga0307510_10001023 3300033180 Bacteria 29633
125 Ga0316592_1007859 3300033524 Bacteria 2091
126 Ga0316588_1001155 3300033528 Bacteria 4193
127 Ga0373937_0336165 3300036401 Unclassified 1430
128 Ga0316584_0149587 3300036712 Bacteria 1738
129 Ga0395899_0018851 3300037312 Bacteria 5244
130 Ga0395900_0000245 3300037418 Bacteria 85245
131 Ga0395898_0136043 3300037466 Bacteria 2353
132 Ga0395898_0459381 3300037466 Unclassified 1212
133 Ga0395905_0266074 3300037471 Bacteria 1600
134 Ga0395901_0000579 3300038443 Bacteria 42444
135 Ga0237819_00584 3300038705 Bacteria 12198
136 Ga0439436_0000066 3300041404 Bacteria 29532
137 Ga0439438_000141 3300041405 Bacteria 32709
138 Ga0451853_1791667 3300041512 Bacteria 1135
139 Ga0495627_045548 3300046453 Bacteria 1336
140 Ga0495638_0052404 3300046460 Bacteria 2542
141 Ga0495651_0032474 3300046462 Bacteria 4071
142 Ga0495653_0036996 3300046463 Bacteria 3839
143 Ga0495650_0000074 3300046471 Bacteria 251346
144 Ga0495650_0008771 3300046471 Bacteria 5851
145 Ga0495584_0001138 3300046491 Bacteria 16452
146 Ga0495607_0000261 3300046501 Bacteria 56378
147 Ga0495606_0001476 3300046507 Bacteria 31356
148 Ga0495610_0001679 3300046512 Bacteria 19452
149 Ga0495616_0000594 3300046513 Bacteria 27272
150 Ga0495620_0000327 3300046515 Bacteria 33465
151 Ga0495628_0000328 3300046516 Bacteria 42897
152 Ga0495631_0007222 3300046518 Bacteria 5662
153 Ga0495632_0016341 3300046519 Bacteria 4132
154 Ga0495632_0071213 3300046519 Bacteria 1671
155 Ga0495637_0000415 3300046520 Bacteria 31323
156 Ga0495663_0001242 3300046525 Bacteria 8120
157 Ga0495652_0003121 3300046529 Bacteria 16558
158 Ga0495652_0016855 3300046529 Bacteria 6529
159 Ga0495652_0038739 3300046529 Bacteria 4127
160 Ga0495609_0000454 3300046538 Bacteria 33468
161 Ga0495633_0045576 3300046558 Bacteria 2076
162 Ga0495668_0005687 3300046616 Bacteria 8352
163 Ga0495668_0047205 3300046616 Bacteria 2391
164 Ga0495625_0036033 3300046660 Bacteria 3641
165 Ga0495625_0113204 3300046660 Bacteria 1853
166 Ga0495657_0046724 3300046675 Bacteria 2930
167 Ga0495623_0004430 3300046679 Bacteria 9228
168 Ga0495646_0000600 3300046680 Bacteria 19594
169 Ga0495589_0000423 3300046794 Bacteria 31362
170 Ga0495600_0000812 3300046809 Bacteria 16603
171 Ga0495660_0000348 3300046810 Bacteria 40994
172 Ga0495660_0020262 3300046810 Bacteria 3811
173 Ga0495636_0001464 3300047318 Bacteria 8952
174 Ga0495672_0000010 3300047320 Bacteria 545038
175 Ga0495676_0000762 3300047321 Bacteria 26867
176 Ga0495673_0000036 3300047469 Bacteria 311035
177 Ga0495681_0000465 3300047470 Bacteria 31006
178 Ga0495681_0003939 3300047470 Bacteria 10233
179 Ga0495686_0000033 3300047472 Bacteria 342031
180 Ga0495686_0001834 3300047472 Bacteria 21351
181 Ga0495602_0006066 3300048088 Bacteria 12675
182 Ga0495602_0008761 3300048088 Bacteria 10560
183 Ga0495602_0168856 3300048088 Bacteria 1700
184 Ga0496114_0032620 3300048917 Bacteria 4288
185 Ga0496118_0002465 3300048921 Bacteria 24852
186 Ga0496126_0005156 3300048929 Bacteria 15113
187 Ga0496126_0296787 3300048929 Bacteria 1335
188 Ga0495678_003391 3300049459 Bacteria 9909
189 Ga0501072_0351696 3300049588 Bacteria 1170
190 Ga0501083_0201655 3300049744 Bacteria 1297
191 Ga0501045_0131176 3300049824 Bacteria 1863
192 Ga0501226_000001 3300049853 Bacteria 432595
193 nmdc:mga07m45_66006_c1 3300050496 Unclassified 2055
194 Ga0495601_0074457 3300053077 Bacteria 2172
195 Ga0500646_0006619 3300053090 Bacteria 2949
196 Ga0500556_0000506 3300053104 Bacteria 26798
197 Ga0500574_000211 3300053141 Bacteria 6879

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2599185248 2599767903 258
2 iso_pu_bacteria 2599185313 2600007142 258
3 iso_pu_bacteria 2599185324 2600072082 258
4 3300003761 Ga0055535_1000279 Ga0055535_100027928 262
5 3300003762 Ga0055542_1000139 Ga0055542_100013946 262
6 3300025228 Ga0209672_100297 Ga0209672_10029727 262
7 3300025242 Ga0209258_100057 Ga0209258_100057194 262
8 3300025254 Ga0209148_1000068 Ga0209148_1000068194 262
9 3300025272 Ga0209455_1002165 Ga0209455_10021652 262
10 3300031548 Ga0307408_100284815 Ga0307408_1002848151 262
11 3300026116 Ga0207674_10046372 Ga0207674_100463722 269
12 3300046460 Ga0495638_0052404 Ga0495638_0052404_329_1174 269
13 3300046501 Ga0495607_0000261 Ga0495607_0000261_36479_37324 269
14 3300046513 Ga0495616_0000594 Ga0495616_0000594_881_1726 269
15 3300038705 Ga0237819_00584 Ga0237819_00584_5802_6650 270
16 3300047321 Ga0495676_0000762 Ga0495676_0000762_25149_26000 271
17 3300047470 Ga0495681_0003939 Ga0495681_0003939_6195_7049 272
18 3300050496 nmdc:mga07m45_66006_c1 nmdc:mga07m45_66006_c1_930_1850 275
19 3300046519 Ga0495632_0071213 Ga0495632_0071213_383_1246 277
20 3300027907 Ga0207428_10150190 Ga0207428_101501902 278
21 3300005339 Ga0070660_100000565 Ga0070660_10000056518 284
22 3300025919 Ga0207657_10000309 Ga0207657_100003099 284
23 3300028800 Ga0265338_10000643 Ga0265338_1000064317 284
24 3300005367 Ga0070667_100161824 Ga0070667_1001618242 285
25 3300009551 Ga0105238_10083814 Ga0105238_100838142 285
26 3300013307 Ga0157372_10170266 Ga0157372_101702663 285
27 3300005614 Ga0068856_100010424 Ga0068856_1000104242 286
28 3300025909 Ga0207705_10003672 Ga0207705_100036727 286
29 3300026078 Ga0207702_10009095 Ga0207702_100090958 286
30 3300005563 Ga0068855_100023118 Ga0068855_1000231188 287
31 3300025949 Ga0207667_10016060 Ga0207667_100160602 287
32 3300053104 Ga0500556_0000506 Ga0500556_0000506_16897_17820 287
33 3300037312 Ga0395899_0018851 Ga0395899_0018851_3189_4115 288
34 3300037418 Ga0395900_0000245 Ga0395900_0000245_50340_51266 288
35 3300037466 Ga0395898_0459381 Ga0395898_0459381_50_976 288
36 3300037471 Ga0395905_0266074 Ga0395905_0266074_467_1393 288
37 3300038443 Ga0395901_0000579 Ga0395901_0000579_13209_14135 288
38 3300049588 Ga0501072_0351696 Ga0501072_0351696_205_1101 288
39 3300049744 Ga0501083_0201655 Ga0501083_0201655_26_955 288
40 3300049824 Ga0501045_0131176 Ga0501045_0131176_919_1815 288
41 3300036401 Ga0373937_0336165 Ga0373937_0336165_365_1336 289
42 3300047320 Ga0495672_0000010 Ga0495672_0000010_22296_23228 289
43 3300049853 Ga0501226_000001 Ga0501226_000001_425459_426364 289
44 3300005435 Ga0070714_100015164 Ga0070714_1000151645 290
45 3300013105 Ga0157369_10416166 Ga0157369_104161661 290
46 3300013307 Ga0157372_10038837 Ga0157372_100388372 290
47 3300025924 Ga0207694_10042854 Ga0207694_100428542 290
48 3300025929 Ga0207664_10185536 Ga0207664_101855362 290
49 iso_pu_bacteria 2818991436 2819543668 290
50 3300005347 Ga0070668_100248756 Ga0070668_1002487562 292
51 3300005548 Ga0070665_100065870 Ga0070665_1000658702 292
52 3300006358 Ga0068871_100097508 Ga0068871_1000975081 292
53 3300025273 Ga0209673_1023413 Ga0209673_10234132 292
54 3300025295 Ga0209564_1002215 Ga0209564_100221511 292
55 3300025299 Ga0209256_1001987 Ga0209256_10019875 292
56 3300025940 Ga0207691_10087606 Ga0207691_100876063 292
57 3300025986 Ga0207658_10096637 Ga0207658_100966372 292
58 3300026023 Ga0207677_10260288 Ga0207677_102602882 292
59 iso_pu_bacteria 2842918807 2842920355 292
60 3300005458 Ga0070681_10199362 Ga0070681_101993622 293
61 3300046453 Ga0495627_045548 Ga0495627_045548_338_1312 293
62 3300046471 Ga0495650_0008771 Ga0495650_0008771_4220_5194 293
63 3300046491 Ga0495584_0001138 Ga0495584_0001138_4544_5518 293
64 3300046507 Ga0495606_0001476 Ga0495606_0001476_19970_20944 293
65 3300046515 Ga0495620_0000327 Ga0495620_0000327_12496_13470 293
66 3300046518 Ga0495631_0007222 Ga0495631_0007222_1074_2048 293
67 3300046519 Ga0495632_0016341 Ga0495632_0016341_935_1909 293
68 3300046520 Ga0495637_0000415 Ga0495637_0000415_10400_11374 293
69 3300046538 Ga0495609_0000454 Ga0495609_0000454_12506_13480 293
70 3300046558 Ga0495633_0045576 Ga0495633_0045576_555_1466 293
71 3300046616 Ga0495668_0047205 Ga0495668_0047205_1128_2102 293
72 3300046660 Ga0495625_0036033 Ga0495625_0036033_485_1459 293
73 3300046794 Ga0495589_0000423 Ga0495589_0000423_10422_11396 293
74 3300046810 Ga0495660_0020262 Ga0495660_0020262_1927_2901 293
75 3300047470 Ga0495681_0000465 Ga0495681_0000465_10413_11387 293
76 3300048929 Ga0496126_0296787 Ga0496126_0296787_176_1132 293
77 3300049459 Ga0495678_003391 Ga0495678_003391_6856_7830 293
78 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001142 294
79 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001137 294
80 3300003751 Ga0055538_1000001 Ga0055538_1000001895 294
81 3300003752 Ga0055539_1000001 Ga0055539_1000001895 294
82 3300003756 Ga0055533_1000003 Ga0055533_1000003137 294
83 3300003759 Ga0055525_1000003 Ga0055525_1000003137 294
84 3300003841 Ga0055541_1000001 Ga0055541_1000001137 294
85 3300005327 Ga0070658_10001681 Ga0070658_100016816 294
86 3300005337 Ga0070682_100004217 Ga0070682_1000042172 294
87 3300005339 Ga0070660_100001715 Ga0070660_1000017157 294
88 3300005339 Ga0070660_100018389 Ga0070660_1000183894 294
89 3300005339 Ga0070660_100159721 Ga0070660_1001597212 294
90 3300005366 Ga0070659_100001127 Ga0070659_1000011276 294
91 3300005366 Ga0070659_100003938 Ga0070659_1000039387 294
92 3300005458 Ga0070681_10001450 Ga0070681_1000145010 294
93 3300005546 Ga0070696_100006153 Ga0070696_1000061532 294
94 3300005548 Ga0070665_100000339 Ga0070665_10000033914 294
95 3300005563 Ga0068855_100005501 Ga0068855_10000550111 294
96 3300005843 Ga0068860_100186670 Ga0068860_1001866702 294
97 3300009551 Ga0105238_10076968 Ga0105238_100769683 294
98 3300013100 Ga0157373_10001895 Ga0157373_1000189511 294
99 3300013102 Ga0157371_10006733 Ga0157371_100067333 294
100 3300013102 Ga0157371_10009702 Ga0157371_100097022 294
101 3300013104 Ga0157370_10025065 Ga0157370_100250654 294
102 3300013105 Ga0157369_10003308 Ga0157369_100033086 294
103 3300013307 Ga0157372_10020856 Ga0157372_100208562 294
104 3300014497 Ga0182008_10000209 Ga0182008_1000020923 294
105 3300014497 Ga0182008_10004934 Ga0182008_100049344 294
106 3300014497 Ga0182008_10008788 Ga0182008_100087884 294
107 3300015261 Ga0182006_1003878 Ga0182006_10038782 294
108 3300015262 Ga0182007_10012843 Ga0182007_100128433 294
109 3300015262 Ga0182007_10014042 Ga0182007_100140423 294
110 3300025224 Ga0209784_100004 Ga0209784_100004137 294
111 3300025225 Ga0209566_100004 Ga0209566_100004294 294
112 3300025226 Ga0209674_100006 Ga0209674_100006294 294
113 3300025230 Ga0209563_100009 Ga0209563_100009137 294
114 3300025231 Ga0207427_100606 Ga0207427_1006069 294
115 3300025233 Ga0209437_100004 Ga0209437_100004137 294
116 3300025253 Ga0209677_100005 Ga0209677_100005137 294
117 3300025256 Ga0209759_1001656 Ga0209759_10016568 294
118 3300025261 Ga0209233_1000005 Ga0209233_1000005294 294
119 3300025912 Ga0207707_10013368 Ga0207707_100133684 294
120 3300025919 Ga0207657_10004562 Ga0207657_100045627 294
121 3300025919 Ga0207657_10028360 Ga0207657_100283603 294
122 3300025919 Ga0207657_10192738 Ga0207657_101927382 294
123 3300025924 Ga0207694_10047080 Ga0207694_100470802 294
124 3300025932 Ga0207690_10000875 Ga0207690_1000087511 294
125 3300025932 Ga0207690_10010419 Ga0207690_100104192 294
126 3300025932 Ga0207690_10024891 Ga0207690_100248912 294
127 3300025949 Ga0207667_10003022 Ga0207667_1000302211 294
128 3300028379 Ga0268266_10000004 Ga0268266_10000004251 294
129 3300031901 Ga0307406_10088236 Ga0307406_100882362 294
130 3300032002 Ga0307416_100223067 Ga0307416_1002230672 294
131 3300046660 Ga0495625_0113204 Ga0495625_0113204_402_1316 294
132 3300053090 Ga0500646_0006619 Ga0500646_0006619_1784_2698 294
133 3300005329 Ga0070683_100246840 Ga0070683_1002468401 295
134 3300005344 Ga0070661_100417913 Ga0070661_1004179131 295
135 3300005455 Ga0070663_100177686 Ga0070663_1001776862 295
136 3300005457 Ga0070662_100202679 Ga0070662_1002026791 295
137 3300005564 Ga0070664_100104004 Ga0070664_1001040042 295
138 3300005578 Ga0068854_100348375 Ga0068854_1003483751 295
139 3300005616 Ga0068852_100362742 Ga0068852_1003627421 295
140 3300005842 Ga0068858_100049264 Ga0068858_1000492643 295
141 3300009545 Ga0105237_10329147 Ga0105237_103291472 295
142 3300009551 Ga0105238_10242879 Ga0105238_102428792 295
143 3300010375 Ga0105239_10268257 Ga0105239_102682572 295
144 3300025913 Ga0207695_10036608 Ga0207695_100366082 295
145 3300025914 Ga0207671_10030435 Ga0207671_100304352 295
146 3300025920 Ga0207649_10067120 Ga0207649_100671202 295
147 3300025924 Ga0207694_10023575 Ga0207694_100235752 295
148 3300025933 Ga0207706_10092890 Ga0207706_100928903 295
149 3300025940 Ga0207691_10209668 Ga0207691_102096682 295
150 3300026067 Ga0207678_10237604 Ga0207678_102376042 295
151 3300026116 Ga0207674_10337841 Ga0207674_103378412 295
152 3300026142 Ga0207698_10339227 Ga0207698_103392271 295
153 3300041512 Ga0451853_1791667 Ga0451853_1791667_193_1122 295
154 3300047318 Ga0495636_0001464 Ga0495636_0001464_5657_6574 295
155 3300047472 Ga0495686_0001834 Ga0495686_0001834_8609_9526 295
156 3300048917 Ga0496114_0032620 Ga0496114_0032620_1730_2662 295
157 3300048929 Ga0496126_0005156 Ga0496126_0005156_12643_13575 295
158 3300031727 Ga0316576_10095760 Ga0316576_100957603 296
159 3300031733 Ga0316577_10091101 Ga0316577_100911012 296
160 3300032168 Ga0316593_10039024 Ga0316593_100390242 296
161 3300033524 Ga0316592_1007859 Ga0316592_10078592 296
162 3300033528 Ga0316588_1001155 Ga0316588_10011553 296
163 3300036712 Ga0316584_0149587 Ga0316584_0149587_694_1659 296
164 3300041404 Ga0439436_0000066 Ga0439436_0000066_20216_21136 296
165 3300041405 Ga0439438_000141 Ga0439438_000141_20289_21269 296
166 3300046512 Ga0495610_0001679 Ga0495610_0001679_2451_3371 296
167 3300046525 Ga0495663_0001242 Ga0495663_0001242_819_1739 296
168 3300003322 rootL2_10261658 rootL2_102616582 297
169 3300046516 Ga0495628_0000328 Ga0495628_0000328_15578_16519 297
170 3300046529 Ga0495652_0003121 Ga0495652_0003121_12376_13317 297
171 3300046679 Ga0495623_0004430 Ga0495623_0004430_2783_3724 297
172 3300048088 Ga0495602_0006066 Ga0495602_0006066_3260_4201 297
173 2162886007 SwRhRL2b_contig_3350539 SwRhRL2b_0383.00001260 298
174 3300005289 Ga0065704_10070432 Ga0065704_100704327 298
175 3300005471 Ga0070698_100489174 Ga0070698_1004891741 298
176 3300013105 Ga0157369_10006769 Ga0157369_100067694 298
177 3300014497 Ga0182008_10019748 Ga0182008_100197482 298
178 3300014497 Ga0182008_10036436 Ga0182008_100364362 298
179 3300015262 Ga0182007_10000393 Ga0182007_1000039322 298
180 3300015262 Ga0182007_10003153 Ga0182007_100031534 298
181 3300015262 Ga0182007_10008147 Ga0182007_100081474 298
182 3300031852 Ga0307410_10037060 Ga0307410_100370603 298
183 3300031911 Ga0307412_10000422 Ga0307412_1000042213 298
184 3300033180 Ga0307510_10001023 Ga0307510_100010239 298
185 3300037466 Ga0395898_0136043 Ga0395898_0136043_1354_2289 298
186 3300046462 Ga0495651_0032474 Ga0495651_0032474_370_1374 298
187 3300046463 Ga0495653_0036996 Ga0495653_0036996_2484_3488 298
188 3300046471 Ga0495650_0000074 Ga0495650_0000074_57756_58694 298
189 3300046529 Ga0495652_0016855 Ga0495652_0016855_561_1505 298
190 3300046529 Ga0495652_0038739 Ga0495652_0038739_380_1384 298
191 3300046616 Ga0495668_0005687 Ga0495668_0005687_5603_6535 298
192 3300046675 Ga0495657_0046724 Ga0495657_0046724_16_1020 298
193 3300046680 Ga0495646_0000600 Ga0495646_0000600_17161_18105 298
194 3300046809 Ga0495600_0000812 Ga0495600_0000812_2725_3729 298
195 3300046810 Ga0495660_0000348 Ga0495660_0000348_21008_21940 298
196 3300047469 Ga0495673_0000036 Ga0495673_0000036_283176_284108 298
197 3300047472 Ga0495686_0000033 Ga0495686_0000033_110381_111313 298
198 3300048088 Ga0495602_0008761 Ga0495602_0008761_6813_7817 298
199 3300048088 Ga0495602_0168856 Ga0495602_0168856_579_1523 298
200 3300048921 Ga0496118_0002465 Ga0496118_0002465_16390_17322 298
201 3300053077 Ga0495601_0074457 Ga0495601_0074457_663_1667 298
202 3300053141 Ga0500574_000211 Ga0500574_000211_649_1653 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

54

314

0.92

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

24

250

0.9

PF04321

RmlD_sub_bind

RmlD substrate binding domain

21

183

0.86

PF07993

NAD_binding_4

Male sterility protein

62

219

0.84

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

53

313

0.8

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

54

271

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x3b-assembly1.cif.gz_A structure of rmd from pseudomonas aeruginosa complexed with nadph 0.9259 5 296
6x3b-assembly2.cif.gz_C structure of rmd from pseudomonas aeruginosa complexed with nadph 0.9237 7 294
6x3b-assembly1.cif.gz_B structure of rmd from pseudomonas aeruginosa complexed with nadph 0.9218 6 296
6x3b-assembly2.cif.gz_C structure of rmd from pseudomonas aeruginosa complexed with nadph 0.9143 7 294
6x3b-assembly2.cif.gz_D structure of rmd from pseudomonas aeruginosa complexed with nadph 0.9123 6 295
ID Description Score Start End Superfamily
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8866 7 251 3.40.50.720
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8735 5 297 3.40.50.720
1vl0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8727 8 234 3.40.50.720
af_A0A1D6KLI4_51_197_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8724 60 173 3.40.50.720
2pk3B02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8594 172 295 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A7C5ZMY9-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.96 89 297
AF-A0A3D5CMB6-F1-model_v4 GDP-mannose 4,6-dehydratase 0.9559 7 235
AF-X1QG26-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9532 133 251
AF-A0A7X2NBZ8-F1-model_v4 deleted 0.9515 5 295
AF-A0A625RB69-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9502 43 171 GO:0008446
GO:0042351

Feature Viewer

pLDDT pTM Quality
92.81 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map