F309681

General Info

Members Datasets Scaffolds Average Seq Length
202 145 404 162

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10177768|Ga0075364_101777682
Length 181
Sequence VSRSAEARDEMYVDYVAARQAHLRRIAYAVCGDWHRADDLLQTALTKLYVAWPRVHRDGSPDAYVRRIIVRTSIDESRRPWRRERSGLDGHDRAAETGLPVEERSALFEALQALPEMQRKVVVLRHWLGLSVEETASELRISAGTVKSHSSRGLSSLQRALQQVELEEPTAAAQGRPRRTT

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
84 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
85 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
86 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
87 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
125 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
136 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
137 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
140 2643221561 Nocardioides sp. Root151 Isolate Unclassified
141 2643221615 Nocardioides sp. Root224 Isolate Unclassified
142 2643221641 Nocardioides sp. Root122 Isolate Unclassified
143 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
144 2643221696 Nocardioides sp. Root140 Isolate Unclassified
145 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 0
Isolates 2.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.81
Nodule 0
Rhizoplane 4.95
Rhizosphere 70.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10177768 3300006051 Bacteria 1440
2 JGI25407J50210_10040611 3300003373 Bacteria 1192
3 Ga0070658_10033813 3300005327 Bacteria 4114
4 Ga0070683_100002429 3300005329 Bacteria 14809
5 Ga0068869_100594469 3300005334 Bacteria 934
6 Ga0070682_100011860 3300005337 Bacteria 4986
7 Ga0070660_100894778 3300005339 Bacteria 748
8 Ga0070661_100075101 3300005344 Bacteria 2490
9 Ga0070692_10014634 3300005345 Bacteria 3691
10 Ga0070668_100324522 3300005347 Bacteria 1297
11 Ga0070675_101022057 3300005354 Bacteria 759
12 Ga0070671_100389157 3300005355 Bacteria 1192
13 Ga0070659_100058056 3300005366 Bacteria 3053
14 Ga0070667_100150363 3300005367 Bacteria 2045
15 Ga0070678_100366603 3300005456 Bacteria 1243
16 Ga0070678_101336267 3300005456 Bacteria 668
17 Ga0070685_11261273 3300005466 Bacteria 563
18 Ga0070684_100013821 3300005535 Bacteria 6519
19 Ga0070672_101218155 3300005543 Bacteria 671
20 Ga0070693_100226696 3300005547 Bacteria 1227
21 Ga0070665_100001394 3300005548 Bacteria 28474
22 Ga0070665_100185160 3300005548 Bacteria 2083
23 Ga0068855_100152923 3300005563 Bacteria 2623
24 Ga0068856_100030007 3300005614 Bacteria 5314
25 Ga0070702_100461632 3300005615 Bacteria 924
26 Ga0068852_100239884 3300005616 Bacteria 1732
27 Ga0068864_100033302 3300005618 Bacteria 4381
28 Ga0068866_10072694 3300005718 Bacteria 1823
29 Ga0068861_101462807 3300005719 Bacteria 669
30 Ga0068863_101193052 3300005841 Bacteria 767
31 Ga0068858_100125591 3300005842 Bacteria 2402
32 Ga0068860_102292877 3300005843 Bacteria 560
33 Ga0081455_10000201 3300005937 Bacteria 76008
34 Ga0081455_10009834 3300005937 Bacteria 9795
35 Ga0081455_10427907 3300005937 Bacteria 911
36 Ga0081538_10018605 3300005981 Bacteria 5207
37 Ga0081538_10033389 3300005981 Bacteria 3427
38 Ga0075365_10012946 3300006038 Bacteria 4973
39 Ga0075365_10044109 3300006038 Bacteria 2921
40 Ga0075365_10075086 3300006038 Bacteria 2281
41 Ga0075365_10563584 3300006038 Bacteria 806
42 Ga0075365_10627936 3300006038 Bacteria 760
43 Ga0075365_10814253 3300006038 Bacteria 659
44 Ga0075368_10237851 3300006042 Bacteria 776
45 Ga0075363_100022991 3300006048 Bacteria 3155
46 Ga0075363_100090853 3300006048 Bacteria 1680
47 Ga0075363_100141839 3300006048 Bacteria 1353
48 Ga0075364_10016540 3300006051 Bacteria 4590
49 Ga0075364_10431381 3300006051 Bacteria 900
50 Ga0075367_10366998 3300006178 Bacteria 909
51 Ga0075367_10375717 3300006178 Bacteria 898
52 Ga0097621_100442574 3300006237 Bacteria 1170
53 Ga0097621_100883745 3300006237 Bacteria 832
54 Ga0075370_10050958 3300006353 Bacteria 2348
55 Ga0075370_10059512 3300006353 Bacteria 2174
56 Ga0075370_10309637 3300006353 Bacteria 940
57 Ga0075370_10369764 3300006353 Bacteria 858
58 Ga0075430_100016425 3300006846 Bacteria 6302
59 Ga0075430_100035442 3300006846 Bacteria 4233
60 Ga0075430_100812721 3300006846 Bacteria 770
61 Ga0075431_100003956 3300006847 Bacteria 14435
62 Ga0075431_100026004 3300006847 Bacteria 6000
63 Ga0068865_101089177 3300006881 Bacteria 703
64 Ga0105245_10003081 3300009098 Bacteria 14922
65 Ga0105242_10368495 3300009176 Bacteria 1331
66 Ga0105249_10135832 3300009553 Bacteria 2353
67 Ga0105239_10028118 3300010375 Bacteria 6187
68 Ga0105246_10001965 3300011119 Bacteria 12389
69 Ga0157371_10166084 3300013102 Bacteria 1576
70 Ga0157369_10063144 3300013105 Bacteria 3991
71 Ga0157374_10589826 3300013296 Bacteria 1121
72 Ga0163162_10463177 3300013306 Bacteria 1399
73 Ga0157372_10006032 3300013307 Bacteria 12871
74 Ga0157375_10002144 3300013308 Bacteria 17045
75 Ga0157375_10146475 3300013308 Bacteria 2492
76 Ga0163163_11000086 3300014325 Bacteria 899
77 Ga0163163_11299379 3300014325 Bacteria 789
78 Ga0163161_10128264 3300017792 Bacteria 1911
79 Ga0207642_10066191 3300025899 Bacteria 1701
80 Ga0207647_10028581 3300025904 Bacteria 3619
81 Ga0207649_10278439 3300025920 Bacteria 1215
82 Ga0207659_10558762 3300025926 Bacteria 973
83 Ga0207644_11210326 3300025931 Bacteria 635
84 Ga0207690_10055758 3300025932 Bacteria 2663
85 Ga0207711_10797592 3300025941 Bacteria 880
86 Ga0207689_10605370 3300025942 Bacteria 922
87 Ga0207661_10039273 3300025944 Bacteria 3714
88 Ga0207712_11329343 3300025961 Bacteria 643
89 Ga0207640_11523386 3300025981 Bacteria 601
90 Ga0207703_10140502 3300026035 Bacteria 2095
91 Ga0207641_11699127 3300026088 Bacteria 633
92 Ga0207676_10110867 3300026095 Bacteria 2296
93 Ga0207683_10299848 3300026121 Bacteria 1470
94 Ga0207698_10246980 3300026142 Bacteria 1630
95 Ga0209813_10177959 3300027866 Bacteria 776
96 Ga0207428_10006783 3300027907 Bacteria 10500
97 Ga0268264_12108189 3300028381 Bacteria 572
98 Ga0307408_101359340 3300031548 Bacteria 667
99 Ga0307405_10093384 3300031731 Bacteria 1999
100 Ga0307413_10107450 3300031824 Bacteria 1860
101 Ga0307410_10386215 3300031852 Bacteria 1128
102 Ga0307412_10431765 3300031911 Bacteria 1080
103 Ga0307412_10887531 3300031911 Bacteria 780
104 Ga0307409_100396577 3300031995 Bacteria 1317
105 Ga0307409_100466013 3300031995 Bacteria 1223
106 Ga0307409_100808167 3300031995 Bacteria 946
107 Ga0307416_100256020 3300032002 Bacteria 1707
108 Ga0307414_10387475 3300032004 Bacteria 1210
109 Ga0307415_100308372 3300032126 Bacteria 1314
110 Ga0451791_1554295 3300041451 Bacteria 588
111 Ga0451802_2079252 3300041460 Bacteria 750
112 Ga0451807_2654885 3300041486 Bacteria 665
113 Ga0451837_0240100 3300041494 Bacteria 1480
114 Ga0451837_1050200 3300041494 Bacteria 946
115 Ga0451843_1377571 3300041509 Bacteria 1700
116 Ga0451853_1075490 3300041512 Bacteria 712
117 Ga0451853_1651318 3300041512 Bacteria 847
118 Ga0466965_0032647 3300044683 Bacteria 2542
119 Ga0466970_0181399 3300044765 Bacteria 1168
120 Ga0466960_0000259 3300044901 Bacteria 18187
121 Ga0451576_0187422 3300045051 Bacteria 2160
122 Ga0466967_0884301 3300045976 Bacteria 888
123 Ga0495657_0435875 3300046675 Bacteria 768
124 Ga0495658_0087813 3300046683 Bacteria 1837
125 Ga0496103_0080761 3300048906 Bacteria 2045
126 Ga0496109_0012328 3300048912 Bacteria 7380
127 Ga0496109_0924190 3300048912 Bacteria 810
128 Ga0496110_0086838 3300048913 Bacteria 2793
129 Ga0496111_0001345 3300048914 Bacteria 13887
130 Ga0496114_0026082 3300048917 Bacteria 4782
131 Ga0496114_0076806 3300048917 Bacteria 2815
132 Ga0501031_0651166 3300049568 Bacteria 677
133 Ga0501033_0625809 3300049570 Bacteria 737
134 Ga0501034_0071121 3300049571 Bacteria 3489
135 Ga0501034_0120250 3300049571 Bacteria 2613
136 Ga0501034_0157629 3300049571 Bacteria 2243
137 Ga0501039_0353782 3300049575 Bacteria 1154
138 Ga0501041_0872906 3300049577 Bacteria 578
139 Ga0501042_0357243 3300049578 Bacteria 1057
140 Ga0501047_0213423 3300049581 Bacteria 1788
141 Ga0501067_0000687 3300049583 Bacteria 18200
142 Ga0501067_0060982 3300049583 Bacteria 2087
143 Ga0501068_0426572 3300049584 Bacteria 856
144 Ga0501069_0029413 3300049585 Bacteria 3015
145 Ga0501069_0040777 3300049585 Bacteria 2566
146 Ga0501070_0044008 3300049586 Bacteria 3715
147 Ga0501070_0190333 3300049586 Bacteria 1687
148 Ga0501070_0267234 3300049586 Bacteria 1397
149 Ga0501071_0382486 3300049587 Bacteria 1073
150 Ga0501072_0108152 3300049588 Bacteria 2212
151 Ga0501072_0246729 3300049588 Bacteria 1422
152 Ga0501072_0479297 3300049588 Bacteria 984
153 Ga0501073_0030217 3300049589 Bacteria 3869
154 Ga0501073_0041062 3300049589 Bacteria 3269
155 Ga0501074_0003099 3300049590 Bacteria 11717
156 Ga0501074_0029033 3300049590 Bacteria 4006
157 Ga0501074_0038361 3300049590 Bacteria 3473
158 Ga0501079_0017782 3300049741 Bacteria 5433
159 Ga0501079_0810689 3300049741 Bacteria 737
160 Ga0501079_0855110 3300049741 Bacteria 716
161 Ga0501080_0015690 3300049742 Bacteria 6984
162 Ga0501080_0063619 3300049742 Bacteria 3433
163 Ga0501080_0451240 3300049742 Bacteria 1153
164 Ga0501083_0008493 3300049744 Bacteria 7252
165 Ga0501035_0231594 3300049822 Bacteria 1574
166 Ga0501045_0290659 3300049824 Bacteria 1216
167 nmdc:mga03n38_116379_c1 3300050490 Bacteria 1308
168 nmdc:mga03n38_98777_c1 3300050490 Bacteria 1405
169 nmdc:mga00v17_18940_c1 3300050491 Bacteria 3919
170 nmdc:mga00v17_306281_c1 3300050491 Bacteria 1032
171 nmdc:mga00v17_51412_c1 3300050491 Bacteria 2506
172 nmdc:mga0yw44_347260_c1 3300050492 Bacteria 998
173 nmdc:mga0yw44_9021_c1 3300050492 Bacteria 5013
174 nmdc:mga06z11_191698_c1 3300050494 Bacteria 1183
175 nmdc:mga06z11_205889_c1 3300050494 Bacteria 1144
176 nmdc:mga04h51_204779_c1 3300050495 Bacteria 776
177 nmdc:mga07m45_25677_c1 3300050496 Bacteria 3233
178 nmdc:mga07m45_35645_c1 3300050496 Bacteria 2768
179 nmdc:mga07m45_399928_c1 3300050496 Bacteria 797
180 nmdc:mga07m45_418760_c1 3300050496 Bacteria 777
181 nmdc:mga05p37_370_c1 3300050507 Bacteria 48311
182 nmdc:mga09592_735_c1 3300050508 Bacteria 25241
183 nmdc:mga0qj67_34716_c1 3300050509 Bacteria 3941
184 nmdc:mga0qj67_76392_c1 3300050509 Bacteria 2679
185 nmdc:mga06r32_292_c1 3300050510 Bacteria 41600
186 nmdc:mga06r32_5063_c1 3300050510 Bacteria 11871
187 nmdc:mga08y16_7864_c1 3300050511 Bacteria 11162
188 nmdc:mga0a205_536102_c1 3300050515 Bacteria 1026
189 Ga0495595_0051860 3300053084 Bacteria 1902
190 Ga0500644_0000014 3300053088 Bacteria 109650
191 Ga0500554_001951 3300053102 Bacteria 4003
192 Ga0500593_000621 3300053117 Bacteria 13657
193 Ga0500604_0164592 3300053151 Bacteria 757
194 Ga0501082_0534691 3300060353 Bacteria 1025
195 Ga0501082_0776178 3300060353 Bacteria 838
196 Ga0530510_0673815 3300061734 Bacteria 788
197 2643827155 2643221561 Bacteria 4984412
198 2644092928 2643221615 Bacteria 5487866
199 2644228343 2643221641 Bacteria 4490190
200 2644322541 2643221657 Bacteria 5490246
201 2644534013 2643221696 Bacteria 5431823
202 2855388800 2855386786 Bacteria 4752232
203 Ga0075364_10177768
204 JGI25407J50210_10040611
205 Ga0070658_10033813
206 Ga0070683_100002429
207 Ga0068869_100594469
208 Ga0070682_100011860
209 Ga0070660_100894778
210 Ga0070661_100075101
211 Ga0070692_10014634
212 Ga0070668_100324522
213 Ga0070675_101022057
214 Ga0070671_100389157
215 Ga0070659_100058056
216 Ga0070667_100150363
217 Ga0070678_100366603
218 Ga0070678_101336267
219 Ga0070685_11261273
220 Ga0070684_100013821
221 Ga0070672_101218155
222 Ga0070693_100226696
223 Ga0070665_100001394
224 Ga0070665_100185160
225 Ga0068855_100152923
226 Ga0068856_100030007
227 Ga0070702_100461632
228 Ga0068852_100239884
229 Ga0068864_100033302
230 Ga0068866_10072694
231 Ga0068861_101462807
232 Ga0068863_101193052
233 Ga0068858_100125591
234 Ga0068860_102292877
235 Ga0081455_10000201
236 Ga0081455_10009834
237 Ga0081455_10427907
238 Ga0081538_10018605
239 Ga0081538_10033389
240 Ga0075365_10012946
241 Ga0075365_10044109
242 Ga0075365_10075086
243 Ga0075365_10563584
244 Ga0075365_10627936
245 Ga0075365_10814253
246 Ga0075368_10237851
247 Ga0075363_100022991
248 Ga0075363_100090853
249 Ga0075363_100141839
250 Ga0075364_10016540
251 Ga0075364_10431381
252 Ga0075367_10366998
253 Ga0075367_10375717
254 Ga0097621_100442574
255 Ga0097621_100883745
256 Ga0075370_10050958
257 Ga0075370_10059512
258 Ga0075370_10309637
259 Ga0075370_10369764
260 Ga0075430_100016425
261 Ga0075430_100035442
262 Ga0075430_100812721
263 Ga0075431_100003956
264 Ga0075431_100026004
265 Ga0068865_101089177
266 Ga0105245_10003081
267 Ga0105242_10368495
268 Ga0105249_10135832
269 Ga0105239_10028118
270 Ga0105246_10001965
271 Ga0157371_10166084
272 Ga0157369_10063144
273 Ga0157374_10589826
274 Ga0163162_10463177
275 Ga0157372_10006032
276 Ga0157375_10002144
277 Ga0157375_10146475
278 Ga0163163_11000086
279 Ga0163163_11299379
280 Ga0163161_10128264
281 Ga0207642_10066191
282 Ga0207647_10028581
283 Ga0207649_10278439
284 Ga0207659_10558762
285 Ga0207644_11210326
286 Ga0207690_10055758
287 Ga0207711_10797592
288 Ga0207689_10605370
289 Ga0207661_10039273
290 Ga0207712_11329343
291 Ga0207640_11523386
292 Ga0207703_10140502
293 Ga0207641_11699127
294 Ga0207676_10110867
295 Ga0207683_10299848
296 Ga0207698_10246980
297 Ga0209813_10177959
298 Ga0207428_10006783
299 Ga0268264_12108189
300 Ga0307408_101359340
301 Ga0307405_10093384
302 Ga0307413_10107450
303 Ga0307410_10386215
304 Ga0307412_10431765
305 Ga0307412_10887531
306 Ga0307409_100396577
307 Ga0307409_100466013
308 Ga0307409_100808167
309 Ga0307416_100256020
310 Ga0307414_10387475
311 Ga0307415_100308372
312 Ga0451791_1554295
313 Ga0451802_2079252
314 Ga0451807_2654885
315 Ga0451837_0240100
316 Ga0451837_1050200
317 Ga0451843_1377571
318 Ga0451853_1075490
319 Ga0451853_1651318
320 Ga0466965_0032647
321 Ga0466970_0181399
322 Ga0466960_0000259
323 Ga0451576_0187422
324 Ga0466967_0884301
325 Ga0495657_0435875
326 Ga0495658_0087813
327 Ga0496103_0080761
328 Ga0496109_0012328
329 Ga0496109_0924190
330 Ga0496110_0086838
331 Ga0496111_0001345
332 Ga0496114_0026082
333 Ga0496114_0076806
334 Ga0501031_0651166
335 Ga0501033_0625809
336 Ga0501034_0071121
337 Ga0501034_0120250
338 Ga0501034_0157629
339 Ga0501039_0353782
340 Ga0501041_0872906
341 Ga0501042_0357243
342 Ga0501047_0213423
343 Ga0501067_0000687
344 Ga0501067_0060982
345 Ga0501068_0426572
346 Ga0501069_0029413
347 Ga0501069_0040777
348 Ga0501070_0044008
349 Ga0501070_0190333
350 Ga0501070_0267234
351 Ga0501071_0382486
352 Ga0501072_0108152
353 Ga0501072_0246729
354 Ga0501072_0479297
355 Ga0501073_0030217
356 Ga0501073_0041062
357 Ga0501074_0003099
358 Ga0501074_0029033
359 Ga0501074_0038361
360 Ga0501079_0017782
361 Ga0501079_0810689
362 Ga0501079_0855110
363 Ga0501080_0015690
364 Ga0501080_0063619
365 Ga0501080_0451240
366 Ga0501083_0008493
367 Ga0501035_0231594
368 Ga0501045_0290659
369 nmdc:mga03n38_116379_c1
370 nmdc:mga03n38_98777_c1
371 nmdc:mga00v17_18940_c1
372 nmdc:mga00v17_306281_c1
373 nmdc:mga00v17_51412_c1
374 nmdc:mga0yw44_347260_c1
375 nmdc:mga0yw44_9021_c1
376 nmdc:mga06z11_191698_c1
377 nmdc:mga06z11_205889_c1
378 nmdc:mga04h51_204779_c1
379 nmdc:mga07m45_25677_c1
380 nmdc:mga07m45_35645_c1
381 nmdc:mga07m45_399928_c1
382 nmdc:mga07m45_418760_c1
383 nmdc:mga05p37_370_c1
384 nmdc:mga09592_735_c1
385 nmdc:mga0qj67_34716_c1
386 nmdc:mga0qj67_76392_c1
387 nmdc:mga06r32_292_c1
388 nmdc:mga06r32_5063_c1
389 nmdc:mga08y16_7864_c1
390 nmdc:mga0a205_536102_c1
391 Ga0495595_0051860
392 Ga0500644_0000014
393 Ga0500554_001951
394 Ga0500593_000621
395 Ga0500604_0164592
396 Ga0501082_0534691
397 Ga0501082_0776178
398 Ga0530510_0673815
399 2643827155
400 2644092928
401 2644228343
402 2644322541
403 2644534013
404 2855388800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

110

159

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

104

157

0.94

PF04542

Sigma70_r2

Sigma-70 region 2

15

83

0.93

PF07638

Sigma70_ECF

ECF sigma factor

3

167

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bhy-assembly1.cif.gz_B dna-binding domain of deor in complex with the dna operator 0.9688 116 152
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9426 105 163
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9416 100 163
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9385 99 158
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9368 99 157
ID Description Score Start End Superfamily
af_O06371_1_115_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9416 118 151 1.10.10.60
4l5jC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9408 116 153 1.10.10.10
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9385 99 158 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9368 99 157 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9328 99 158 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2H5ASB6-F1-model_v4 RNA polymerase sigma24 factor 0.9326 7 161 GO:0003677
GO:0006352
GO:0016987
AF-A0A5Q0H0K7-F1-model_v4 SigE family RNA polymerase sigma factor 0.9275 6 161 GO:0003677
GO:0006352
GO:0016987
AF-A0A077MEI1-F1-model_v4 RNA polymerase sigma-E factor 0.9241 12 161 GO:0003677
GO:0006352
GO:0016987
AF-A0A1Q4YA21-F1-model_v4 RNA polymerase subunit sigma-24 0.9224 6 165 GO:0003677
GO:0006352
GO:0016987
AF-A0A543KPX3-F1-model_v4 RNA polymerase sigma-70 factor (Sigma-E family) 0.921 11 165 GO:0003677
GO:0006352
GO:0016987

Map