F309665
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 202 | 133 | 194 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10000938|Ga0081539_1000093822 |
| Length | 172 |
| Sequence | VAAVCVFCASSTTLEQRWLDLAAETGRELAARGHTLVSGGGCVGMMGAVAGIPQTLVDREVADTNADELVVTGDMGARKNLMIERSDAFITLPGGLGTLDELFEVWTTATLRLHRKPIVLLDPDGFYDGLLAWLGKLAETEFVRRPALEVVTVVSSVPAAFDAIDPAHTTSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 2 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 3 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 4 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 5 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 6 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 7 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 88 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 89 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 90 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 91 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 92 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 93 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 94 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 95 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 96 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 97 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 98 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 99 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 100 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 101 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 102 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 103 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 104 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 105 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 106 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 112 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 113 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 114 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 121 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 130 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 131 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 132 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 133 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.54 |
| Metatranscriptomes | 0.5 |
| Isolates | 3.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.98 |
| Nodule | 0 |
| Rhizoplane | 1.98 |
| Rhizosphere | 84.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10190814 | 3300003322 | Bacteria | 4113 |
| 2 | Ga0070658_10031138 | 3300005327 | Bacteria | 4283 |
| 3 | Ga0070676_10012368 | 3300005328 | Bacteria | 4656 |
| 4 | Ga0070683_100006016 | 3300005329 | Bacteria | 10167 |
| 5 | Ga0068869_100309904 | 3300005334 | Bacteria | 1277 |
| 6 | Ga0068869_100684700 | 3300005334 | Bacteria | 873 |
| 7 | Ga0070680_100764606 | 3300005336 | Bacteria | 832 |
| 8 | Ga0068868_100039531 | 3300005338 | Bacteria | 3666 |
| 9 | Ga0070661_100026894 | 3300005344 | Bacteria | 4141 |
| 10 | Ga0070661_100039972 | 3300005344 | Bacteria | 3419 |
| 11 | Ga0070692_10014930 | 3300005345 | Bacteria | 3661 |
| 12 | Ga0070668_100000772 | 3300005347 | Bacteria | 22052 |
| 13 | Ga0070668_100534014 | 3300005347 | Bacteria | 1019 |
| 14 | Ga0070669_101411802 | 3300005353 | Bacteria | 604 |
| 15 | Ga0070675_100002456 | 3300005354 | Bacteria | 13858 |
| 16 | Ga0070659_100053887 | 3300005366 | Bacteria | 3167 |
| 17 | Ga0070667_100297437 | 3300005367 | Bacteria | 1453 |
| 18 | Ga0070713_100194499 | 3300005436 | Bacteria | 1829 |
| 19 | Ga0070700_100011290 | 3300005441 | Bacteria | 4945 |
| 20 | Ga0070678_100223598 | 3300005456 | Bacteria | 1566 |
| 21 | Ga0070662_100015343 | 3300005457 | Bacteria | 5129 |
| 22 | Ga0070681_10310116 | 3300005458 | Bacteria | 1487 |
| 23 | Ga0070681_10918247 | 3300005458 | Bacteria | 794 |
| 24 | Ga0070679_100320470 | 3300005530 | Bacteria | 1499 |
| 25 | Ga0070684_100002719 | 3300005535 | Bacteria | 13068 |
| 26 | Ga0070684_100351618 | 3300005535 | Bacteria | 1355 |
| 27 | Ga0070664_100004061 | 3300005564 | Bacteria | 11759 |
| 28 | Ga0070664_100469635 | 3300005564 | Bacteria | 1157 |
| 29 | Ga0068857_100061825 | 3300005577 | Bacteria | 3328 |
| 30 | Ga0068857_100501429 | 3300005577 | Bacteria | 1139 |
| 31 | Ga0070702_100050441 | 3300005615 | Bacteria | 2377 |
| 32 | Ga0068859_100166532 | 3300005617 | Bacteria | 2284 |
| 33 | Ga0068861_100388516 | 3300005719 | Bacteria | 1235 |
| 34 | Ga0068861_101169245 | 3300005719 | Bacteria | 742 |
| 35 | Ga0068858_100535448 | 3300005842 | Bacteria | 1133 |
| 36 | Ga0068862_100105351 | 3300005844 | Bacteria | 2472 |
| 37 | Ga0068862_100204440 | 3300005844 | Bacteria | 1782 |
| 38 | Ga0081455_10146576 | 3300005937 | Bacteria | 1825 |
| 39 | Ga0081540_1000837 | 3300005983 | Bacteria | 28052 |
| 40 | Ga0081540_1016696 | 3300005983 | Bacteria | 4578 |
| 41 | Ga0081539_10000938 | 3300005985 | Bacteria | 54684 |
| 42 | Ga0081539_10001138 | 3300005985 | Bacteria | 48256 |
| 43 | Ga0081539_10002602 | 3300005985 | Bacteria | 24742 |
| 44 | Ga0081539_10007280 | 3300005985 | Bacteria | 10157 |
| 45 | Ga0081539_10130788 | 3300005985 | Bacteria | 1233 |
| 46 | Ga0070715_10141236 | 3300006163 | Bacteria | 1170 |
| 47 | Ga0070716_100188024 | 3300006173 | Bacteria | 1362 |
| 48 | Ga0070716_100359665 | 3300006173 | Bacteria | 1033 |
| 49 | Ga0075428_100058408 | 3300006844 | Bacteria | 4223 |
| 50 | Ga0075428_100112749 | 3300006844 | Bacteria | 2962 |
| 51 | Ga0075428_100407610 | 3300006844 | Bacteria | 1457 |
| 52 | Ga0075430_100020116 | 3300006846 | Bacteria | 5680 |
| 53 | Ga0075430_100209586 | 3300006846 | Bacteria | 1617 |
| 54 | Ga0075431_100015619 | 3300006847 | Bacteria | 7696 |
| 55 | Ga0075431_100043073 | 3300006847 | Bacteria | 4658 |
| 56 | Ga0075431_100581516 | 3300006847 | Bacteria | 1105 |
| 57 | Ga0075429_100082216 | 3300006880 | Bacteria | 2807 |
| 58 | Ga0068865_100040510 | 3300006881 | Bacteria | 3166 |
| 59 | Ga0097620_100166523 | 3300006931 | Bacteria | 2284 |
| 60 | Ga0105244_10304969 | 3300009036 | Bacteria | 736 |
| 61 | Ga0111539_10002477 | 3300009094 | Bacteria | 24496 |
| 62 | Ga0105245_10003578 | 3300009098 | Bacteria | 13870 |
| 63 | Ga0105245_10624810 | 3300009098 | Bacteria | 1106 |
| 64 | Ga0114129_10017169 | 3300009147 | Bacteria | 10308 |
| 65 | Ga0114129_10053880 | 3300009147 | Bacteria | 5641 |
| 66 | Ga0114129_10635851 | 3300009147 | Bacteria | 1379 |
| 67 | Ga0105241_10788062 | 3300009174 | Bacteria | 875 |
| 68 | Ga0105248_10164183 | 3300009177 | Bacteria | 2504 |
| 69 | Ga0105249_10111560 | 3300009553 | Bacteria | 2586 |
| 70 | Ga0105239_10389828 | 3300010375 | Bacteria | 1576 |
| 71 | Ga0105239_10785916 | 3300010375 | Bacteria | 1090 |
| 72 | Ga0157369_10006173 | 3300013105 | Bacteria | 13908 |
| 73 | Ga0157374_10599113 | 3300013296 | Bacteria | 1112 |
| 74 | Ga0163162_10459379 | 3300013306 | Bacteria | 1405 |
| 75 | Ga0157380_10642342 | 3300014326 | Bacteria | 1057 |
| 76 | Ga0157377_10006766 | 3300014745 | Bacteria | 5492 |
| 77 | Ga0206353_12053953 | 3300020082 | Bacteria | 3978 |
| 78 | Ga0207645_10044194 | 3300025907 | Bacteria | 2851 |
| 79 | Ga0207643_10157693 | 3300025908 | Bacteria | 1364 |
| 80 | Ga0207705_10444934 | 3300025909 | Bacteria | 1004 |
| 81 | Ga0207649_10010025 | 3300025920 | Bacteria | 5196 |
| 82 | Ga0207649_10036827 | 3300025920 | Bacteria | 2950 |
| 83 | Ga0207652_10079159 | 3300025921 | Bacteria | 2871 |
| 84 | Ga0207652_10413505 | 3300025921 | Bacteria | 1217 |
| 85 | Ga0207681_10651991 | 3300025923 | Bacteria | 873 |
| 86 | Ga0207659_10002823 | 3300025926 | Bacteria | 10360 |
| 87 | Ga0207687_10475108 | 3300025927 | Bacteria | 1040 |
| 88 | Ga0207690_10266520 | 3300025932 | Bacteria | 1329 |
| 89 | Ga0207690_10371514 | 3300025932 | Bacteria | 1134 |
| 90 | Ga0207706_10094445 | 3300025933 | Bacteria | 2630 |
| 91 | Ga0207689_10656570 | 3300025942 | Bacteria | 884 |
| 92 | Ga0207661_10039999 | 3300025944 | Bacteria | 3683 |
| 93 | Ga0207661_10069909 | 3300025944 | Bacteria | 2864 |
| 94 | Ga0207661_10751022 | 3300025944 | Bacteria | 898 |
| 95 | Ga0207679_10054203 | 3300025945 | Bacteria | 2951 |
| 96 | Ga0207679_10857903 | 3300025945 | Bacteria | 829 |
| 97 | Ga0207712_10143067 | 3300025961 | Bacteria | 1838 |
| 98 | Ga0207668_10001417 | 3300025972 | Bacteria | 14105 |
| 99 | Ga0207668_10345266 | 3300025972 | Bacteria | 1243 |
| 100 | Ga0207668_11406525 | 3300025972 | Bacteria | 629 |
| 101 | Ga0207658_10087769 | 3300025986 | Bacteria | 2403 |
| 102 | Ga0207677_10056020 | 3300026023 | Bacteria | 2698 |
| 103 | Ga0207677_10080417 | 3300026023 | Bacteria | 2335 |
| 104 | Ga0207639_10219762 | 3300026041 | Bacteria | 1640 |
| 105 | Ga0207708_10072077 | 3300026075 | Bacteria | 2647 |
| 106 | Ga0207702_10854712 | 3300026078 | Bacteria | 901 |
| 107 | Ga0207641_10369012 | 3300026088 | Bacteria | 1372 |
| 108 | Ga0207674_10029112 | 3300026116 | Bacteria | 5821 |
| 109 | Ga0207674_10574993 | 3300026116 | Bacteria | 1088 |
| 110 | Ga0207675_100647099 | 3300026118 | Bacteria | 1063 |
| 111 | Ga0207683_10105654 | 3300026121 | Bacteria | 2517 |
| 112 | Ga0268266_10624781 | 3300028379 | Bacteria | 1036 |
| 113 | Ga0268265_10143544 | 3300028380 | Bacteria | 2002 |
| 114 | Ga0307517_10072023 | 3300028786 | Bacteria | 3087 |
| 115 | Ga0307515_10000065 | 3300028794 | Bacteria | 244497 |
| 116 | Ga0307515_10026553 | 3300028794 | Bacteria | 9961 |
| 117 | Ga0307512_10004293 | 3300030522 | Bacteria | 15725 |
| 118 | Ga0307512_10007541 | 3300030522 | Bacteria | 10765 |
| 119 | Ga0307512_10047053 | 3300030522 | Bacteria | 3511 |
| 120 | Ga0307513_10045997 | 3300031456 | Bacteria | 4765 |
| 121 | Ga0307513_10047253 | 3300031456 | Bacteria | 4683 |
| 122 | Ga0307513_10089516 | 3300031456 | Bacteria | 3142 |
| 123 | Ga0307513_10352366 | 3300031456 | Bacteria | 1219 |
| 124 | Ga0307509_10166575 | 3300031507 | Bacteria | 2091 |
| 125 | Ga0307508_10004400 | 3300031616 | Bacteria | 13782 |
| 126 | Ga0307508_10017796 | 3300031616 | Bacteria | 6464 |
| 127 | Ga0307516_10006179 | 3300031730 | Bacteria | 14095 |
| 128 | Ga0307516_10265185 | 3300031730 | Bacteria | 1406 |
| 129 | Ga0307516_10316657 | 3300031730 | Bacteria | 1232 |
| 130 | Ga0307405_10008616 | 3300031731 | Bacteria | 5182 |
| 131 | Ga0307405_10010475 | 3300031731 | Bacteria | 4808 |
| 132 | Ga0307413_10580701 | 3300031824 | Bacteria | 914 |
| 133 | Ga0307413_10905095 | 3300031824 | Bacteria | 750 |
| 134 | Ga0326468_10000979 | 3300031889 | Bacteria | 2745 |
| 135 | Ga0307406_10042244 | 3300031901 | Bacteria | 2845 |
| 136 | Ga0307406_10085758 | 3300031901 | Bacteria | 2107 |
| 137 | Ga0307406_10769703 | 3300031901 | Bacteria | 810 |
| 138 | Ga0307407_10110304 | 3300031903 | Bacteria | 1726 |
| 139 | Ga0307409_100036062 | 3300031995 | Bacteria | 3630 |
| 140 | Ga0307409_100164595 | 3300031995 | Bacteria | 1944 |
| 141 | Ga0307409_100597170 | 3300031995 | Bacteria | 1090 |
| 142 | Ga0307409_101167282 | 3300031995 | Bacteria | 793 |
| 143 | Ga0307416_100023628 | 3300032002 | Bacteria | 4466 |
| 144 | Ga0307416_100167740 | 3300032002 | Bacteria | 2039 |
| 145 | Ga0307415_100002719 | 3300032126 | Bacteria | 8835 |
| 146 | Ga0307415_100419134 | 3300032126 | Bacteria | 1148 |
| 147 | Ga0307415_100489503 | 3300032126 | Bacteria | 1073 |
| 148 | Ga0307415_100810351 | 3300032126 | Bacteria | 855 |
| 149 | Ga0307415_101231811 | 3300032126 | Bacteria | 706 |
| 150 | Ga0373938_0008590 | 3300034957 | Bacteria | 1828 |
| 151 | Ga0373940_0019975 | 3300035088 | Bacteria | 1697 |
| 152 | Ga0373951_0000213 | 3300035091 | Bacteria | 20460 |
| 153 | Ga0373942_0000033 | 3300035207 | Bacteria | 26057 |
| 154 | Ga0373937_0331034 | 3300036401 | Bacteria | 1441 |
| 155 | Ga0395899_0016451 | 3300037312 | Bacteria | 5639 |
| 156 | Ga0395900_0003395 | 3300037418 | Bacteria | 17196 |
| 157 | Ga0395900_0317218 | 3300037418 | Bacteria | 1540 |
| 158 | Ga0395898_0003058 | 3300037466 | Bacteria | 18956 |
| 159 | Ga0395898_0012990 | 3300037466 | Bacteria | 8585 |
| 160 | Ga0395905_0040873 | 3300037471 | Bacteria | 4350 |
| 161 | Ga0451853_0073508 | 3300041512 | Bacteria | 11953 |
| 162 | Ga0439463_079439 | 3300042016 | Bacteria | 843 |
| 163 | Ga0439464_0098136 | 3300042439 | Bacteria | 888 |
| 164 | Ga0466957_0115146 | 3300044842 | Bacteria | 1709 |
| 165 | Ga0466967_0801466 | 3300045976 | Bacteria | 935 |
| 166 | Ga0495590_0238874 | 3300046457 | Bacteria | 674 |
| 167 | Ga0495638_0200270 | 3300046460 | Bacteria | 1128 |
| 168 | Ga0495687_194547 | 3300047443 | Bacteria | 650 |
| 169 | Ga0496108_0000010 | 3300048911 | Bacteria | 273269 |
| 170 | Ga0496108_0201142 | 3300048911 | Bacteria | 1729 |
| 171 | Ga0496112_0623897 | 3300048915 | Bacteria | 1009 |
| 172 | Ga0496112_0915869 | 3300048915 | Bacteria | 798 |
| 173 | Ga0501046_0248307 | 3300049580 | Bacteria | 1311 |
| 174 | Ga0501047_0585996 | 3300049581 | Bacteria | 938 |
| 175 | nmdc:mga05p37_303108_c1 | 3300050507 | Bacteria | 1897 |
| 176 | nmdc:mga05p37_37259_c1 | 3300050507 | Bacteria | 5963 |
| 177 | nmdc:mga05p37_827641_c1 | 3300050507 | Bacteria | 1009 |
| 178 | nmdc:mga09592_125328_c1 | 3300050508 | Bacteria | 2208 |
| 179 | nmdc:mga09592_193178_c2 | 3300050508 | Bacteria | 1438 |
| 180 | nmdc:mga0qj67_250122_c1 | 3300050509 | Bacteria | 1438 |
| 181 | nmdc:mga0qj67_327215_c1 | 3300050509 | Bacteria | 1240 |
| 182 | nmdc:mga0qj67_38607_c1 | 3300050509 | Bacteria | 3747 |
| 183 | nmdc:mga0qj67_420676_c1 | 3300050509 | Bacteria | 1077 |
| 184 | nmdc:mga0qj67_57086_c1 | 3300050509 | Bacteria | 3095 |
| 185 | nmdc:mga06r32_14871_c1 | 3300050510 | Bacteria | 7061 |
| 186 | nmdc:mga06r32_213903_c1 | 3300050510 | Bacteria | 1916 |
| 187 | nmdc:mga06r32_570027_c1 | 3300050510 | Bacteria | 1105 |
| 188 | nmdc:mga08y16_1214570_c1 | 3300050511 | Bacteria | 724 |
| 189 | nmdc:mga08y16_3990_c1 | 3300050511 | Bacteria | 15390 |
| 190 | nmdc:mga0a205_764624_c1 | 3300050515 | Bacteria | 814 |
| 191 | Ga0500651_0113210 | 3300053093 | Bacteria | 1654 |
| 192 | Ga0500650_0106334 | 3300053098 | Bacteria | 1311 |
| 193 | Ga0500588_0378490 | 3300053146 | Bacteria | 539 |
| 194 | Ga0500600_0259906 | 3300053149 | Bacteria | 771 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300030522 | Ga0307512_10007541 | Ga0307512_100075416 | 138 |
| 2 | 3300046457 | Ga0495590_0238874 | Ga0495590_0238874_223_642 | 138 |
| 3 | 3300053146 | Ga0500588_0378490 | Ga0500588_0378490_75_494 | 138 |
| 4 | 3300006173 | Ga0070716_100188024 | Ga0070716_1001880242 | 162 |
| 5 | 3300005719 | Ga0068861_101169245 | Ga0068861_1011692451 | 164 |
| 6 | 3300005985 | Ga0081539_10000938 | Ga0081539_1000093822 | 170 |
| 7 | 3300048911 | Ga0496108_0201142 | Ga0496108_0201142_518_1060 | 172 |
| 8 | 3300005327 | Ga0070658_10031138 | Ga0070658_100311385 | 177 |
| 9 | 3300005344 | Ga0070661_100039972 | Ga0070661_1000399721 | 177 |
| 10 | 3300005458 | Ga0070681_10310116 | Ga0070681_103101162 | 177 |
| 11 | 3300005530 | Ga0070679_100320470 | Ga0070679_1003204702 | 177 |
| 12 | 3300005535 | Ga0070684_100351618 | Ga0070684_1003516182 | 177 |
| 13 | 3300005937 | Ga0081455_10146576 | Ga0081455_101465762 | 177 |
| 14 | 3300006163 | Ga0070715_10141236 | Ga0070715_101412362 | 177 |
| 15 | 3300009174 | Ga0105241_10788062 | Ga0105241_107880621 | 177 |
| 16 | 3300013105 | Ga0157369_10006173 | Ga0157369_100061732 | 177 |
| 17 | 3300020082 | Ga0206353_12053953 | Ga0206353_120539534 | 177 |
| 18 | 3300025909 | Ga0207705_10444934 | Ga0207705_104449342 | 177 |
| 19 | 3300025920 | Ga0207649_10036827 | Ga0207649_100368273 | 177 |
| 20 | 3300025921 | Ga0207652_10079159 | Ga0207652_100791592 | 177 |
| 21 | 3300025932 | Ga0207690_10371514 | Ga0207690_103715142 | 177 |
| 22 | 3300025944 | Ga0207661_10039999 | Ga0207661_100399992 | 177 |
| 23 | 3300035091 | Ga0373951_0000213 | Ga0373951_0000213_161_694 | 177 |
| 24 | 3300036401 | Ga0373937_0331034 | Ga0373937_0331034_808_1341 | 177 |
| 25 | 3300048915 | Ga0496112_0915869 | Ga0496112_0915869_210_743 | 177 |
| 26 | iso_pu_bacteria | 2831935698 | 2831939301 | 177 |
| 27 | iso_pu_bacteria | 2832004796 | 2832007111 | 177 |
| 28 | iso_pu_bacteria | 2856858025 | 2856858671 | 177 |
| 29 | iso_pu_bacteria | 2858902515 | 2858903125 | 177 |
| 30 | iso_pu_bacteria | 2866065130 | 2866066804 | 177 |
| 31 | iso_pu_bacteria | 2867507094 | 2867512177 | 177 |
| 32 | iso_pu_bacteria | 649633069 | 649813147 | 177 |
| 33 | iso_pu_bacteria | 2751185782 | 2753271482 | 178 |
| 34 | 3300005983 | Ga0081540_1000837 | Ga0081540_10008376 | 179 |
| 35 | 3300006844 | Ga0075428_100058408 | Ga0075428_1000584084 | 179 |
| 36 | 3300006846 | Ga0075430_100020116 | Ga0075430_1000201163 | 179 |
| 37 | 3300006847 | Ga0075431_100015619 | Ga0075431_1000156198 | 179 |
| 38 | 3300006880 | Ga0075429_100082216 | Ga0075429_1000822163 | 179 |
| 39 | 3300009147 | Ga0114129_10017169 | Ga0114129_1001716910 | 179 |
| 40 | 3300049580 | Ga0501046_0248307 | Ga0501046_0248307_441_986 | 179 |
| 41 | 3300049581 | Ga0501047_0585996 | Ga0501047_0585996_43_585 | 179 |
| 42 | 3300050507 | nmdc:mga05p37_37259_c1 | nmdc:mga05p37_37259_c1_4080_4625 | 179 |
| 43 | 3300050508 | nmdc:mga09592_125328_c1 | nmdc:mga09592_125328_c1_1214_1759 | 179 |
| 44 | 3300050509 | nmdc:mga0qj67_38607_c1 | nmdc:mga0qj67_38607_c1_2858_3403 | 179 |
| 45 | 3300050509 | nmdc:mga0qj67_57086_c1 | nmdc:mga0qj67_57086_c1_869_1414 | 179 |
| 46 | 3300050510 | nmdc:mga06r32_213903_c1 | nmdc:mga06r32_213903_c1_460_1005 | 179 |
| 47 | 3300005577 | Ga0068857_100501429 | Ga0068857_1005014292 | 180 |
| 48 | 3300005985 | Ga0081539_10002602 | Ga0081539_100026023 | 180 |
| 49 | 3300005985 | Ga0081539_10007280 | Ga0081539_100072804 | 180 |
| 50 | 3300005985 | Ga0081539_10130788 | Ga0081539_101307882 | 180 |
| 51 | 3300006844 | Ga0075428_100112749 | Ga0075428_1001127492 | 180 |
| 52 | 3300006844 | Ga0075428_100407610 | Ga0075428_1004076101 | 180 |
| 53 | 3300006846 | Ga0075430_100209586 | Ga0075430_1002095863 | 180 |
| 54 | 3300006847 | Ga0075431_100043073 | Ga0075431_1000430733 | 180 |
| 55 | 3300006847 | Ga0075431_100581516 | Ga0075431_1005815162 | 180 |
| 56 | 3300009147 | Ga0114129_10053880 | Ga0114129_100538802 | 180 |
| 57 | 3300009147 | Ga0114129_10635851 | Ga0114129_106358512 | 180 |
| 58 | 3300025945 | Ga0207679_10857903 | Ga0207679_108579031 | 180 |
| 59 | 3300026078 | Ga0207702_10854712 | Ga0207702_108547122 | 180 |
| 60 | 3300026116 | Ga0207674_10574993 | Ga0207674_105749932 | 180 |
| 61 | 3300050507 | nmdc:mga05p37_303108_c1 | nmdc:mga05p37_303108_c1_1269_1811 | 180 |
| 62 | 3300050507 | nmdc:mga05p37_827641_c1 | nmdc:mga05p37_827641_c1_99_641 | 180 |
| 63 | 3300050508 | nmdc:mga09592_193178_c2 | nmdc:mga09592_193178_c2_760_1302 | 180 |
| 64 | 3300050509 | nmdc:mga0qj67_250122_c1 | nmdc:mga0qj67_250122_c1_292_834 | 180 |
| 65 | 3300050509 | nmdc:mga0qj67_420676_c1 | nmdc:mga0qj67_420676_c1_82_624 | 180 |
| 66 | 3300050510 | nmdc:mga06r32_14871_c1 | nmdc:mga06r32_14871_c1_3463_4005 | 180 |
| 67 | 3300050510 | nmdc:mga06r32_570027_c1 | nmdc:mga06r32_570027_c1_432_974 | 180 |
| 68 | 3300050511 | nmdc:mga08y16_1214570_c1 | nmdc:mga08y16_1214570_c1_10_552 | 180 |
| 69 | 3300005334 | Ga0068869_100309904 | Ga0068869_1003099043 | 181 |
| 70 | 3300005347 | Ga0070668_100000772 | Ga0070668_10000077217 | 181 |
| 71 | 3300005347 | Ga0070668_100534014 | Ga0070668_1005340142 | 181 |
| 72 | 3300005564 | Ga0070664_100469635 | Ga0070664_1004696351 | 181 |
| 73 | 3300005617 | Ga0068859_100166532 | Ga0068859_1001665322 | 181 |
| 74 | 3300005844 | Ga0068862_100105351 | Ga0068862_1001053512 | 181 |
| 75 | 3300006173 | Ga0070716_100359665 | Ga0070716_1003596652 | 181 |
| 76 | 3300006931 | Ga0097620_100166523 | Ga0097620_1001665232 | 181 |
| 77 | 3300009098 | Ga0105245_10624810 | Ga0105245_106248101 | 181 |
| 78 | 3300010375 | Ga0105239_10785916 | Ga0105239_107859162 | 181 |
| 79 | 3300025927 | Ga0207687_10475108 | Ga0207687_104751082 | 181 |
| 80 | 3300025944 | Ga0207661_10751022 | Ga0207661_107510221 | 181 |
| 81 | 3300025972 | Ga0207668_10001417 | Ga0207668_100014176 | 181 |
| 82 | 3300025972 | Ga0207668_10345266 | Ga0207668_103452662 | 181 |
| 83 | 3300026023 | Ga0207677_10056020 | Ga0207677_100560201 | 181 |
| 84 | 3300026041 | Ga0207639_10219762 | Ga0207639_102197622 | 181 |
| 85 | 3300028379 | Ga0268266_10624781 | Ga0268266_106247812 | 181 |
| 86 | 3300028794 | Ga0307515_10000065 | Ga0307515_10000065175 | 181 |
| 87 | 3300031456 | Ga0307513_10089516 | Ga0307513_100895161 | 181 |
| 88 | 3300031901 | Ga0307406_10085758 | Ga0307406_100857582 | 181 |
| 89 | 3300031901 | Ga0307406_10769703 | Ga0307406_107697032 | 181 |
| 90 | 3300031995 | Ga0307409_100164595 | Ga0307409_1001645951 | 181 |
| 91 | 3300032002 | Ga0307416_100167740 | Ga0307416_1001677403 | 181 |
| 92 | 3300032126 | Ga0307415_100002719 | Ga0307415_1000027196 | 181 |
| 93 | 3300037312 | Ga0395899_0016451 | Ga0395899_0016451_3733_4278 | 181 |
| 94 | 3300037418 | Ga0395900_0003395 | Ga0395900_0003395_15665_16210 | 181 |
| 95 | 3300037466 | Ga0395898_0003058 | Ga0395898_0003058_16813_17358 | 181 |
| 96 | 3300037471 | Ga0395905_0040873 | Ga0395905_0040873_2027_2572 | 181 |
| 97 | 3300044842 | Ga0466957_0115146 | Ga0466957_0115146_318_863 | 181 |
| 98 | 3300048915 | Ga0496112_0623897 | Ga0496112_0623897_106_660 | 181 |
| 99 | 3300003322 | rootL2_10190814 | rootL2_101908144 | 182 |
| 100 | 3300005328 | Ga0070676_10012368 | Ga0070676_100123683 | 182 |
| 101 | 3300005329 | Ga0070683_100006016 | Ga0070683_1000060163 | 182 |
| 102 | 3300005334 | Ga0068869_100684700 | Ga0068869_1006847001 | 182 |
| 103 | 3300005336 | Ga0070680_100764606 | Ga0070680_1007646062 | 182 |
| 104 | 3300005338 | Ga0068868_100039531 | Ga0068868_1000395313 | 182 |
| 105 | 3300005344 | Ga0070661_100026894 | Ga0070661_1000268943 | 182 |
| 106 | 3300005345 | Ga0070692_10014930 | Ga0070692_100149305 | 182 |
| 107 | 3300005353 | Ga0070669_101411802 | Ga0070669_1014118021 | 182 |
| 108 | 3300005354 | Ga0070675_100002456 | Ga0070675_10000245614 | 182 |
| 109 | 3300005366 | Ga0070659_100053887 | Ga0070659_1000538873 | 182 |
| 110 | 3300005367 | Ga0070667_100297437 | Ga0070667_1002974371 | 182 |
| 111 | 3300005436 | Ga0070713_100194499 | Ga0070713_1001944992 | 182 |
| 112 | 3300005441 | Ga0070700_100011290 | Ga0070700_1000112904 | 182 |
| 113 | 3300005456 | Ga0070678_100223598 | Ga0070678_1002235982 | 182 |
| 114 | 3300005457 | Ga0070662_100015343 | Ga0070662_1000153433 | 182 |
| 115 | 3300005458 | Ga0070681_10918247 | Ga0070681_109182472 | 182 |
| 116 | 3300005535 | Ga0070684_100002719 | Ga0070684_1000027194 | 182 |
| 117 | 3300005564 | Ga0070664_100004061 | Ga0070664_10000406111 | 182 |
| 118 | 3300005577 | Ga0068857_100061825 | Ga0068857_1000618253 | 182 |
| 119 | 3300005615 | Ga0070702_100050441 | Ga0070702_1000504412 | 182 |
| 120 | 3300005719 | Ga0068861_100388516 | Ga0068861_1003885162 | 182 |
| 121 | 3300005842 | Ga0068858_100535448 | Ga0068858_1005354482 | 182 |
| 122 | 3300005844 | Ga0068862_100204440 | Ga0068862_1002044402 | 182 |
| 123 | 3300005983 | Ga0081540_1016696 | Ga0081540_10166962 | 182 |
| 124 | 3300005985 | Ga0081539_10001138 | Ga0081539_1000113836 | 182 |
| 125 | 3300006881 | Ga0068865_100040510 | Ga0068865_1000405103 | 182 |
| 126 | 3300009036 | Ga0105244_10304969 | Ga0105244_103049691 | 182 |
| 127 | 3300009094 | Ga0111539_10002477 | Ga0111539_100024777 | 182 |
| 128 | 3300009098 | Ga0105245_10003578 | Ga0105245_1000357810 | 182 |
| 129 | 3300009177 | Ga0105248_10164183 | Ga0105248_101641834 | 182 |
| 130 | 3300009553 | Ga0105249_10111560 | Ga0105249_101115603 | 182 |
| 131 | 3300010375 | Ga0105239_10389828 | Ga0105239_103898282 | 182 |
| 132 | 3300013296 | Ga0157374_10599113 | Ga0157374_105991131 | 182 |
| 133 | 3300013306 | Ga0163162_10459379 | Ga0163162_104593792 | 182 |
| 134 | 3300014326 | Ga0157380_10642342 | Ga0157380_106423422 | 182 |
| 135 | 3300014745 | Ga0157377_10006766 | Ga0157377_100067663 | 182 |
| 136 | 3300025907 | Ga0207645_10044194 | Ga0207645_100441944 | 182 |
| 137 | 3300025908 | Ga0207643_10157693 | Ga0207643_101576932 | 182 |
| 138 | 3300025920 | Ga0207649_10010025 | Ga0207649_100100253 | 182 |
| 139 | 3300025921 | Ga0207652_10413505 | Ga0207652_104135052 | 182 |
| 140 | 3300025923 | Ga0207681_10651991 | Ga0207681_106519912 | 182 |
| 141 | 3300025926 | Ga0207659_10002823 | Ga0207659_1000282311 | 182 |
| 142 | 3300025932 | Ga0207690_10266520 | Ga0207690_102665202 | 182 |
| 143 | 3300025933 | Ga0207706_10094445 | Ga0207706_100944452 | 182 |
| 144 | 3300025942 | Ga0207689_10656570 | Ga0207689_106565701 | 182 |
| 145 | 3300025944 | Ga0207661_10069909 | Ga0207661_100699093 | 182 |
| 146 | 3300025945 | Ga0207679_10054203 | Ga0207679_100542032 | 182 |
| 147 | 3300025961 | Ga0207712_10143067 | Ga0207712_101430672 | 182 |
| 148 | 3300025972 | Ga0207668_11406525 | Ga0207668_114065251 | 182 |
| 149 | 3300025986 | Ga0207658_10087769 | Ga0207658_100877692 | 182 |
| 150 | 3300026023 | Ga0207677_10080417 | Ga0207677_100804173 | 182 |
| 151 | 3300026075 | Ga0207708_10072077 | Ga0207708_100720772 | 182 |
| 152 | 3300026088 | Ga0207641_10369012 | Ga0207641_103690122 | 182 |
| 153 | 3300026116 | Ga0207674_10029112 | Ga0207674_100291127 | 182 |
| 154 | 3300026118 | Ga0207675_100647099 | Ga0207675_1006470992 | 182 |
| 155 | 3300026121 | Ga0207683_10105654 | Ga0207683_101056543 | 182 |
| 156 | 3300028380 | Ga0268265_10143544 | Ga0268265_101435443 | 182 |
| 157 | 3300028786 | Ga0307517_10072023 | Ga0307517_100720232 | 182 |
| 158 | 3300028794 | Ga0307515_10026553 | Ga0307515_100265535 | 182 |
| 159 | 3300030522 | Ga0307512_10004293 | Ga0307512_100042939 | 182 |
| 160 | 3300030522 | Ga0307512_10047053 | Ga0307512_100470534 | 182 |
| 161 | 3300031456 | Ga0307513_10045997 | Ga0307513_100459975 | 182 |
| 162 | 3300031456 | Ga0307513_10047253 | Ga0307513_100472536 | 182 |
| 163 | 3300031456 | Ga0307513_10352366 | Ga0307513_103523661 | 182 |
| 164 | 3300031507 | Ga0307509_10166575 | Ga0307509_101665752 | 182 |
| 165 | 3300031616 | Ga0307508_10004400 | Ga0307508_100044003 | 182 |
| 166 | 3300031616 | Ga0307508_10017796 | Ga0307508_100177965 | 182 |
| 167 | 3300031730 | Ga0307516_10006179 | Ga0307516_100061793 | 182 |
| 168 | 3300031730 | Ga0307516_10265185 | Ga0307516_102651851 | 182 |
| 169 | 3300031730 | Ga0307516_10316657 | Ga0307516_103166571 | 182 |
| 170 | 3300031731 | Ga0307405_10008616 | Ga0307405_100086164 | 182 |
| 171 | 3300031731 | Ga0307405_10010475 | Ga0307405_100104754 | 182 |
| 172 | 3300031824 | Ga0307413_10580701 | Ga0307413_105807011 | 182 |
| 173 | 3300031824 | Ga0307413_10905095 | Ga0307413_109050951 | 182 |
| 174 | 3300031889 | Ga0326468_10000979 | Ga0326468_100009793 | 182 |
| 175 | 3300031901 | Ga0307406_10042244 | Ga0307406_100422442 | 182 |
| 176 | 3300031903 | Ga0307407_10110304 | Ga0307407_101103042 | 182 |
| 177 | 3300031995 | Ga0307409_100036062 | Ga0307409_1000360623 | 182 |
| 178 | 3300031995 | Ga0307409_100597170 | Ga0307409_1005971702 | 182 |
| 179 | 3300031995 | Ga0307409_101167282 | Ga0307409_1011672821 | 182 |
| 180 | 3300032002 | Ga0307416_100023628 | Ga0307416_1000236282 | 182 |
| 181 | 3300032126 | Ga0307415_100419134 | Ga0307415_1004191342 | 182 |
| 182 | 3300032126 | Ga0307415_100489503 | Ga0307415_1004895032 | 182 |
| 183 | 3300032126 | Ga0307415_100810351 | Ga0307415_1008103512 | 182 |
| 184 | 3300032126 | Ga0307415_101231811 | Ga0307415_1012318111 | 182 |
| 185 | 3300034957 | Ga0373938_0008590 | Ga0373938_0008590_518_1069 | 182 |
| 186 | 3300035088 | Ga0373940_0019975 | Ga0373940_0019975_538_1089 | 182 |
| 187 | 3300035207 | Ga0373942_0000033 | Ga0373942_0000033_5511_6062 | 182 |
| 188 | 3300037418 | Ga0395900_0317218 | Ga0395900_0317218_77_625 | 182 |
| 189 | 3300037466 | Ga0395898_0012990 | Ga0395898_0012990_3883_4431 | 182 |
| 190 | 3300041512 | Ga0451853_0073508 | Ga0451853_0073508_1245_1793 | 182 |
| 191 | 3300042016 | Ga0439463_079439 | Ga0439463_079439_159_710 | 182 |
| 192 | 3300042439 | Ga0439464_0098136 | Ga0439464_0098136_190_741 | 182 |
| 193 | 3300045976 | Ga0466967_0801466 | Ga0466967_0801466_49_597 | 182 |
| 194 | 3300046460 | Ga0495638_0200270 | Ga0495638_0200270_211_762 | 182 |
| 195 | 3300047443 | Ga0495687_194547 | Ga0495687_194547_44_595 | 182 |
| 196 | 3300048911 | Ga0496108_0000010 | Ga0496108_0000010_245211_245762 | 182 |
| 197 | 3300050509 | nmdc:mga0qj67_327215_c1 | nmdc:mga0qj67_327215_c1_606_1154 | 182 |
| 198 | 3300050511 | nmdc:mga08y16_3990_c1 | nmdc:mga08y16_3990_c1_4520_5068 | 182 |
| 199 | 3300050515 | nmdc:mga0a205_764624_c1 | nmdc:mga0a205_764624_c1_89_637 | 182 |
| 200 | 3300053093 | Ga0500651_0113210 | Ga0500651_0113210_1072_1623 | 182 |
| 201 | 3300053098 | Ga0500650_0106334 | Ga0500650_0106334_83_634 | 182 |
| 202 | 3300053149 | Ga0500600_0259906 | Ga0500600_0259906_71_622 | 182 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3sbx-assembly4.cif.gz_H | crystal structure of a putative uncharacterized protein from mycobacterium marinum bound to adenosine 5'-monophosphate amp | 0.9907 | 3 | 176 |
| 3qua-assembly1.cif.gz_B | crystal structure of a putative uncharacterized protein and possible molybdenum cofactor protein from mycobacterium smegmatis | 0.981 | 3 | 176 |
| 7w2i-assembly1.cif.gz_D | crystal structure of log (rv1205) from mycobacterium tuberculosis | 0.979 | 3 | 176 |
| 5zbl-assembly2.cif.gz_C | crystal structure of type-i log from corynebacterium glutamicum in complex with amp | 0.9653 | 3 | 178 |
| 3sbx-assembly4.cif.gz_H | crystal structure of a putative uncharacterized protein from mycobacterium marinum bound to adenosine 5'-monophosphate amp | 0.963 | 3 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3sbxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9907 | 3 | 174 | 3.40.50.450 |
| af_Q2G0B7_1_186_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9586 | 1 | 176 | 3.40.50.450 |
| 3sbxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.952 | 3 | 174 | 3.40.50.450 |
| af_A0A1D6K2U3_1_187_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9408 | 3 | 177 | 3.40.50.450 |
| af_A4HXF6_126_320_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9282 | 1 | 177 | 3.40.50.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H3QXX7-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9961 | 1 | 174 |
GO:0005829
GO:0009691 GO:0102682 |
| AF-A0A370FWS5-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9948 | 3 | 176 |
GO:0005829
GO:0009691 GO:0102682 |
| AF-A0A545B1B0-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9945 | 1 | 178 |
GO:0005829
GO:0009691 GO:0102682 |
| AF-A0A1M7QPY8-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9943 | 2 | 181 |
GO:0005829
GO:0009691 GO:0102682 |
| AF-A0A5C7P4V6-F1-model_v4 | Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) | 0.9943 | 3 | 181 |
GO:0005829
GO:0009691 GO:0102682 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar