F309665

General Info

Members Datasets Scaffolds Average Seq Length
202 133 194 180

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10000938|Ga0081539_1000093822
Length 172
Sequence VAAVCVFCASSTTLEQRWLDLAAETGRELAARGHTLVSGGGCVGMMGAVAGIPQTLVDREVADTNADELVVTGDMGARKNLMIERSDAFITLPGGLGTLDELFEVWTTATLRLHRKPIVLLDPDGFYDGLLAWLGKLAETEFVRRPALEVVTVVSSVPAAFDAIDPAHTTSL

Samples

Sample ID Description Type Environment
1 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
2 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
3 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
4 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
5 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
6 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
7 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
103 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
104 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
105 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
113 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
130 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
131 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
132 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
133 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.54
Metatranscriptomes 0.5
Isolates 3.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 1.98
Rhizosphere 84.16
Stem 0
Stem Tuber 0
Unclassified 11.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10190814 3300003322 Bacteria 4113
2 Ga0070658_10031138 3300005327 Bacteria 4283
3 Ga0070676_10012368 3300005328 Bacteria 4656
4 Ga0070683_100006016 3300005329 Bacteria 10167
5 Ga0068869_100309904 3300005334 Bacteria 1277
6 Ga0068869_100684700 3300005334 Bacteria 873
7 Ga0070680_100764606 3300005336 Bacteria 832
8 Ga0068868_100039531 3300005338 Bacteria 3666
9 Ga0070661_100026894 3300005344 Bacteria 4141
10 Ga0070661_100039972 3300005344 Bacteria 3419
11 Ga0070692_10014930 3300005345 Bacteria 3661
12 Ga0070668_100000772 3300005347 Bacteria 22052
13 Ga0070668_100534014 3300005347 Bacteria 1019
14 Ga0070669_101411802 3300005353 Bacteria 604
15 Ga0070675_100002456 3300005354 Bacteria 13858
16 Ga0070659_100053887 3300005366 Bacteria 3167
17 Ga0070667_100297437 3300005367 Bacteria 1453
18 Ga0070713_100194499 3300005436 Bacteria 1829
19 Ga0070700_100011290 3300005441 Bacteria 4945
20 Ga0070678_100223598 3300005456 Bacteria 1566
21 Ga0070662_100015343 3300005457 Bacteria 5129
22 Ga0070681_10310116 3300005458 Bacteria 1487
23 Ga0070681_10918247 3300005458 Bacteria 794
24 Ga0070679_100320470 3300005530 Bacteria 1499
25 Ga0070684_100002719 3300005535 Bacteria 13068
26 Ga0070684_100351618 3300005535 Bacteria 1355
27 Ga0070664_100004061 3300005564 Bacteria 11759
28 Ga0070664_100469635 3300005564 Bacteria 1157
29 Ga0068857_100061825 3300005577 Bacteria 3328
30 Ga0068857_100501429 3300005577 Bacteria 1139
31 Ga0070702_100050441 3300005615 Bacteria 2377
32 Ga0068859_100166532 3300005617 Bacteria 2284
33 Ga0068861_100388516 3300005719 Bacteria 1235
34 Ga0068861_101169245 3300005719 Bacteria 742
35 Ga0068858_100535448 3300005842 Bacteria 1133
36 Ga0068862_100105351 3300005844 Bacteria 2472
37 Ga0068862_100204440 3300005844 Bacteria 1782
38 Ga0081455_10146576 3300005937 Bacteria 1825
39 Ga0081540_1000837 3300005983 Bacteria 28052
40 Ga0081540_1016696 3300005983 Bacteria 4578
41 Ga0081539_10000938 3300005985 Bacteria 54684
42 Ga0081539_10001138 3300005985 Bacteria 48256
43 Ga0081539_10002602 3300005985 Bacteria 24742
44 Ga0081539_10007280 3300005985 Bacteria 10157
45 Ga0081539_10130788 3300005985 Bacteria 1233
46 Ga0070715_10141236 3300006163 Bacteria 1170
47 Ga0070716_100188024 3300006173 Bacteria 1362
48 Ga0070716_100359665 3300006173 Bacteria 1033
49 Ga0075428_100058408 3300006844 Bacteria 4223
50 Ga0075428_100112749 3300006844 Bacteria 2962
51 Ga0075428_100407610 3300006844 Bacteria 1457
52 Ga0075430_100020116 3300006846 Bacteria 5680
53 Ga0075430_100209586 3300006846 Bacteria 1617
54 Ga0075431_100015619 3300006847 Bacteria 7696
55 Ga0075431_100043073 3300006847 Bacteria 4658
56 Ga0075431_100581516 3300006847 Bacteria 1105
57 Ga0075429_100082216 3300006880 Bacteria 2807
58 Ga0068865_100040510 3300006881 Bacteria 3166
59 Ga0097620_100166523 3300006931 Bacteria 2284
60 Ga0105244_10304969 3300009036 Bacteria 736
61 Ga0111539_10002477 3300009094 Bacteria 24496
62 Ga0105245_10003578 3300009098 Bacteria 13870
63 Ga0105245_10624810 3300009098 Bacteria 1106
64 Ga0114129_10017169 3300009147 Bacteria 10308
65 Ga0114129_10053880 3300009147 Bacteria 5641
66 Ga0114129_10635851 3300009147 Bacteria 1379
67 Ga0105241_10788062 3300009174 Bacteria 875
68 Ga0105248_10164183 3300009177 Bacteria 2504
69 Ga0105249_10111560 3300009553 Bacteria 2586
70 Ga0105239_10389828 3300010375 Bacteria 1576
71 Ga0105239_10785916 3300010375 Bacteria 1090
72 Ga0157369_10006173 3300013105 Bacteria 13908
73 Ga0157374_10599113 3300013296 Bacteria 1112
74 Ga0163162_10459379 3300013306 Bacteria 1405
75 Ga0157380_10642342 3300014326 Bacteria 1057
76 Ga0157377_10006766 3300014745 Bacteria 5492
77 Ga0206353_12053953 3300020082 Bacteria 3978
78 Ga0207645_10044194 3300025907 Bacteria 2851
79 Ga0207643_10157693 3300025908 Bacteria 1364
80 Ga0207705_10444934 3300025909 Bacteria 1004
81 Ga0207649_10010025 3300025920 Bacteria 5196
82 Ga0207649_10036827 3300025920 Bacteria 2950
83 Ga0207652_10079159 3300025921 Bacteria 2871
84 Ga0207652_10413505 3300025921 Bacteria 1217
85 Ga0207681_10651991 3300025923 Bacteria 873
86 Ga0207659_10002823 3300025926 Bacteria 10360
87 Ga0207687_10475108 3300025927 Bacteria 1040
88 Ga0207690_10266520 3300025932 Bacteria 1329
89 Ga0207690_10371514 3300025932 Bacteria 1134
90 Ga0207706_10094445 3300025933 Bacteria 2630
91 Ga0207689_10656570 3300025942 Bacteria 884
92 Ga0207661_10039999 3300025944 Bacteria 3683
93 Ga0207661_10069909 3300025944 Bacteria 2864
94 Ga0207661_10751022 3300025944 Bacteria 898
95 Ga0207679_10054203 3300025945 Bacteria 2951
96 Ga0207679_10857903 3300025945 Bacteria 829
97 Ga0207712_10143067 3300025961 Bacteria 1838
98 Ga0207668_10001417 3300025972 Bacteria 14105
99 Ga0207668_10345266 3300025972 Bacteria 1243
100 Ga0207668_11406525 3300025972 Bacteria 629
101 Ga0207658_10087769 3300025986 Bacteria 2403
102 Ga0207677_10056020 3300026023 Bacteria 2698
103 Ga0207677_10080417 3300026023 Bacteria 2335
104 Ga0207639_10219762 3300026041 Bacteria 1640
105 Ga0207708_10072077 3300026075 Bacteria 2647
106 Ga0207702_10854712 3300026078 Bacteria 901
107 Ga0207641_10369012 3300026088 Bacteria 1372
108 Ga0207674_10029112 3300026116 Bacteria 5821
109 Ga0207674_10574993 3300026116 Bacteria 1088
110 Ga0207675_100647099 3300026118 Bacteria 1063
111 Ga0207683_10105654 3300026121 Bacteria 2517
112 Ga0268266_10624781 3300028379 Bacteria 1036
113 Ga0268265_10143544 3300028380 Bacteria 2002
114 Ga0307517_10072023 3300028786 Bacteria 3087
115 Ga0307515_10000065 3300028794 Bacteria 244497
116 Ga0307515_10026553 3300028794 Bacteria 9961
117 Ga0307512_10004293 3300030522 Bacteria 15725
118 Ga0307512_10007541 3300030522 Bacteria 10765
119 Ga0307512_10047053 3300030522 Bacteria 3511
120 Ga0307513_10045997 3300031456 Bacteria 4765
121 Ga0307513_10047253 3300031456 Bacteria 4683
122 Ga0307513_10089516 3300031456 Bacteria 3142
123 Ga0307513_10352366 3300031456 Bacteria 1219
124 Ga0307509_10166575 3300031507 Bacteria 2091
125 Ga0307508_10004400 3300031616 Bacteria 13782
126 Ga0307508_10017796 3300031616 Bacteria 6464
127 Ga0307516_10006179 3300031730 Bacteria 14095
128 Ga0307516_10265185 3300031730 Bacteria 1406
129 Ga0307516_10316657 3300031730 Bacteria 1232
130 Ga0307405_10008616 3300031731 Bacteria 5182
131 Ga0307405_10010475 3300031731 Bacteria 4808
132 Ga0307413_10580701 3300031824 Bacteria 914
133 Ga0307413_10905095 3300031824 Bacteria 750
134 Ga0326468_10000979 3300031889 Bacteria 2745
135 Ga0307406_10042244 3300031901 Bacteria 2845
136 Ga0307406_10085758 3300031901 Bacteria 2107
137 Ga0307406_10769703 3300031901 Bacteria 810
138 Ga0307407_10110304 3300031903 Bacteria 1726
139 Ga0307409_100036062 3300031995 Bacteria 3630
140 Ga0307409_100164595 3300031995 Bacteria 1944
141 Ga0307409_100597170 3300031995 Bacteria 1090
142 Ga0307409_101167282 3300031995 Bacteria 793
143 Ga0307416_100023628 3300032002 Bacteria 4466
144 Ga0307416_100167740 3300032002 Bacteria 2039
145 Ga0307415_100002719 3300032126 Bacteria 8835
146 Ga0307415_100419134 3300032126 Bacteria 1148
147 Ga0307415_100489503 3300032126 Bacteria 1073
148 Ga0307415_100810351 3300032126 Bacteria 855
149 Ga0307415_101231811 3300032126 Bacteria 706
150 Ga0373938_0008590 3300034957 Bacteria 1828
151 Ga0373940_0019975 3300035088 Bacteria 1697
152 Ga0373951_0000213 3300035091 Bacteria 20460
153 Ga0373942_0000033 3300035207 Bacteria 26057
154 Ga0373937_0331034 3300036401 Bacteria 1441
155 Ga0395899_0016451 3300037312 Bacteria 5639
156 Ga0395900_0003395 3300037418 Bacteria 17196
157 Ga0395900_0317218 3300037418 Bacteria 1540
158 Ga0395898_0003058 3300037466 Bacteria 18956
159 Ga0395898_0012990 3300037466 Bacteria 8585
160 Ga0395905_0040873 3300037471 Bacteria 4350
161 Ga0451853_0073508 3300041512 Bacteria 11953
162 Ga0439463_079439 3300042016 Bacteria 843
163 Ga0439464_0098136 3300042439 Bacteria 888
164 Ga0466957_0115146 3300044842 Bacteria 1709
165 Ga0466967_0801466 3300045976 Bacteria 935
166 Ga0495590_0238874 3300046457 Bacteria 674
167 Ga0495638_0200270 3300046460 Bacteria 1128
168 Ga0495687_194547 3300047443 Bacteria 650
169 Ga0496108_0000010 3300048911 Bacteria 273269
170 Ga0496108_0201142 3300048911 Bacteria 1729
171 Ga0496112_0623897 3300048915 Bacteria 1009
172 Ga0496112_0915869 3300048915 Bacteria 798
173 Ga0501046_0248307 3300049580 Bacteria 1311
174 Ga0501047_0585996 3300049581 Bacteria 938
175 nmdc:mga05p37_303108_c1 3300050507 Bacteria 1897
176 nmdc:mga05p37_37259_c1 3300050507 Bacteria 5963
177 nmdc:mga05p37_827641_c1 3300050507 Bacteria 1009
178 nmdc:mga09592_125328_c1 3300050508 Bacteria 2208
179 nmdc:mga09592_193178_c2 3300050508 Bacteria 1438
180 nmdc:mga0qj67_250122_c1 3300050509 Bacteria 1438
181 nmdc:mga0qj67_327215_c1 3300050509 Bacteria 1240
182 nmdc:mga0qj67_38607_c1 3300050509 Bacteria 3747
183 nmdc:mga0qj67_420676_c1 3300050509 Bacteria 1077
184 nmdc:mga0qj67_57086_c1 3300050509 Bacteria 3095
185 nmdc:mga06r32_14871_c1 3300050510 Bacteria 7061
186 nmdc:mga06r32_213903_c1 3300050510 Bacteria 1916
187 nmdc:mga06r32_570027_c1 3300050510 Bacteria 1105
188 nmdc:mga08y16_1214570_c1 3300050511 Bacteria 724
189 nmdc:mga08y16_3990_c1 3300050511 Bacteria 15390
190 nmdc:mga0a205_764624_c1 3300050515 Bacteria 814
191 Ga0500651_0113210 3300053093 Bacteria 1654
192 Ga0500650_0106334 3300053098 Bacteria 1311
193 Ga0500588_0378490 3300053146 Bacteria 539
194 Ga0500600_0259906 3300053149 Bacteria 771

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030522 Ga0307512_10007541 Ga0307512_100075416 138
2 3300046457 Ga0495590_0238874 Ga0495590_0238874_223_642 138
3 3300053146 Ga0500588_0378490 Ga0500588_0378490_75_494 138
4 3300006173 Ga0070716_100188024 Ga0070716_1001880242 162
5 3300005719 Ga0068861_101169245 Ga0068861_1011692451 164
6 3300005985 Ga0081539_10000938 Ga0081539_1000093822 170
7 3300048911 Ga0496108_0201142 Ga0496108_0201142_518_1060 172
8 3300005327 Ga0070658_10031138 Ga0070658_100311385 177
9 3300005344 Ga0070661_100039972 Ga0070661_1000399721 177
10 3300005458 Ga0070681_10310116 Ga0070681_103101162 177
11 3300005530 Ga0070679_100320470 Ga0070679_1003204702 177
12 3300005535 Ga0070684_100351618 Ga0070684_1003516182 177
13 3300005937 Ga0081455_10146576 Ga0081455_101465762 177
14 3300006163 Ga0070715_10141236 Ga0070715_101412362 177
15 3300009174 Ga0105241_10788062 Ga0105241_107880621 177
16 3300013105 Ga0157369_10006173 Ga0157369_100061732 177
17 3300020082 Ga0206353_12053953 Ga0206353_120539534 177
18 3300025909 Ga0207705_10444934 Ga0207705_104449342 177
19 3300025920 Ga0207649_10036827 Ga0207649_100368273 177
20 3300025921 Ga0207652_10079159 Ga0207652_100791592 177
21 3300025932 Ga0207690_10371514 Ga0207690_103715142 177
22 3300025944 Ga0207661_10039999 Ga0207661_100399992 177
23 3300035091 Ga0373951_0000213 Ga0373951_0000213_161_694 177
24 3300036401 Ga0373937_0331034 Ga0373937_0331034_808_1341 177
25 3300048915 Ga0496112_0915869 Ga0496112_0915869_210_743 177
26 iso_pu_bacteria 2831935698 2831939301 177
27 iso_pu_bacteria 2832004796 2832007111 177
28 iso_pu_bacteria 2856858025 2856858671 177
29 iso_pu_bacteria 2858902515 2858903125 177
30 iso_pu_bacteria 2866065130 2866066804 177
31 iso_pu_bacteria 2867507094 2867512177 177
32 iso_pu_bacteria 649633069 649813147 177
33 iso_pu_bacteria 2751185782 2753271482 178
34 3300005983 Ga0081540_1000837 Ga0081540_10008376 179
35 3300006844 Ga0075428_100058408 Ga0075428_1000584084 179
36 3300006846 Ga0075430_100020116 Ga0075430_1000201163 179
37 3300006847 Ga0075431_100015619 Ga0075431_1000156198 179
38 3300006880 Ga0075429_100082216 Ga0075429_1000822163 179
39 3300009147 Ga0114129_10017169 Ga0114129_1001716910 179
40 3300049580 Ga0501046_0248307 Ga0501046_0248307_441_986 179
41 3300049581 Ga0501047_0585996 Ga0501047_0585996_43_585 179
42 3300050507 nmdc:mga05p37_37259_c1 nmdc:mga05p37_37259_c1_4080_4625 179
43 3300050508 nmdc:mga09592_125328_c1 nmdc:mga09592_125328_c1_1214_1759 179
44 3300050509 nmdc:mga0qj67_38607_c1 nmdc:mga0qj67_38607_c1_2858_3403 179
45 3300050509 nmdc:mga0qj67_57086_c1 nmdc:mga0qj67_57086_c1_869_1414 179
46 3300050510 nmdc:mga06r32_213903_c1 nmdc:mga06r32_213903_c1_460_1005 179
47 3300005577 Ga0068857_100501429 Ga0068857_1005014292 180
48 3300005985 Ga0081539_10002602 Ga0081539_100026023 180
49 3300005985 Ga0081539_10007280 Ga0081539_100072804 180
50 3300005985 Ga0081539_10130788 Ga0081539_101307882 180
51 3300006844 Ga0075428_100112749 Ga0075428_1001127492 180
52 3300006844 Ga0075428_100407610 Ga0075428_1004076101 180
53 3300006846 Ga0075430_100209586 Ga0075430_1002095863 180
54 3300006847 Ga0075431_100043073 Ga0075431_1000430733 180
55 3300006847 Ga0075431_100581516 Ga0075431_1005815162 180
56 3300009147 Ga0114129_10053880 Ga0114129_100538802 180
57 3300009147 Ga0114129_10635851 Ga0114129_106358512 180
58 3300025945 Ga0207679_10857903 Ga0207679_108579031 180
59 3300026078 Ga0207702_10854712 Ga0207702_108547122 180
60 3300026116 Ga0207674_10574993 Ga0207674_105749932 180
61 3300050507 nmdc:mga05p37_303108_c1 nmdc:mga05p37_303108_c1_1269_1811 180
62 3300050507 nmdc:mga05p37_827641_c1 nmdc:mga05p37_827641_c1_99_641 180
63 3300050508 nmdc:mga09592_193178_c2 nmdc:mga09592_193178_c2_760_1302 180
64 3300050509 nmdc:mga0qj67_250122_c1 nmdc:mga0qj67_250122_c1_292_834 180
65 3300050509 nmdc:mga0qj67_420676_c1 nmdc:mga0qj67_420676_c1_82_624 180
66 3300050510 nmdc:mga06r32_14871_c1 nmdc:mga06r32_14871_c1_3463_4005 180
67 3300050510 nmdc:mga06r32_570027_c1 nmdc:mga06r32_570027_c1_432_974 180
68 3300050511 nmdc:mga08y16_1214570_c1 nmdc:mga08y16_1214570_c1_10_552 180
69 3300005334 Ga0068869_100309904 Ga0068869_1003099043 181
70 3300005347 Ga0070668_100000772 Ga0070668_10000077217 181
71 3300005347 Ga0070668_100534014 Ga0070668_1005340142 181
72 3300005564 Ga0070664_100469635 Ga0070664_1004696351 181
73 3300005617 Ga0068859_100166532 Ga0068859_1001665322 181
74 3300005844 Ga0068862_100105351 Ga0068862_1001053512 181
75 3300006173 Ga0070716_100359665 Ga0070716_1003596652 181
76 3300006931 Ga0097620_100166523 Ga0097620_1001665232 181
77 3300009098 Ga0105245_10624810 Ga0105245_106248101 181
78 3300010375 Ga0105239_10785916 Ga0105239_107859162 181
79 3300025927 Ga0207687_10475108 Ga0207687_104751082 181
80 3300025944 Ga0207661_10751022 Ga0207661_107510221 181
81 3300025972 Ga0207668_10001417 Ga0207668_100014176 181
82 3300025972 Ga0207668_10345266 Ga0207668_103452662 181
83 3300026023 Ga0207677_10056020 Ga0207677_100560201 181
84 3300026041 Ga0207639_10219762 Ga0207639_102197622 181
85 3300028379 Ga0268266_10624781 Ga0268266_106247812 181
86 3300028794 Ga0307515_10000065 Ga0307515_10000065175 181
87 3300031456 Ga0307513_10089516 Ga0307513_100895161 181
88 3300031901 Ga0307406_10085758 Ga0307406_100857582 181
89 3300031901 Ga0307406_10769703 Ga0307406_107697032 181
90 3300031995 Ga0307409_100164595 Ga0307409_1001645951 181
91 3300032002 Ga0307416_100167740 Ga0307416_1001677403 181
92 3300032126 Ga0307415_100002719 Ga0307415_1000027196 181
93 3300037312 Ga0395899_0016451 Ga0395899_0016451_3733_4278 181
94 3300037418 Ga0395900_0003395 Ga0395900_0003395_15665_16210 181
95 3300037466 Ga0395898_0003058 Ga0395898_0003058_16813_17358 181
96 3300037471 Ga0395905_0040873 Ga0395905_0040873_2027_2572 181
97 3300044842 Ga0466957_0115146 Ga0466957_0115146_318_863 181
98 3300048915 Ga0496112_0623897 Ga0496112_0623897_106_660 181
99 3300003322 rootL2_10190814 rootL2_101908144 182
100 3300005328 Ga0070676_10012368 Ga0070676_100123683 182
101 3300005329 Ga0070683_100006016 Ga0070683_1000060163 182
102 3300005334 Ga0068869_100684700 Ga0068869_1006847001 182
103 3300005336 Ga0070680_100764606 Ga0070680_1007646062 182
104 3300005338 Ga0068868_100039531 Ga0068868_1000395313 182
105 3300005344 Ga0070661_100026894 Ga0070661_1000268943 182
106 3300005345 Ga0070692_10014930 Ga0070692_100149305 182
107 3300005353 Ga0070669_101411802 Ga0070669_1014118021 182
108 3300005354 Ga0070675_100002456 Ga0070675_10000245614 182
109 3300005366 Ga0070659_100053887 Ga0070659_1000538873 182
110 3300005367 Ga0070667_100297437 Ga0070667_1002974371 182
111 3300005436 Ga0070713_100194499 Ga0070713_1001944992 182
112 3300005441 Ga0070700_100011290 Ga0070700_1000112904 182
113 3300005456 Ga0070678_100223598 Ga0070678_1002235982 182
114 3300005457 Ga0070662_100015343 Ga0070662_1000153433 182
115 3300005458 Ga0070681_10918247 Ga0070681_109182472 182
116 3300005535 Ga0070684_100002719 Ga0070684_1000027194 182
117 3300005564 Ga0070664_100004061 Ga0070664_10000406111 182
118 3300005577 Ga0068857_100061825 Ga0068857_1000618253 182
119 3300005615 Ga0070702_100050441 Ga0070702_1000504412 182
120 3300005719 Ga0068861_100388516 Ga0068861_1003885162 182
121 3300005842 Ga0068858_100535448 Ga0068858_1005354482 182
122 3300005844 Ga0068862_100204440 Ga0068862_1002044402 182
123 3300005983 Ga0081540_1016696 Ga0081540_10166962 182
124 3300005985 Ga0081539_10001138 Ga0081539_1000113836 182
125 3300006881 Ga0068865_100040510 Ga0068865_1000405103 182
126 3300009036 Ga0105244_10304969 Ga0105244_103049691 182
127 3300009094 Ga0111539_10002477 Ga0111539_100024777 182
128 3300009098 Ga0105245_10003578 Ga0105245_1000357810 182
129 3300009177 Ga0105248_10164183 Ga0105248_101641834 182
130 3300009553 Ga0105249_10111560 Ga0105249_101115603 182
131 3300010375 Ga0105239_10389828 Ga0105239_103898282 182
132 3300013296 Ga0157374_10599113 Ga0157374_105991131 182
133 3300013306 Ga0163162_10459379 Ga0163162_104593792 182
134 3300014326 Ga0157380_10642342 Ga0157380_106423422 182
135 3300014745 Ga0157377_10006766 Ga0157377_100067663 182
136 3300025907 Ga0207645_10044194 Ga0207645_100441944 182
137 3300025908 Ga0207643_10157693 Ga0207643_101576932 182
138 3300025920 Ga0207649_10010025 Ga0207649_100100253 182
139 3300025921 Ga0207652_10413505 Ga0207652_104135052 182
140 3300025923 Ga0207681_10651991 Ga0207681_106519912 182
141 3300025926 Ga0207659_10002823 Ga0207659_1000282311 182
142 3300025932 Ga0207690_10266520 Ga0207690_102665202 182
143 3300025933 Ga0207706_10094445 Ga0207706_100944452 182
144 3300025942 Ga0207689_10656570 Ga0207689_106565701 182
145 3300025944 Ga0207661_10069909 Ga0207661_100699093 182
146 3300025945 Ga0207679_10054203 Ga0207679_100542032 182
147 3300025961 Ga0207712_10143067 Ga0207712_101430672 182
148 3300025972 Ga0207668_11406525 Ga0207668_114065251 182
149 3300025986 Ga0207658_10087769 Ga0207658_100877692 182
150 3300026023 Ga0207677_10080417 Ga0207677_100804173 182
151 3300026075 Ga0207708_10072077 Ga0207708_100720772 182
152 3300026088 Ga0207641_10369012 Ga0207641_103690122 182
153 3300026116 Ga0207674_10029112 Ga0207674_100291127 182
154 3300026118 Ga0207675_100647099 Ga0207675_1006470992 182
155 3300026121 Ga0207683_10105654 Ga0207683_101056543 182
156 3300028380 Ga0268265_10143544 Ga0268265_101435443 182
157 3300028786 Ga0307517_10072023 Ga0307517_100720232 182
158 3300028794 Ga0307515_10026553 Ga0307515_100265535 182
159 3300030522 Ga0307512_10004293 Ga0307512_100042939 182
160 3300030522 Ga0307512_10047053 Ga0307512_100470534 182
161 3300031456 Ga0307513_10045997 Ga0307513_100459975 182
162 3300031456 Ga0307513_10047253 Ga0307513_100472536 182
163 3300031456 Ga0307513_10352366 Ga0307513_103523661 182
164 3300031507 Ga0307509_10166575 Ga0307509_101665752 182
165 3300031616 Ga0307508_10004400 Ga0307508_100044003 182
166 3300031616 Ga0307508_10017796 Ga0307508_100177965 182
167 3300031730 Ga0307516_10006179 Ga0307516_100061793 182
168 3300031730 Ga0307516_10265185 Ga0307516_102651851 182
169 3300031730 Ga0307516_10316657 Ga0307516_103166571 182
170 3300031731 Ga0307405_10008616 Ga0307405_100086164 182
171 3300031731 Ga0307405_10010475 Ga0307405_100104754 182
172 3300031824 Ga0307413_10580701 Ga0307413_105807011 182
173 3300031824 Ga0307413_10905095 Ga0307413_109050951 182
174 3300031889 Ga0326468_10000979 Ga0326468_100009793 182
175 3300031901 Ga0307406_10042244 Ga0307406_100422442 182
176 3300031903 Ga0307407_10110304 Ga0307407_101103042 182
177 3300031995 Ga0307409_100036062 Ga0307409_1000360623 182
178 3300031995 Ga0307409_100597170 Ga0307409_1005971702 182
179 3300031995 Ga0307409_101167282 Ga0307409_1011672821 182
180 3300032002 Ga0307416_100023628 Ga0307416_1000236282 182
181 3300032126 Ga0307415_100419134 Ga0307415_1004191342 182
182 3300032126 Ga0307415_100489503 Ga0307415_1004895032 182
183 3300032126 Ga0307415_100810351 Ga0307415_1008103512 182
184 3300032126 Ga0307415_101231811 Ga0307415_1012318111 182
185 3300034957 Ga0373938_0008590 Ga0373938_0008590_518_1069 182
186 3300035088 Ga0373940_0019975 Ga0373940_0019975_538_1089 182
187 3300035207 Ga0373942_0000033 Ga0373942_0000033_5511_6062 182
188 3300037418 Ga0395900_0317218 Ga0395900_0317218_77_625 182
189 3300037466 Ga0395898_0012990 Ga0395898_0012990_3883_4431 182
190 3300041512 Ga0451853_0073508 Ga0451853_0073508_1245_1793 182
191 3300042016 Ga0439463_079439 Ga0439463_079439_159_710 182
192 3300042439 Ga0439464_0098136 Ga0439464_0098136_190_741 182
193 3300045976 Ga0466967_0801466 Ga0466967_0801466_49_597 182
194 3300046460 Ga0495638_0200270 Ga0495638_0200270_211_762 182
195 3300047443 Ga0495687_194547 Ga0495687_194547_44_595 182
196 3300048911 Ga0496108_0000010 Ga0496108_0000010_245211_245762 182
197 3300050509 nmdc:mga0qj67_327215_c1 nmdc:mga0qj67_327215_c1_606_1154 182
198 3300050511 nmdc:mga08y16_3990_c1 nmdc:mga08y16_3990_c1_4520_5068 182
199 3300050515 nmdc:mga0a205_764624_c1 nmdc:mga0a205_764624_c1_89_637 182
200 3300053093 Ga0500651_0113210 Ga0500651_0113210_1072_1623 182
201 3300053098 Ga0500650_0106334 Ga0500650_0106334_83_634 182
202 3300053149 Ga0500600_0259906 Ga0500600_0259906_71_622 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

29

164

0.94

PF18306

LDcluster4

SLOG cluster4 family

1

141

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sbx-assembly4.cif.gz_H crystal structure of a putative uncharacterized protein from mycobacterium marinum bound to adenosine 5'-monophosphate amp 0.9907 3 176
3qua-assembly1.cif.gz_B crystal structure of a putative uncharacterized protein and possible molybdenum cofactor protein from mycobacterium smegmatis 0.981 3 176
7w2i-assembly1.cif.gz_D crystal structure of log (rv1205) from mycobacterium tuberculosis 0.979 3 176
5zbl-assembly2.cif.gz_C crystal structure of type-i log from corynebacterium glutamicum in complex with amp 0.9653 3 178
3sbx-assembly4.cif.gz_H crystal structure of a putative uncharacterized protein from mycobacterium marinum bound to adenosine 5'-monophosphate amp 0.963 3 176
ID Description Score Start End Superfamily
3sbxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9907 3 174 3.40.50.450
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9586 1 176 3.40.50.450
3sbxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.952 3 174 3.40.50.450
af_A0A1D6K2U3_1_187_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9408 3 177 3.40.50.450
af_A4HXF6_126_320_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9282 1 177 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A1H3QXX7-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9961 1 174 GO:0005829
GO:0009691
GO:0102682
AF-A0A370FWS5-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9948 3 176 GO:0005829
GO:0009691
GO:0102682
AF-A0A545B1B0-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9945 1 178 GO:0005829
GO:0009691
GO:0102682
AF-A0A1M7QPY8-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9943 2 181 GO:0005829
GO:0009691
GO:0102682
AF-A0A5C7P4V6-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9943 3 181 GO:0005829
GO:0009691
GO:0102682

Feature Viewer

pLDDT pTM Quality
95.94 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map