F309657

General Info

Members Datasets Scaffolds Average Seq Length
202 149 404 123

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10681842|Ga0081455_106818421
Length 136
Sequence VSGDPVPRIIRLSLDIPDAALATRLASLLVDVPGVRLVGAGEAADATVGPPRLAAAAGNATPLAASPSHSDVPLTAREQEVLALLADGASNKEIARRLGISVHTAKFHVGSLLDKLDAVGRTDAVAHAARLGVIHL

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
6 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
38 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
39 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
40 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
41 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
44 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
45 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
46 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
58 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
59 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
60 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
61 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
138 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
142 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
143 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
144 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
145 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
146 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.47
Nodule 0
Rhizoplane 1.98
Rhizosphere 94.06
Stem 0
Stem Tuber 0
Unclassified 25.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10681842 3300005937 Bacteria 657
2 Ga0070709_10094087 3300005434 Bacteria 1982
3 Ga0070713_100296836 3300005436 Unclassified 1487
4 Ga0070713_101346219 3300005436 Bacteria 692
5 Ga0070711_100116498 3300005439 Bacteria 1969
6 Ga0070707_100604409 3300005468 Bacteria 1059
7 Ga0070707_100977465 3300005468 Bacteria 812
8 Ga0070699_100156564 3300005518 Bacteria 2016
9 Ga0070679_100780870 3300005530 Bacteria 898
10 Ga0070697_101140151 3300005536 Bacteria 694
11 Ga0070695_100406885 3300005545 Unclassified 1033
12 Ga0070695_101717987 3300005545 Bacteria 525
13 Ga0070696_100742037 3300005546 Unclassified 804
14 Ga0070704_101216304 3300005549 Unclassified 687
15 Ga0068854_101105987 3300005578 Bacteria 706
16 Ga0081540_1001229 3300005983 Bacteria 22370
17 Ga0081540_1049631 3300005983 Bacteria 2092
18 Ga0081539_10364905 3300005985 Bacteria 605
19 Ga0070717_10837055 3300006028 Bacteria 837
20 Ga0070715_10547516 3300006163 Bacteria 670
21 Ga0075431_100414342 3300006847 Bacteria 1347
22 Ga0075431_101793340 3300006847 Bacteria 570
23 Ga0075433_10054784 3300006852 Bacteria 3480
24 Ga0075433_10132718 3300006852 Bacteria 2213
25 Ga0075434_100029907 3300006871 Bacteria 5361
26 Ga0075434_100365167 3300006871 Unclassified 1464
27 Ga0075436_100315659 3300006914 Unclassified 1122
28 Ga0075436_101327728 3300006914 Bacteria 544
29 Ga0075435_100378352 3300007076 Bacteria 1216
30 Ga0105240_10056048 3300009093 Bacteria 4933
31 Ga0111539_10080690 3300009094 Bacteria 3827
32 Ga0111539_10541232 3300009094 Unclassified 1356
33 Ga0111539_11098697 3300009094 Unclassified 924
34 Ga0114129_10582557 3300009147 Bacteria 1452
35 Ga0114129_10792888 3300009147 Bacteria 1209
36 Ga0114129_13238621 3300009147 Bacteria 528
37 Ga0105248_11918163 3300009177 Bacteria 672
38 Ga0105237_10749019 3300009545 Bacteria 983
39 Ga0105249_10328539 3300009553 Unclassified 1542
40 Ga0105239_12706563 3300010375 Bacteria 579
41 Ga0157370_10019823 3300013104 Bacteria 6730
42 Ga0157369_10641657 3300013105 Bacteria 1095
43 Ga0157372_10927333 3300013307 Bacteria 1010
44 Ga0207692_10308280 3300025898 Unclassified 965
45 Ga0207695_10613847 3300025913 Bacteria 969
46 Ga0207693_10070100 3300025915 Bacteria 2744
47 Ga0207700_11048436 3300025928 Bacteria 729
48 Ga0207665_10107953 3300025939 Bacteria 1952
49 Ga0207428_10166723 3300027907 Bacteria 1670
50 Ga0265337_1081012 3300028556 Bacteria 888
51 Ga0265334_10055609 3300028573 Bacteria 1505
52 Ga0265323_10083009 3300028653 Bacteria 1080
53 Ga0265336_10000447 3300028666 Bacteria 25233
54 Ga0265338_10010384 3300028800 Bacteria 10926
55 Ga0265332_10001666 3300031238 Bacteria 12142
56 Ga0265329_10025669 3300031242 Bacteria 1947
57 Ga0265340_10000923 3300031247 Bacteria 16698
58 Ga0265339_10001666 3300031249 Bacteria 16403
59 Ga0265331_10024279 3300031250 Bacteria 3069
60 Ga0265327_10175443 3300031251 Bacteria 982
61 Ga0265316_10312832 3300031344 Bacteria 1142
62 Ga0265314_10316605 3300031711 Bacteria 869
63 Ga0265342_10000024 3300031712 Bacteria 171500
64 Ga0307405_10491584 3300031731 Bacteria 982
65 Ga0307406_10550509 3300031901 Bacteria 944
66 Ga0307407_11003795 3300031903 Bacteria 645
67 Ga0307409_100712121 3300031995 Unclassified 1004
68 Ga0307409_100913927 3300031995 Bacteria 892
69 Ga0307414_10382699 3300032004 Bacteria 1217
70 Ga0373926_0140889 3300035083 Bacteria 916
71 Ga0373936_0106201 3300035113 Bacteria 1189
72 Ga0373936_0171220 3300035113 Bacteria 949
73 Ga0373945_0081453 3300035116 Bacteria 1241
74 Ga0373943_0331529 3300035170 Bacteria 869
75 Ga0373946_0593779 3300035171 Bacteria 574
76 Ga0373955_0554994 3300035172 Unclassified 703
77 Ga0373935_0190703 3300035692 Unclassified 1412
78 Ga0373935_0788031 3300035692 Bacteria 701
79 Ga0373927_0021603 3300035695 Bacteria 4218
80 Ga0373927_0027830 3300035695 Unclassified 3692
81 Ga0373927_0155583 3300035695 Unclassified 1497
82 Ga0373927_0548914 3300035695 Unclassified 764
83 Ga0373927_0668508 3300035695 Archaea 686
84 Ga0373933_0166906 3300035724 Bacteria 1400
85 Ga0373933_0266522 3300035724 Bacteria 1105
86 Ga0373933_0306399 3300035724 Unclassified 1029
87 Ga0373947_0105783 3300035725 Bacteria 1773
88 Ga0373947_0461524 3300035725 Unclassified 861
89 Ga0373937_0176674 3300036401 Bacteria 2005
90 Ga0373937_0501762 3300036401 Archaea 1153
91 Ga0373925_0387993 3300037068 Bacteria 1138
92 Ga0373925_0480294 3300037068 Bacteria 1019
93 Ga0395899_0537093 3300037312 Bacteria 753
94 Ga0395900_0031920 3300037418 Bacteria 5413
95 Ga0395900_0515398 3300037418 Bacteria 1144
96 Ga0395898_0335177 3300037466 Bacteria 1442
97 Ga0395898_0839104 3300037466 Bacteria 858
98 Ga0395905_0405707 3300037471 Unclassified 1258
99 Ga0395901_0462037 3300038443 Bacteria 1297
100 Ga0395901_0568856 3300038443 Bacteria 1146
101 Ga0439448_0300937 3300042005 Unclassified 569
102 Ga0466967_1565605 3300045976 Bacteria 656
103 Ga0495592_0261172 3300046454 Archaea 1141
104 Ga0495592_0812389 3300046454 Bacteria 555
105 Ga0495603_0002763 3300046455 Bacteria 10343
106 Ga0495603_0201595 3300046455 Bacteria 1150
107 Ga0495651_0811264 3300046462 Unclassified 577
108 Ga0495653_0574721 3300046463 Unclassified 695
109 Ga0495650_0325796 3300046471 Bacteria 511
110 Ga0495582_0091254 3300046473 Bacteria 1699
111 Ga0495639_0078558 3300046475 Bacteria 1534
112 Ga0495662_0588781 3300046476 Unclassified 544
113 Ga0495664_0097583 3300046477 Unclassified 1769
114 Ga0495585_0142817 3300046492 Bacteria 1253
115 Ga0495608_0297310 3300046511 Bacteria 1000
116 Ga0495618_0012352 3300046514 Bacteria 5184
117 Ga0495618_0185685 3300046514 Unclassified 1320
118 Ga0495630_0761673 3300046517 Unclassified 740
119 Ga0495630_1125123 3300046517 Unclassified 595
120 Ga0495652_0137532 3300046529 Unclassified 1925
121 Ga0495654_0146477 3300046530 Bacteria 1048
122 Ga0495640_0086595 3300046533 Unclassified 2074
123 Ga0495640_0565285 3300046533 Unclassified 689
124 Ga0495587_0106860 3300046536 Unclassified 1610
125 Ga0495609_0366902 3300046538 Bacteria 579
126 Ga0495645_0727626 3300046543 Bacteria 600
127 Ga0495667_0330691 3300046559 Bacteria 964
128 Ga0495634_0014309 3300046642 Bacteria 5724
129 Ga0495634_0089822 3300046642 Bacteria 1996
130 Ga0495635_0382051 3300046663 Unclassified 937
131 Ga0495647_0078042 3300046681 Bacteria 1338
132 Ga0495658_0003603 3300046683 Bacteria 7667
133 Ga0495658_0280378 3300046683 Unclassified 1052
134 Ga0495613_0386731 3300046689 Unclassified 956
135 Ga0495624_0107428 3300046690 Unclassified 1717
136 Ga0495624_0216848 3300046690 Bacteria 1161
137 Ga0495624_0428746 3300046690 Unclassified 793
138 Ga0495581_0445461 3300047315 Unclassified 754
139 Ga0495581_0507019 3300047315 Unclassified 701
140 Ga0495604_0159839 3300047317 Archaea 1593
141 Ga0495604_1039250 3300047317 Unclassified 505
142 Ga0495674_0501061 3300047319 Unclassified 971
143 Ga0495676_0222191 3300047321 Unclassified 1301
144 Ga0495675_0550321 3300047444 Unclassified 658
145 Ga0495684_0037638 3300047471 Bacteria 3711
146 Ga0495684_0179248 3300047471 Unclassified 1571
147 Ga0495593_0464502 3300047673 Unclassified 634
148 Ga0496101_1494870 3300048904 Unclassified 526
149 Ga0496110_0735588 3300048913 Bacteria 889
150 Ga0496112_0761598 3300048915 Bacteria 894
151 Ga0496114_0583190 3300048917 Unclassified 987
152 Ga0496126_0016159 3300048929 Bacteria 7476
153 Ga0501038_0037085 3300049574 Bacteria 4277
154 Ga0501040_0935108 3300049576 Unclassified 628
155 Ga0501041_0018097 3300049577 Bacteria 4196
156 Ga0501042_0333502 3300049578 Bacteria 1096
157 Ga0501046_0194488 3300049580 Bacteria 1512
158 Ga0501048_0036239 3300049582 Bacteria 3546
159 Ga0501072_1320891 3300049588 Bacteria 559
160 Ga0501074_0039455 3300049590 Bacteria 3420
161 Ga0501075_0155095 3300049591 Bacteria 1746
162 Ga0501076_0005321 3300049592 Bacteria 9236
163 Ga0501077_0086742 3300049593 Bacteria 1984
164 Ga0501077_0289478 3300049593 Bacteria 1043
165 Ga0501079_0029537 3300049741 Bacteria 4209
166 Ga0501079_1069141 3300049741 Bacteria 636
167 Ga0501080_0152031 3300049742 Bacteria 2139
168 Ga0501083_0080346 3300049744 Bacteria 2162
169 Ga0501045_0085845 3300049824 Bacteria 2323
170 Ga0501045_0681705 3300049824 Bacteria 759
171 nmdc:mga05p37_1895515_c1 3300050507 Unclassified 570
172 nmdc:mga05p37_1987565_c1 3300050507 Bacteria 551
173 nmdc:mga05p37_260331_c1 3300050507 Bacteria 2076
174 nmdc:mga0qj67_1057497_c1 3300050509 Bacteria 635
175 nmdc:mga06r32_502636_c1 3300050510 Bacteria 1189
176 nmdc:mga08y16_1361665_c1 3300050511 Unclassified 674
177 nmdc:mga08y16_57522_c1 3300050511 Bacteria 4063
178 nmdc:mga0n895_22212_c1 3300050512 Bacteria 5948
179 nmdc:mga0n895_327028_c1 3300050512 Bacteria 1553
180 nmdc:mga08x19_1275976_c1 3300050514 Unclassified 520
181 nmdc:mga0a205_28408_c1 3300050515 Bacteria 5349
182 nmdc:mga0a205_345363_c1 3300050515 Bacteria 1356
183 Ga0495601_0007049 3300053077 Bacteria 6587
184 Ga0495601_0008499 3300053077 Bacteria 6063
185 Ga0495601_0154340 3300053077 Bacteria 1499
186 Ga0495601_0208218 3300053077 Bacteria 1278
187 Ga0495612_0100637 3300053078 Unclassified 1230
188 Ga0495612_0554923 3300053078 Bacteria 529
189 Ga0500635_0021099 3300053080 Bacteria 2002
190 Ga0495595_0153819 3300053084 Bacteria 1133
191 Ga0495595_0464081 3300053084 Unclassified 644
192 Ga0495619_0019795 3300053085 Bacteria 4282
193 Ga0495619_0532129 3300053085 Bacteria 807
194 Ga0500643_165900 3300053087 Bacteria 592
195 Ga0500566_0290175 3300053094 Bacteria 775
196 Ga0500554_059150 3300053102 Bacteria 1225
197 Ga0500603_001784 3300053150 Bacteria 4836
198 Ga0500638_051136 3300053162 Bacteria 1998
199 Ga0500636_0015878 3300053177 Bacteria 4436
200 Ga0501084_0023293 3300054114 Bacteria 5170
201 Ga0501082_0055310 3300060353 Bacteria 3419
202 2883292769 2883291878 Bacteria 5894118
203 Ga0081455_10681842
204 Ga0070709_10094087
205 Ga0070713_100296836
206 Ga0070713_101346219
207 Ga0070711_100116498
208 Ga0070707_100604409
209 Ga0070707_100977465
210 Ga0070699_100156564
211 Ga0070679_100780870
212 Ga0070697_101140151
213 Ga0070695_100406885
214 Ga0070695_101717987
215 Ga0070696_100742037
216 Ga0070704_101216304
217 Ga0068854_101105987
218 Ga0081540_1001229
219 Ga0081540_1049631
220 Ga0081539_10364905
221 Ga0070717_10837055
222 Ga0070715_10547516
223 Ga0075431_100414342
224 Ga0075431_101793340
225 Ga0075433_10054784
226 Ga0075433_10132718
227 Ga0075434_100029907
228 Ga0075434_100365167
229 Ga0075436_100315659
230 Ga0075436_101327728
231 Ga0075435_100378352
232 Ga0105240_10056048
233 Ga0111539_10080690
234 Ga0111539_10541232
235 Ga0111539_11098697
236 Ga0114129_10582557
237 Ga0114129_10792888
238 Ga0114129_13238621
239 Ga0105248_11918163
240 Ga0105237_10749019
241 Ga0105249_10328539
242 Ga0105239_12706563
243 Ga0157370_10019823
244 Ga0157369_10641657
245 Ga0157372_10927333
246 Ga0207692_10308280
247 Ga0207695_10613847
248 Ga0207693_10070100
249 Ga0207700_11048436
250 Ga0207665_10107953
251 Ga0207428_10166723
252 Ga0265337_1081012
253 Ga0265334_10055609
254 Ga0265323_10083009
255 Ga0265336_10000447
256 Ga0265338_10010384
257 Ga0265332_10001666
258 Ga0265329_10025669
259 Ga0265340_10000923
260 Ga0265339_10001666
261 Ga0265331_10024279
262 Ga0265327_10175443
263 Ga0265316_10312832
264 Ga0265314_10316605
265 Ga0265342_10000024
266 Ga0307405_10491584
267 Ga0307406_10550509
268 Ga0307407_11003795
269 Ga0307409_100712121
270 Ga0307409_100913927
271 Ga0307414_10382699
272 Ga0373926_0140889
273 Ga0373936_0106201
274 Ga0373936_0171220
275 Ga0373945_0081453
276 Ga0373943_0331529
277 Ga0373946_0593779
278 Ga0373955_0554994
279 Ga0373935_0190703
280 Ga0373935_0788031
281 Ga0373927_0021603
282 Ga0373927_0027830
283 Ga0373927_0155583
284 Ga0373927_0548914
285 Ga0373927_0668508
286 Ga0373933_0166906
287 Ga0373933_0266522
288 Ga0373933_0306399
289 Ga0373947_0105783
290 Ga0373947_0461524
291 Ga0373937_0176674
292 Ga0373937_0501762
293 Ga0373925_0387993
294 Ga0373925_0480294
295 Ga0395899_0537093
296 Ga0395900_0031920
297 Ga0395900_0515398
298 Ga0395898_0335177
299 Ga0395898_0839104
300 Ga0395905_0405707
301 Ga0395901_0462037
302 Ga0395901_0568856
303 Ga0439448_0300937
304 Ga0466967_1565605
305 Ga0495592_0261172
306 Ga0495592_0812389
307 Ga0495603_0002763
308 Ga0495603_0201595
309 Ga0495651_0811264
310 Ga0495653_0574721
311 Ga0495650_0325796
312 Ga0495582_0091254
313 Ga0495639_0078558
314 Ga0495662_0588781
315 Ga0495664_0097583
316 Ga0495585_0142817
317 Ga0495608_0297310
318 Ga0495618_0012352
319 Ga0495618_0185685
320 Ga0495630_0761673
321 Ga0495630_1125123
322 Ga0495652_0137532
323 Ga0495654_0146477
324 Ga0495640_0086595
325 Ga0495640_0565285
326 Ga0495587_0106860
327 Ga0495609_0366902
328 Ga0495645_0727626
329 Ga0495667_0330691
330 Ga0495634_0014309
331 Ga0495634_0089822
332 Ga0495635_0382051
333 Ga0495647_0078042
334 Ga0495658_0003603
335 Ga0495658_0280378
336 Ga0495613_0386731
337 Ga0495624_0107428
338 Ga0495624_0216848
339 Ga0495624_0428746
340 Ga0495581_0445461
341 Ga0495581_0507019
342 Ga0495604_0159839
343 Ga0495604_1039250
344 Ga0495674_0501061
345 Ga0495676_0222191
346 Ga0495675_0550321
347 Ga0495684_0037638
348 Ga0495684_0179248
349 Ga0495593_0464502
350 Ga0496101_1494870
351 Ga0496110_0735588
352 Ga0496112_0761598
353 Ga0496114_0583190
354 Ga0496126_0016159
355 Ga0501038_0037085
356 Ga0501040_0935108
357 Ga0501041_0018097
358 Ga0501042_0333502
359 Ga0501046_0194488
360 Ga0501048_0036239
361 Ga0501072_1320891
362 Ga0501074_0039455
363 Ga0501075_0155095
364 Ga0501076_0005321
365 Ga0501077_0086742
366 Ga0501077_0289478
367 Ga0501079_0029537
368 Ga0501079_1069141
369 Ga0501080_0152031
370 Ga0501083_0080346
371 Ga0501045_0085845
372 Ga0501045_0681705
373 nmdc:mga05p37_1895515_c1
374 nmdc:mga05p37_1987565_c1
375 nmdc:mga05p37_260331_c1
376 nmdc:mga0qj67_1057497_c1
377 nmdc:mga06r32_502636_c1
378 nmdc:mga08y16_1361665_c1
379 nmdc:mga08y16_57522_c1
380 nmdc:mga0n895_22212_c1
381 nmdc:mga0n895_327028_c1
382 nmdc:mga08x19_1275976_c1
383 nmdc:mga0a205_28408_c1
384 nmdc:mga0a205_345363_c1
385 Ga0495601_0007049
386 Ga0495601_0008499
387 Ga0495601_0154340
388 Ga0495601_0208218
389 Ga0495612_0100637
390 Ga0495612_0554923
391 Ga0500635_0021099
392 Ga0495595_0153819
393 Ga0495595_0464081
394 Ga0495619_0019795
395 Ga0495619_0532129
396 Ga0500643_165900
397 Ga0500566_0290175
398 Ga0500554_059150
399 Ga0500603_001784
400 Ga0500638_051136
401 Ga0500636_0015878
402 Ga0501084_0023293
403 Ga0501082_0055310
404 2883292769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

72

128

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

74

116

0.93

PF13384

HTH_23

Homeodomain-like domain

73

106

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c57-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain crystal form ii 0.9688 62 105
6kju-assembly1.cif.gz_B huge conformation shift of vibrio cholerae vqma dimer in the absence of target dna provides insight into dna-binding mechanisms of luxr-type receptors 0.9458 62 105
3qp5-assembly2.cif.gz_D crystal structure of cvir bound to antagonist chlorolactone (cl) 0.9289 62 105
6cbq-assembly1.cif.gz_A crystal structure of qscr bound to agonist s3 0.9148 62 105
7qh5-assembly1.cif.gz_A the crystal structure of the sigma factor sigg1 from streptomyces tsukubaensis nrrl18488 0.8906 62 107
ID Description Score Start End Superfamily
3c57B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9724 63 104 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9419 62 105 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9405 62 105 1.10.10.10
3qp5D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9289 62 105 1.10.10.10
4i98B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8912 65 105 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A8B0GMW2-F1-model_v4 deleted 0.8608 53 105
AF-A0A6N8JNZ5-F1-model_v4 HTH luxR-type domain-containing protein 0.8563 53 105 GO:0003677
GO:0006355
GO:0016020
AF-A0A2V2EPZ5-F1-model_v4 deleted 0.8526 53 105
AF-F7UZJ6-F1-model_v4 HTH luxR-type domain-containing protein 0.8496 53 105 GO:0003677
GO:0006355
AF-A0A256F303-F1-model_v4 Bacterial regulatory, luxR family protein 0.8492 53 105 GO:0003677
GO:0006355

Map