F309603

General Info

Members Datasets Scaffolds Average Seq Length
202 143 404 218

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100429101|Ga0068855_1004291011
Length 233
Sequence MAQAVGAFALGGCVSLVRVHNFAISLDGFGTGEGQSLETPFGHAGHQLHDWFFPTQAFRAQQGEPGGSRGVDNAFAGQWGPGVGVEIMGRNKFGYQRGPWADEEWQGWWGDNPPFHTPVVVLTHHVRPPLEMQGGTTFHFVDKDPADALDFARDLAGDLDVRIGGGVSTVRQFLAADLIDHMHVVVVPIVLGRGERLWDGLDCLDQRFDIEAVSSPSGVTHLTFTRETPVGLT

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
44 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
69 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
70 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
71 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
72 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
73 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
104 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
105 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
106 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
107 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
124 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
125 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
126 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
127 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
128 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
129 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
130 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
131 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
132 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
133 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
134 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
135 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
136 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
137 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
138 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
139 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
140 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
141 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
142 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
143 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.09
Metatranscriptomes 1.98
Isolates 6.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.93
Nodule 0
Rhizoplane 1.98
Rhizosphere 79.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100429101 3300005563 Bacteria 1445
2 LJQas_1008000 3300000549 Bacteria 1294
3 JGI25406J46586_10001751 3300003203 Bacteria 10207
4 Ga0055542_1003189 3300003762 Bacteria 4612
5 Ga0065714_10101191 3300005288 Bacteria 1649
6 Ga0070683_101143459 3300005329 Bacteria 748
7 Ga0070680_100001458 3300005336 Bacteria 17148
8 Ga0068868_100046877 3300005338 Bacteria 3384
9 Ga0070660_100287032 3300005339 Bacteria 1347
10 Ga0070692_10176794 3300005345 Bacteria 1234
11 Ga0070659_100000541 3300005366 Bacteria 27562
12 Ga0070659_100011632 3300005366 Bacteria 6511
13 Ga0070681_10000167 3300005458 Bacteria 50063
14 Ga0070681_10012774 3300005458 Bacteria 8333
15 Ga0070681_10016435 3300005458 Bacteria 7388
16 Ga0070679_100000271 3300005530 Bacteria 43416
17 Ga0070679_100180823 3300005530 Bacteria 2081
18 Ga0070679_100526322 3300005530 Bacteria 1126
19 Ga0070686_100495540 3300005544 Bacteria 947
20 Ga0081539_10001393 3300005985 Bacteria 41656
21 Ga0105243_10663545 3300009148 Bacteria 1012
22 Ga0105242_10674744 3300009176 Bacteria 1008
23 Ga0105248_10705047 3300009177 Bacteria 1139
24 Ga0105237_10124081 3300009545 Bacteria 2577
25 Ga0105239_10986614 3300010375 Bacteria 968
26 Ga0157373_10058156 3300013100 Bacteria 2742
27 Ga0157371_10005606 3300013102 Bacteria 10555
28 Ga0157369_10000398 3300013105 Bacteria 57899
29 Ga0157369_10002850 3300013105 Bacteria 20654
30 Ga0157369_10003331 3300013105 Bacteria 19087
31 Ga0157369_10005120 3300013105 Bacteria 15350
32 Ga0157369_10020146 3300013105 Bacteria 7458
33 Ga0157369_10058504 3300013105 Bacteria 4158
34 Ga0163163_10016998 3300014325 Bacteria 6774
35 Ga0197907_10964550 3300020069 Bacteria 1939
36 Ga0206353_10518244 3300020082 Bacteria 2211
37 Ga0224712_10016765 3300022467 Bacteria 2414
38 Ga0224712_10139946 3300022467 Bacteria 1064
39 Ga0209148_1001748 3300025254 Bacteria 9395
40 Ga0207692_10343969 3300025898 Bacteria 918
41 Ga0207705_10189313 3300025909 Bacteria 1555
42 Ga0207707_10000109 3300025912 Bacteria 82750
43 Ga0207707_10027033 3300025912 Bacteria 5015
44 Ga0207707_10039393 3300025912 Bacteria 4131
45 Ga0207671_10097264 3300025914 Bacteria 2225
46 Ga0207660_10000090 3300025917 Bacteria 49164
47 Ga0207660_10191468 3300025917 Bacteria 1593
48 Ga0207657_10047277 3300025919 Bacteria 3764
49 Ga0207657_10671913 3300025919 Bacteria 806
50 Ga0207652_10000520 3300025921 Bacteria 39057
51 Ga0207652_10120074 3300025921 Bacteria 2338
52 Ga0207652_10131294 3300025921 Bacteria 2234
53 Ga0207700_10471349 3300025928 Bacteria 1109
54 Ga0207664_10618498 3300025929 Bacteria 973
55 Ga0207690_10000426 3300025932 Bacteria 27493
56 Ga0207669_10231562 3300025937 Bacteria 1363
57 Ga0207689_10080829 3300025942 Bacteria 2672
58 Ga0207667_10840571 3300025949 Bacteria 913
59 Ga0207677_10013139 3300026023 Bacteria 4787
60 Ga0265325_10020843 3300031241 Bacteria 3608
61 Ga0265325_10055346 3300031241 Bacteria 2029
62 Ga0265340_10012326 3300031247 Bacteria 4517
63 Ga0265340_10026010 3300031247 Bacteria 2961
64 Ga0265339_10091367 3300031249 Bacteria 1595
65 Ga0265327_10083343 3300031251 Bacteria 1574
66 Ga0307408_100172169 3300031548 Bacteria 1729
67 Ga0265313_10062334 3300031595 Bacteria 1742
68 Ga0265342_10125895 3300031712 Bacteria 1439
69 Ga0307405_10185147 3300031731 Bacteria 1498
70 Ga0307405_10292663 3300031731 Bacteria 1231
71 Ga0307410_10203021 3300031852 Bacteria 1514
72 Ga0307406_10010220 3300031901 Bacteria 5288
73 Ga0307406_10034210 3300031901 Bacteria 3116
74 Ga0307407_10060475 3300031903 Bacteria 2211
75 Ga0307412_10049834 3300031911 Bacteria 2760
76 Ga0307412_10912251 3300031911 Bacteria 771
77 Ga0307409_100477451 3300031995 Bacteria 1209
78 Ga0307416_100033262 3300032002 Bacteria 3906
79 Ga0307416_100044141 3300032002 Bacteria 3497
80 Ga0307416_100073280 3300032002 Bacteria 2854
81 Ga0307416_101500650 3300032002 Bacteria 780
82 Ga0307414_10008053 3300032004 Bacteria 5956
83 Ga0307411_10127819 3300032005 Bacteria 1852
84 Ga0307415_100115498 3300032126 Bacteria 2001
85 Ga0373956_0171835 3300035119 Bacteria 1023
86 Ga0395899_0005749 3300037312 Bacteria 9626
87 Ga0395899_0323107 3300037312 Bacteria 1039
88 Ga0395900_0012917 3300037418 Bacteria 8531
89 Ga0395900_0045554 3300037418 Bacteria 4518
90 Ga0395900_0047256 3300037418 Bacteria 4432
91 Ga0395898_0034956 3300037466 Bacteria 5001
92 Ga0395898_0036691 3300037466 Bacteria 4866
93 Ga0395898_0075483 3300037466 Bacteria 3256
94 Ga0395898_0324579 3300037466 Bacteria 1468
95 Ga0395905_0277667 3300037471 Bacteria 1561
96 Ga0436364_0525485 3300037853 Bacteria 60710
97 Ga0436364_0610049 3300037853 Bacteria 4082
98 Ga0395901_0002759 3300038443 Bacteria 17705
99 Ga0395901_0233294 3300038443 Bacteria 1921
100 Ga0395901_0307856 3300038443 Bacteria 1641
101 Ga0436363_1678290 3300039450 Bacteria 774
102 Ga0451789_0015647 3300041443 Bacteria 1658
103 Ga0451791_0799557 3300041451 Bacteria 1312
104 Ga0451795_0452946 3300041456 Bacteria 944
105 Ga0439449_0077571 3300042007 Bacteria 1225
106 Ga0439462_0087016 3300042015 Bacteria 855
107 Ga0439434_0074238 3300042435 Bacteria 1073
108 Ga0466972_0111863 3300044658 Bacteria 1290
109 Ga0466965_0114859 3300044683 Bacteria 1386
110 Ga0466966_0134882 3300044684 Bacteria 1510
111 Ga0466961_0520700 3300044693 Bacteria 717
112 Ga0466963_0090365 3300044694 Bacteria 2085
113 Ga0466963_0526686 3300044694 Bacteria 834
114 Ga0466963_0718390 3300044694 Bacteria 705
115 Ga0466964_0449293 3300044706 Bacteria 683
116 Ga0466957_0111830 3300044842 Bacteria 1733
117 Ga0466957_0192512 3300044842 Bacteria 1337
118 Ga0466960_0060007 3300044901 Bacteria 1863
119 Ga0466959_0223263 3300045049 Bacteria 1306
120 Ga0466959_0582040 3300045049 Bacteria 754
121 Ga0466958_0493746 3300045836 Bacteria 794
122 Ga0466967_0241123 3300045976 Bacteria 1725
123 Ga0495653_0249975 3300046463 Bacteria 1177
124 Ga0495580_0017171 3300046472 Bacteria 5418
125 Ga0495582_0007977 3300046473 Bacteria 5849
126 Ga0495582_0023526 3300046473 Bacteria 3370
127 Ga0495639_0006639 3300046475 Bacteria 4976
128 Ga0495662_0014345 3300046476 Bacteria 3855
129 Ga0495630_0225137 3300046517 Bacteria 1432
130 Ga0495642_0053003 3300046528 Bacteria 1671
131 Ga0495665_0030983 3300046531 Bacteria 2862
132 Ga0495665_0116546 3300046531 Bacteria 1399
133 Ga0495586_0001227 3300046535 Bacteria 14396
134 Ga0495586_0063824 3300046535 Bacteria 2006
135 Ga0495587_0018860 3300046536 Bacteria 4276
136 Ga0495645_0037166 3300046543 Bacteria 3548
137 Ga0495667_0003712 3300046559 Bacteria 10265
138 Ga0495623_0142054 3300046679 Bacteria 1427
139 Ga0495581_0003466 3300047315 Bacteria 9054
140 Ga0495581_0065116 3300047315 Bacteria 2106
141 Ga0495680_0203253 3300047322 Bacteria 1420
142 Ga0495675_0088038 3300047444 Bacteria 1950
143 Ga0495684_0313591 3300047471 Bacteria 1123
144 Ga0496114_0002330 3300048917 Bacteria 14456
145 Ga0496117_0001359 3300048920 Bacteria 35660
146 Ga0496117_0002303 3300048920 Bacteria 24577
147 Ga0496118_0343105 3300048921 Bacteria 799
148 Ga0496119_0044337 3300048922 Bacteria 2802
149 Ga0496119_0084958 3300048922 Bacteria 1813
150 Ga0496120_0045173 3300048923 Bacteria 2554
151 Ga0496122_0057306 3300048925 Bacteria 2895
152 Ga0496124_0051214 3300048927 Bacteria 3514
153 Ga0496125_0033520 3300048928 Bacteria 4543
154 Ga0496125_0108737 3300048928 Bacteria 2016
155 Ga0496126_0004670 3300048929 Bacteria 16198
156 Ga0496126_0126974 3300048929 Bacteria 2207
157 Ga0496126_0127450 3300048929 Bacteria 2202
158 Ga0496126_0155348 3300048929 Bacteria 1958
159 Ga0501032_0032826 3300049569 Bacteria 3557
160 Ga0501033_0092449 3300049570 Bacteria 2212
161 Ga0501034_0137811 3300049571 Bacteria 2421
162 Ga0501036_0136247 3300049572 Bacteria 2072
163 Ga0501037_0003821 3300049573 Bacteria 10928
164 Ga0501037_0034882 3300049573 Bacteria 3711
165 Ga0501038_0039064 3300049574 Bacteria 4153
166 Ga0501038_0222156 3300049574 Bacteria 1506
167 Ga0501039_0025148 3300049575 Bacteria 4574
168 Ga0501039_0376958 3300049575 Bacteria 1114
169 Ga0501043_0033836 3300049579 Bacteria 4021
170 Ga0501047_0030233 3300049581 Bacteria 5222
171 Ga0501070_0062454 3300049586 Bacteria 3086
172 Ga0501070_0158454 3300049586 Bacteria 1867
173 Ga0501070_0370519 3300049586 Bacteria 1161
174 Ga0501035_0085728 3300049822 Bacteria 2775
175 Ga0501044_0111063 3300049823 Bacteria 2749
176 Ga0500650_0035727 3300053098 Bacteria 2278
177 Ga0500559_0000736 3300053136 Bacteria 21465
178 Ga0500559_0071788 3300053136 Bacteria 1560
179 Ga0500568_0000285 3300053139 Bacteria 41989
180 Ga0500573_0000024 3300053140 Bacteria 151713
181 Ga0500573_0002953 3300053140 Bacteria 8673
182 Ga0500573_0024841 3300053140 Bacteria 3446
183 Ga0500573_0099581 3300053140 Bacteria 1637
184 Ga0500573_0153326 3300053140 Bacteria 1259
185 Ga0500573_0224488 3300053140 Bacteria 983
186 Ga0500616_0000021 3300053153 Bacteria 484527
187 Ga0500645_012339 3300053730 Bacteria 2763
188 Ga0530510_0741722 3300061734 Bacteria 749
189 2691512973 2690315906 Bacteria 4517044
190 2795784818 2795385470 Bacteria 8317180
191 2808631322 2808606306 Bacteria 3608896
192 2848551407 2848551377 Bacteria 3720646
193 2852644590 2852643534 Bacteria 3013378
194 2857731480 2857729791 Bacteria 4040535
195 2870624774 2870622029 Bacteria 3643329
196 2905929647 2905926851 Bacteria 4423176
197 2928121979 2928121344 Bacteria 3972376
198 2945920544 2945920336 Bacteria 4501603
199 2946004700 2946003308 Bacteria 3857229
200 2946039149 2946037020 Bacteria 4900426
201 2974304505 2974302888 Bacteria 4369871
202 8056037686 8056037122 Bacteria 3854319
203 Ga0068855_100429101
204 LJQas_1008000
205 JGI25406J46586_10001751
206 Ga0055542_1003189
207 Ga0065714_10101191
208 Ga0070683_101143459
209 Ga0070680_100001458
210 Ga0068868_100046877
211 Ga0070660_100287032
212 Ga0070692_10176794
213 Ga0070659_100000541
214 Ga0070659_100011632
215 Ga0070681_10000167
216 Ga0070681_10012774
217 Ga0070681_10016435
218 Ga0070679_100000271
219 Ga0070679_100180823
220 Ga0070679_100526322
221 Ga0070686_100495540
222 Ga0081539_10001393
223 Ga0105243_10663545
224 Ga0105242_10674744
225 Ga0105248_10705047
226 Ga0105237_10124081
227 Ga0105239_10986614
228 Ga0157373_10058156
229 Ga0157371_10005606
230 Ga0157369_10000398
231 Ga0157369_10002850
232 Ga0157369_10003331
233 Ga0157369_10005120
234 Ga0157369_10020146
235 Ga0157369_10058504
236 Ga0163163_10016998
237 Ga0197907_10964550
238 Ga0206353_10518244
239 Ga0224712_10016765
240 Ga0224712_10139946
241 Ga0209148_1001748
242 Ga0207692_10343969
243 Ga0207705_10189313
244 Ga0207707_10000109
245 Ga0207707_10027033
246 Ga0207707_10039393
247 Ga0207671_10097264
248 Ga0207660_10000090
249 Ga0207660_10191468
250 Ga0207657_10047277
251 Ga0207657_10671913
252 Ga0207652_10000520
253 Ga0207652_10120074
254 Ga0207652_10131294
255 Ga0207700_10471349
256 Ga0207664_10618498
257 Ga0207690_10000426
258 Ga0207669_10231562
259 Ga0207689_10080829
260 Ga0207667_10840571
261 Ga0207677_10013139
262 Ga0265325_10020843
263 Ga0265325_10055346
264 Ga0265340_10012326
265 Ga0265340_10026010
266 Ga0265339_10091367
267 Ga0265327_10083343
268 Ga0307408_100172169
269 Ga0265313_10062334
270 Ga0265342_10125895
271 Ga0307405_10185147
272 Ga0307405_10292663
273 Ga0307410_10203021
274 Ga0307406_10010220
275 Ga0307406_10034210
276 Ga0307407_10060475
277 Ga0307412_10049834
278 Ga0307412_10912251
279 Ga0307409_100477451
280 Ga0307416_100033262
281 Ga0307416_100044141
282 Ga0307416_100073280
283 Ga0307416_101500650
284 Ga0307414_10008053
285 Ga0307411_10127819
286 Ga0307415_100115498
287 Ga0373956_0171835
288 Ga0395899_0005749
289 Ga0395899_0323107
290 Ga0395900_0012917
291 Ga0395900_0045554
292 Ga0395900_0047256
293 Ga0395898_0034956
294 Ga0395898_0036691
295 Ga0395898_0075483
296 Ga0395898_0324579
297 Ga0395905_0277667
298 Ga0436364_0525485
299 Ga0436364_0610049
300 Ga0395901_0002759
301 Ga0395901_0233294
302 Ga0395901_0307856
303 Ga0436363_1678290
304 Ga0451789_0015647
305 Ga0451791_0799557
306 Ga0451795_0452946
307 Ga0439449_0077571
308 Ga0439462_0087016
309 Ga0439434_0074238
310 Ga0466972_0111863
311 Ga0466965_0114859
312 Ga0466966_0134882
313 Ga0466961_0520700
314 Ga0466963_0090365
315 Ga0466963_0526686
316 Ga0466963_0718390
317 Ga0466964_0449293
318 Ga0466957_0111830
319 Ga0466957_0192512
320 Ga0466960_0060007
321 Ga0466959_0223263
322 Ga0466959_0582040
323 Ga0466958_0493746
324 Ga0466967_0241123
325 Ga0495653_0249975
326 Ga0495580_0017171
327 Ga0495582_0007977
328 Ga0495582_0023526
329 Ga0495639_0006639
330 Ga0495662_0014345
331 Ga0495630_0225137
332 Ga0495642_0053003
333 Ga0495665_0030983
334 Ga0495665_0116546
335 Ga0495586_0001227
336 Ga0495586_0063824
337 Ga0495587_0018860
338 Ga0495645_0037166
339 Ga0495667_0003712
340 Ga0495623_0142054
341 Ga0495581_0003466
342 Ga0495581_0065116
343 Ga0495680_0203253
344 Ga0495675_0088038
345 Ga0495684_0313591
346 Ga0496114_0002330
347 Ga0496117_0001359
348 Ga0496117_0002303
349 Ga0496118_0343105
350 Ga0496119_0044337
351 Ga0496119_0084958
352 Ga0496120_0045173
353 Ga0496122_0057306
354 Ga0496124_0051214
355 Ga0496125_0033520
356 Ga0496125_0108737
357 Ga0496126_0004670
358 Ga0496126_0126974
359 Ga0496126_0127450
360 Ga0496126_0155348
361 Ga0501032_0032826
362 Ga0501033_0092449
363 Ga0501034_0137811
364 Ga0501036_0136247
365 Ga0501037_0003821
366 Ga0501037_0034882
367 Ga0501038_0039064
368 Ga0501038_0222156
369 Ga0501039_0025148
370 Ga0501039_0376958
371 Ga0501043_0033836
372 Ga0501047_0030233
373 Ga0501070_0062454
374 Ga0501070_0158454
375 Ga0501070_0370519
376 Ga0501035_0085728
377 Ga0501044_0111063
378 Ga0500650_0035727
379 Ga0500559_0000736
380 Ga0500559_0071788
381 Ga0500568_0000285
382 Ga0500573_0000024
383 Ga0500573_0002953
384 Ga0500573_0024841
385 Ga0500573_0099581
386 Ga0500573_0153326
387 Ga0500573_0224488
388 Ga0500616_0000021
389 Ga0500645_012339
390 Ga0530510_0741722
391 2691512973
392 2795784818
393 2808631322
394 2848551407
395 2852644590
396 2857731480
397 2870624774
398 2905929647
399 2928121979
400 2945920544
401 2946004700
402 2946039149
403 2974304505
404 8056037686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

18

222

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8289 1 216
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8036 1 216
2dia-assembly1.cif.gz_A solution structure of the 10th filamin domain from human filamin-b 0.7527 197 218
3tq8-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with trimethoprim 0.7467 1 217
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7462 1 217
ID Description Score Start End Superfamily
af_P0AFB5_9_112_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8897 197 217 3.30.450.20
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8261 2 216 3.40.430.10
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8001 2 216 3.40.430.10
af_Q9QYK2_641_752_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.762 198 215 3.30.70.330
af_Q8IPM1_898_1001_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7518 198 215 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A2T5AFZ9-F1-model_v4 deleted 0.9918 1 219
AF-A0A2T5AFZ9-F1-model_v4 deleted 0.9873 1 219
AF-A0A7Z0IH95-F1-model_v4 Dihydrofolate reductase 0.977 111 219 GO:0008703
GO:0009231
AF-A0A4R4RJQ2-F1-model_v4 Dihydrofolate reductase 0.9759 104 217 GO:0008703
GO:0009231
AF-A0A0T2IIK2-F1-model_v4 Deaminase 0.9748 1 217 GO:0008703
GO:0009231

Map