F309505

General Info

Members Datasets Scaffolds Average Seq Length
202 130 404 165

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100336968|Ga0070700_1003369682
Length 185
Sequence MTAMPFQPTSHPAALPTSRPGRRARRAGVSLGCALLLAWLQVAHAQTGPIEPLDAFPSDKLEISDGKKVKHVLQVWLADSPQRQAQGLMFVRSLPPERGMLFVHDEPTPISMWMKNTYIPLDMVFIDGRGRIQQIVEQTTPHSLAIIRSKEPALAVLEIGGGEAHRLGLHAGQRVQHPALVVPRQ

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
93 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
94 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
95 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
98 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
99 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 6.93
Rhizosphere 85.15
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100336968 3300005441 Bacteria 1113
2 rootH2_10079369 3300003320 Bacteria 2472
3 Ga0070676_10593763 3300005328 Bacteria 798
4 Ga0070670_100016343 3300005331 Bacteria 6373
5 Ga0070670_100481949 3300005331 Bacteria 1102
6 Ga0070677_10109157 3300005333 Bacteria 1232
7 Ga0068869_100096848 3300005334 Bacteria 2228
8 Ga0070682_100041479 3300005337 Bacteria 2837
9 Ga0070682_100168497 3300005337 Bacteria 1520
10 Ga0070660_100390907 3300005339 Bacteria 1149
11 Ga0070669_100223814 3300005353 Bacteria 1488
12 Ga0070669_100797173 3300005353 Bacteria 803
13 Ga0070675_100001032 3300005354 Bacteria 20035
14 Ga0070675_100015135 3300005354 Bacteria 6092
15 Ga0070674_100053428 3300005356 Bacteria 2789
16 Ga0070674_100061915 3300005356 Bacteria 2613
17 Ga0070673_100007225 3300005364 Bacteria 7305
18 Ga0070673_100020173 3300005364 Bacteria 4803
19 Ga0070673_100025625 3300005364 Bacteria 4344
20 Ga0070673_100534370 3300005364 Bacteria 1064
21 Ga0070701_10029904 3300005438 Bacteria 2690
22 Ga0070701_10057082 3300005438 Bacteria 2045
23 Ga0070701_10097162 3300005438 Bacteria 1625
24 Ga0070700_100137241 3300005441 Bacteria 1658
25 Ga0070700_100353024 3300005441 Bacteria 1091
26 Ga0070663_100055931 3300005455 Bacteria 2826
27 Ga0070663_100841089 3300005455 Bacteria 789
28 Ga0070678_100008660 3300005456 Bacteria 6102
29 Ga0070678_100023505 3300005456 Bacteria 4108
30 Ga0068867_100692064 3300005459 Bacteria 899
31 Ga0070684_100559271 3300005535 Bacteria 1062
32 Ga0070672_100011918 3300005543 Bacteria 6077
33 Ga0070672_100026732 3300005543 Bacteria 4300
34 Ga0070672_100748367 3300005543 Bacteria 858
35 Ga0070696_100089998 3300005546 Bacteria 2183
36 Ga0070693_100151632 3300005547 Bacteria 1469
37 Ga0070693_100194661 3300005547 Unclassified 1313
38 Ga0070665_100003874 3300005548 Bacteria 15823
39 Ga0070665_100278020 3300005548 Bacteria 1676
40 Ga0070664_100032150 3300005564 Bacteria 4388
41 Ga0070664_100304307 3300005564 Bacteria 1441
42 Ga0070664_100461024 3300005564 Bacteria 1168
43 Ga0068857_100067309 3300005577 Bacteria 3188
44 Ga0068859_100231309 3300005617 Bacteria 1937
45 Ga0068864_100161992 3300005618 Bacteria 2034
46 Ga0068864_100195266 3300005618 Bacteria 1857
47 Ga0068861_100003540 3300005719 Bacteria 10383
48 Ga0068861_100053055 3300005719 Bacteria 3083
49 Ga0068861_100136751 3300005719 Bacteria 1995
50 Ga0068863_100309267 3300005841 Bacteria 1534
51 Ga0068863_100358351 3300005841 Bacteria 1421
52 Ga0068862_100233993 3300005844 Bacteria 1668
53 Ga0068862_100244895 3300005844 Bacteria 1632
54 Ga0075366_10353579 3300006195 Bacteria 902
55 Ga0097621_100004787 3300006237 Bacteria 9472
56 Ga0097621_100113640 3300006237 Bacteria 2290
57 Ga0097621_100128774 3300006237 Bacteria 2152
58 Ga0097621_100183768 3300006237 Bacteria 1807
59 Ga0068871_100009898 3300006358 Bacteria 6921
60 Ga0068871_100099595 3300006358 Bacteria 2433
61 Ga0075430_100854508 3300006846 Bacteria 750
62 Ga0075429_101422138 3300006880 Bacteria 604
63 Ga0068865_100275334 3300006881 Bacteria 1338
64 Ga0097620_100231310 3300006931 Bacteria 1937
65 Ga0111539_10094979 3300009094 Bacteria 3503
66 Ga0111539_10402458 3300009094 Bacteria 1594
67 Ga0111539_10454703 3300009094 Bacteria 1491
68 Ga0105245_10849958 3300009098 Bacteria 952
69 Ga0105248_10062890 3300009177 Bacteria 4166
70 Ga0105238_10753597 3300009551 Bacteria 988
71 Ga0105238_11746393 3300009551 Bacteria 654
72 Ga0157375_11048529 3300013308 Bacteria 953
73 Ga0163163_10141700 3300014325 Bacteria 2447
74 Ga0163163_10911189 3300014325 Bacteria 942
75 Ga0157380_10003420 3300014326 Bacteria 10899
76 Ga0157376_10255585 3300014969 Bacteria 1639
77 Ga0207697_10222762 3300025315 Bacteria 832
78 Ga0207682_10001837 3300025893 Bacteria 9666
79 Ga0207682_10014539 3300025893 Bacteria 3068
80 Ga0207645_10157282 3300025907 Bacteria 1485
81 Ga0207643_10002188 3300025908 Bacteria 10660
82 Ga0207643_10134239 3300025908 Bacteria 1474
83 Ga0207643_10213912 3300025908 Bacteria 1177
84 Ga0207657_10154788 3300025919 Bacteria 1865
85 Ga0207650_10141097 3300025925 Bacteria 1894
86 Ga0207659_10080120 3300025926 Bacteria 2411
87 Ga0207706_10355168 3300025933 Bacteria 1274
88 Ga0207670_10487647 3300025936 Bacteria 999
89 Ga0207669_10075090 3300025937 Bacteria 2140
90 Ga0207669_10577657 3300025937 Bacteria 910
91 Ga0207704_10045898 3300025938 Bacteria 2599
92 Ga0207704_10607537 3300025938 Bacteria 896
93 Ga0207691_10006981 3300025940 Bacteria 10895
94 Ga0207691_10011125 3300025940 Bacteria 8637
95 Ga0207691_10106370 3300025940 Bacteria 2499
96 Ga0207711_10107921 3300025941 Bacteria 2472
97 Ga0207689_10200781 3300025942 Bacteria 1646
98 Ga0207679_10175317 3300025945 Bacteria 1769
99 Ga0207651_10009554 3300025960 Bacteria 5321
100 Ga0207651_10025039 3300025960 Bacteria 3703
101 Ga0207651_10143835 3300025960 Bacteria 1846
102 Ga0207668_10189755 3300025972 Bacteria 1628
103 Ga0207668_10342815 3300025972 Bacteria 1247
104 Ga0207639_10908061 3300026041 Bacteria 823
105 Ga0207678_10015841 3300026067 Bacteria 6625
106 Ga0207708_10053536 3300026075 Bacteria 3075
107 Ga0207708_10091424 3300026075 Bacteria 2347
108 Ga0207708_10113935 3300026075 Bacteria 2101
109 Ga0207708_10304081 3300026075 Bacteria 1298
110 Ga0207641_10308894 3300026088 Bacteria 1496
111 Ga0207648_10151436 3300026089 Bacteria 2047
112 Ga0207648_10161122 3300026089 Bacteria 1981
113 Ga0207674_10391553 3300026116 Bacteria 1343
114 Ga0207674_10839783 3300026116 Bacteria 886
115 Ga0207675_100005793 3300026118 Bacteria 11811
116 Ga0207675_100147327 3300026118 Bacteria 2239
117 Ga0207675_100166243 3300026118 Bacteria 2107
118 Ga0207683_10003135 3300026121 Bacteria 14447
119 Ga0207683_10016450 3300026121 Bacteria 6295
120 Ga0207683_10494391 3300026121 Bacteria 1129
121 Ga0207698_10594723 3300026142 Bacteria 1090
122 Ga0268266_10005286 3300028379 Bacteria 12121
123 Ga0268266_10366372 3300028379 Bacteria 1357
124 Ga0268265_10135752 3300028380 Bacteria 2052
125 Ga0307515_10346813 3300028794 Bacteria 1134
126 Ga0307513_10008584 3300031456 Bacteria 13046
127 Ga0307513_10039501 3300031456 Bacteria 5231
128 Ga0307513_10051264 3300031456 Bacteria 4454
129 Ga0307513_10249492 3300031456 Bacteria 1572
130 Ga0307408_100072746 3300031548 Bacteria 2546
131 Ga0307408_100307042 3300031548 Bacteria 1331
132 Ga0307514_10172885 3300031649 Bacteria 1407
133 Ga0307405_10589179 3300031731 Unclassified 906
134 Ga0307413_10076973 3300031824 Bacteria 2122
135 Ga0307413_10222505 3300031824 Unclassified 1380
136 Ga0307410_10008060 3300031852 Bacteria 5817
137 Ga0307406_10055830 3300031901 Bacteria 2526
138 Ga0307407_10081324 3300031903 Bacteria 1960
139 Ga0307412_10146575 3300031911 Bacteria 1736
140 Ga0307409_100001561 3300031995 Bacteria 11391
141 Ga0307409_100049633 3300031995 Bacteria 3201
142 Ga0307409_100068043 3300031995 Bacteria 2815
143 Ga0307416_100030598 3300032002 Bacteria 4041
144 Ga0307416_100406427 3300032002 Bacteria 1401
145 Ga0307411_10001611 3300032005 Bacteria 9392
146 Ga0307415_100007264 3300032126 Bacteria 6049
147 Ga0373943_0765194 3300035170 Unclassified 574
148 Ga0373946_0297934 3300035171 Bacteria 797
149 Ga0373955_0069303 3300035172 Unclassified 1967
150 Ga0373935_0667869 3300035692 Unclassified 763
151 Ga0373937_0183877 3300036401 Bacteria 1963
152 Ga0373925_0453212 3300037068 Bacteria 1051
153 Ga0451793_1154819 3300041452 Bacteria 1732
154 Ga0451793_1309146 3300041452 Unclassified 746
155 Ga0451798_0702123 3300041458 Bacteria 1141
156 Ga0451800_0296820 3300041459 Bacteria 3177
157 Ga0451800_0824350 3300041459 Bacteria 1121
158 Ga0451800_1620604 3300041459 Unclassified 1476
159 Ga0451802_0293666 3300041460 Bacteria 1400
160 Ga0451802_0442607 3300041460 Bacteria 3016
161 Ga0451802_1239965 3300041460 Bacteria 1716
162 Ga0451807_1153414 3300041486 Bacteria 4403
163 Ga0451807_1614819 3300041486 Bacteria 8480
164 Ga0451841_1426813 3300041498 Bacteria 1291
165 Ga0451851_0110168 3300041507 Bacteria 549
166 Ga0451843_0660821 3300041509 Bacteria 1080
167 Ga0451853_1393565 3300041512 Bacteria 721
168 Ga0451853_3239692 3300041512 Unclassified 1200
169 Ga0495629_0661663 3300046459 Unclassified 695
170 Ga0495638_0083774 3300046460 Bacteria 1931
171 Ga0495638_0157800 3300046460 Bacteria 1311
172 Ga0495641_0481717 3300046461 Bacteria 565
173 Ga0495616_0002243 3300046513 Bacteria 12923
174 Ga0495656_0250292 3300046615 Bacteria 895
175 Ga0495649_0016319 3300046694 Bacteria 4208
176 Ga0495589_0160253 3300046794 Bacteria 1072
177 Ga0495680_0460973 3300047322 Bacteria 868
178 Ga0495681_0169036 3300047470 Bacteria 906
179 Ga0496104_0302269 3300048907 Bacteria 1512
180 Ga0496108_0653002 3300048911 Bacteria 914
181 Ga0496114_0247350 3300048917 Bacteria 1569
182 Ga0501048_0718004 3300049582 Bacteria 718
183 Ga0501067_0009066 3300049583 Bacteria 5510
184 Ga0501068_0014562 3300049584 Bacteria 4499
185 Ga0501068_0437223 3300049584 Bacteria 846
186 Ga0501069_0166029 3300049585 Bacteria 1272
187 Ga0501070_0023960 3300049586 Bacteria 5116
188 Ga0501074_0003522 3300049590 Bacteria 11113
189 Ga0501077_0001000 3300049593 Bacteria 17040
190 Ga0501079_0104486 3300049741 Bacteria 2197
191 Ga0501080_0601769 3300049742 Bacteria 976
192 Ga0501083_0005340 3300049744 Bacteria 9090
193 nmdc:mga0k408_440295_c1 3300050493 Bacteria 774
194 nmdc:mga09592_1095043_c1 3300050508 Bacteria 662
195 nmdc:mga0qj67_1180403_c1 3300050509 Bacteria 596
196 nmdc:mga0qj67_792423_c1 3300050509 Bacteria 750
197 nmdc:mga08y16_52232_c1 3300050511 Bacteria 4276
198 nmdc:mga08y16_671930_c1 3300050511 Bacteria 1038
199 Ga0500644_0022807 3300053088 Bacteria 1893
200 Ga0500627_0353181 3300053158 Bacteria 634
201 Ga0501084_0038541 3300054114 Bacteria 3995
202 Ga0501082_0007852 3300060353 Bacteria 9205
203 Ga0070700_100336968
204 rootH2_10079369
205 Ga0070676_10593763
206 Ga0070670_100016343
207 Ga0070670_100481949
208 Ga0070677_10109157
209 Ga0068869_100096848
210 Ga0070682_100041479
211 Ga0070682_100168497
212 Ga0070660_100390907
213 Ga0070669_100223814
214 Ga0070669_100797173
215 Ga0070675_100001032
216 Ga0070675_100015135
217 Ga0070674_100053428
218 Ga0070674_100061915
219 Ga0070673_100007225
220 Ga0070673_100020173
221 Ga0070673_100025625
222 Ga0070673_100534370
223 Ga0070701_10029904
224 Ga0070701_10057082
225 Ga0070701_10097162
226 Ga0070700_100137241
227 Ga0070700_100353024
228 Ga0070663_100055931
229 Ga0070663_100841089
230 Ga0070678_100008660
231 Ga0070678_100023505
232 Ga0068867_100692064
233 Ga0070684_100559271
234 Ga0070672_100011918
235 Ga0070672_100026732
236 Ga0070672_100748367
237 Ga0070696_100089998
238 Ga0070693_100151632
239 Ga0070693_100194661
240 Ga0070665_100003874
241 Ga0070665_100278020
242 Ga0070664_100032150
243 Ga0070664_100304307
244 Ga0070664_100461024
245 Ga0068857_100067309
246 Ga0068859_100231309
247 Ga0068864_100161992
248 Ga0068864_100195266
249 Ga0068861_100003540
250 Ga0068861_100053055
251 Ga0068861_100136751
252 Ga0068863_100309267
253 Ga0068863_100358351
254 Ga0068862_100233993
255 Ga0068862_100244895
256 Ga0075366_10353579
257 Ga0097621_100004787
258 Ga0097621_100113640
259 Ga0097621_100128774
260 Ga0097621_100183768
261 Ga0068871_100009898
262 Ga0068871_100099595
263 Ga0075430_100854508
264 Ga0075429_101422138
265 Ga0068865_100275334
266 Ga0097620_100231310
267 Ga0111539_10094979
268 Ga0111539_10402458
269 Ga0111539_10454703
270 Ga0105245_10849958
271 Ga0105248_10062890
272 Ga0105238_10753597
273 Ga0105238_11746393
274 Ga0157375_11048529
275 Ga0163163_10141700
276 Ga0163163_10911189
277 Ga0157380_10003420
278 Ga0157376_10255585
279 Ga0207697_10222762
280 Ga0207682_10001837
281 Ga0207682_10014539
282 Ga0207645_10157282
283 Ga0207643_10002188
284 Ga0207643_10134239
285 Ga0207643_10213912
286 Ga0207657_10154788
287 Ga0207650_10141097
288 Ga0207659_10080120
289 Ga0207706_10355168
290 Ga0207670_10487647
291 Ga0207669_10075090
292 Ga0207669_10577657
293 Ga0207704_10045898
294 Ga0207704_10607537
295 Ga0207691_10006981
296 Ga0207691_10011125
297 Ga0207691_10106370
298 Ga0207711_10107921
299 Ga0207689_10200781
300 Ga0207679_10175317
301 Ga0207651_10009554
302 Ga0207651_10025039
303 Ga0207651_10143835
304 Ga0207668_10189755
305 Ga0207668_10342815
306 Ga0207639_10908061
307 Ga0207678_10015841
308 Ga0207708_10053536
309 Ga0207708_10091424
310 Ga0207708_10113935
311 Ga0207708_10304081
312 Ga0207641_10308894
313 Ga0207648_10151436
314 Ga0207648_10161122
315 Ga0207674_10391553
316 Ga0207674_10839783
317 Ga0207675_100005793
318 Ga0207675_100147327
319 Ga0207675_100166243
320 Ga0207683_10003135
321 Ga0207683_10016450
322 Ga0207683_10494391
323 Ga0207698_10594723
324 Ga0268266_10005286
325 Ga0268266_10366372
326 Ga0268265_10135752
327 Ga0307515_10346813
328 Ga0307513_10008584
329 Ga0307513_10039501
330 Ga0307513_10051264
331 Ga0307513_10249492
332 Ga0307408_100072746
333 Ga0307408_100307042
334 Ga0307514_10172885
335 Ga0307405_10589179
336 Ga0307413_10076973
337 Ga0307413_10222505
338 Ga0307410_10008060
339 Ga0307406_10055830
340 Ga0307407_10081324
341 Ga0307412_10146575
342 Ga0307409_100001561
343 Ga0307409_100049633
344 Ga0307409_100068043
345 Ga0307416_100030598
346 Ga0307416_100406427
347 Ga0307411_10001611
348 Ga0307415_100007264
349 Ga0373943_0765194
350 Ga0373946_0297934
351 Ga0373955_0069303
352 Ga0373935_0667869
353 Ga0373937_0183877
354 Ga0373925_0453212
355 Ga0451793_1154819
356 Ga0451793_1309146
357 Ga0451798_0702123
358 Ga0451800_0296820
359 Ga0451800_0824350
360 Ga0451800_1620604
361 Ga0451802_0293666
362 Ga0451802_0442607
363 Ga0451802_1239965
364 Ga0451807_1153414
365 Ga0451807_1614819
366 Ga0451841_1426813
367 Ga0451851_0110168
368 Ga0451843_0660821
369 Ga0451853_1393565
370 Ga0451853_3239692
371 Ga0495629_0661663
372 Ga0495638_0083774
373 Ga0495638_0157800
374 Ga0495641_0481717
375 Ga0495616_0002243
376 Ga0495656_0250292
377 Ga0495649_0016319
378 Ga0495589_0160253
379 Ga0495680_0460973
380 Ga0495681_0169036
381 Ga0496104_0302269
382 Ga0496108_0653002
383 Ga0496114_0247350
384 Ga0501048_0718004
385 Ga0501067_0009066
386 Ga0501068_0014562
387 Ga0501068_0437223
388 Ga0501069_0166029
389 Ga0501070_0023960
390 Ga0501074_0003522
391 Ga0501077_0001000
392 Ga0501079_0104486
393 Ga0501080_0601769
394 Ga0501083_0005340
395 nmdc:mga0k408_440295_c1
396 nmdc:mga09592_1095043_c1
397 nmdc:mga0qj67_1180403_c1
398 nmdc:mga0qj67_792423_c1
399 nmdc:mga08y16_52232_c1
400 nmdc:mga08y16_671930_c1
401 Ga0500644_0022807
402 Ga0500627_0353181
403 Ga0501084_0038541
404 Ga0501082_0007852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02643

DUF192

Uncharacterized ACR, COG1430

73

177

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pjy-assembly1.cif.gz_A crystal structure of a putative transcription regulator (r01717) from sinorhizobium meliloti 1021 at 1.55 a resolution 0.9461 40 164
3pjy-assembly1.cif.gz_A crystal structure of a putative transcription regulator (r01717) from sinorhizobium meliloti 1021 at 1.55 a resolution 0.9108 40 164
3m7a-assembly2.cif.gz_B crystal structure of saro_0823 (yp_496102.1) a protein of unknown function from novosphingobium aromaticivorans dsm 12444 at 1.22 a resolution 0.8681 33 162
3m7a-assembly2.cif.gz_B crystal structure of saro_0823 (yp_496102.1) a protein of unknown function from novosphingobium aromaticivorans dsm 12444 at 1.22 a resolution 0.8021 33 162
5h3k-assembly1.cif.gz_A crystal structure of a hypothetical protein from synechocystis 0.6533 43 161
ID Description Score Start End Superfamily
3pjyA00 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.9297 40 164 2.60.120.1140
3m7aB01 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.9172 34 162 2.60.120.1140
3pjyA00 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.8934 40 164 2.60.120.1140
3m7aB01 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.8567 34 162 2.60.120.1140
af_Q58891_1_113_2.60.120.1140 Mainly Beta;Sandwich;Jelly Rolls;Protein of unknown function DUF192 0.8017 40 161 2.60.120.1140
ID Description Score Start End GO Terms
AF-A0A658BP16-F1-model_v4 DUF192 domain-containing protein 0.9829 40 161
AF-A0A2S5M9I8-F1-model_v4 DUF192 domain-containing protein 0.9805 60 165
AF-A0A1N7NPG5-F1-model_v4 DUF192 domain-containing protein 0.9769 43 162
AF-A0A2M9G6E5-F1-model_v4 DUF192 domain-containing protein 0.9765 60 167
AF-A0A1V1X0H2-F1-model_v4 DUF192 domain-containing protein 0.976 42 161

Map