F309445

General Info

Members Datasets Scaffolds Average Seq Length
202 147 404 277

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100399623|Ga0070675_1003996232
Length 316
Sequence MTNRSVIYSGPFEVSNPTRHASVVSQRGQSRLVSVDHYENFPVASVLCPPALRPAIAAIYGYARTADDLADEGEVPAEQRLADLAAYRADLQAIIEGRAPSARWAPVFNALRSALQRHALPTGLLADLLSAFEQDVVKHRYADRPELLDYCRRSANPVGRLLLHLYGIDDAASLRQSDSICTALQLANFWQDLGVDAGRGRLYVPASDAQRHGVDPAHLLARVDSPAVHTLVEELVHWTTDLMQTGAPLATSVPGRAGWELRLVVQGGLRILEKIRRTGYATLLRRPKLHARDVPLLLWRAVRMRDGRVTVQRRSA

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
79 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
80 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
81 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
82 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
99 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
116 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
119 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
128 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
129 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
130 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
131 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
132 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
133 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
136 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
137 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
144 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
145 2738541337 Pelomonas sp. BT06 Isolate Unclassified
146 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
147 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 0
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.86
Nodule 0
Rhizoplane 0
Rhizosphere 75.74
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100399623 3300005354 Bacteria 1226
2 Ga0055531_10000162 3300003794 Bacteria 76392
3 Ga0070676_10005250 3300005328 Bacteria 6890
4 Ga0068869_100008629 3300005334 Bacteria 6582
5 Ga0068869_100009543 3300005334 Bacteria 6299
6 Ga0070689_100004013 3300005340 Bacteria 9896
7 Ga0070687_100036448 3300005343 Bacteria 2451
8 Ga0070692_10004791 3300005345 Bacteria 5684
9 Ga0070675_100009031 3300005354 Bacteria 7742
10 Ga0070671_100086950 3300005355 Bacteria 2616
11 Ga0070667_100121086 3300005367 Bacteria 2276
12 Ga0070667_100225459 3300005367 Bacteria 1669
13 Ga0070701_10017793 3300005438 Bacteria 3328
14 Ga0070705_100104862 3300005440 Bacteria 1793
15 Ga0070700_100520540 3300005441 Unclassified 919
16 Ga0070694_100057427 3300005444 Bacteria 2646
17 Ga0070678_100005946 3300005456 Bacteria 7102
18 Ga0070662_100040118 3300005457 Bacteria 3332
19 Ga0068867_100014791 3300005459 Bacteria 5532
20 Ga0068867_100090249 3300005459 Bacteria 2324
21 Ga0070672_100002969 3300005543 Bacteria 10926
22 Ga0070672_100010260 3300005543 Bacteria 6491
23 Ga0070686_100001925 3300005544 Bacteria 11544
24 Ga0070696_100217015 3300005546 Bacteria 1434
25 Ga0070704_100131305 3300005549 Bacteria 1942
26 Ga0070664_100079979 3300005564 Bacteria 2815
27 Ga0070702_100001067 3300005615 Bacteria 10926
28 Ga0068859_100080940 3300005617 Bacteria 3289
29 Ga0068864_100007003 3300005618 Bacteria 9251
30 Ga0068861_100027114 3300005719 Bacteria 4170
31 Ga0068858_100007475 3300005842 Bacteria 10563
32 Ga0068858_100012114 3300005842 Bacteria 8129
33 Ga0068860_100006688 3300005843 Bacteria 11573
34 Ga0068862_100006346 3300005844 Bacteria 9830
35 Ga0075363_100020292 3300006048 Bacteria 3331
36 Ga0075363_100033184 3300006048 Bacteria 2686
37 Ga0075364_10002931 3300006051 Bacteria 9615
38 Ga0075362_10002633 3300006177 Bacteria 6084
39 Ga0075362_10169506 3300006177 Bacteria 1054
40 Ga0075367_10002879 3300006178 Bacteria 8009
41 Ga0075367_10058347 3300006178 Bacteria 2296
42 Ga0075366_10002965 3300006195 Bacteria 8838
43 Ga0075366_10045335 3300006195 Bacteria 2606
44 Ga0075366_10085772 3300006195 Bacteria 1884
45 Ga0097621_100013621 3300006237 Bacteria 6068
46 Ga0075370_10000713 3300006353 Bacteria 13143
47 Ga0075370_10001255 3300006353 Bacteria 10807
48 Ga0075370_10011121 3300006353 Bacteria 4720
49 Ga0075370_10081491 3300006353 Bacteria 1860
50 Ga0075370_10086619 3300006353 Bacteria 1804
51 Ga0068871_100116193 3300006358 Bacteria 2255
52 Ga0068865_100029778 3300006881 Bacteria 3626
53 Ga0068865_100703959 3300006881 Unclassified 863
54 Ga0097620_100080936 3300006931 Bacteria 3289
55 Ga0099794_10027882 3300007265 Bacteria 2622
56 Ga0105240_10027689 3300009093 Bacteria 7417
57 Ga0105240_10041961 3300009093 Bacteria 5834
58 Ga0105245_10003536 3300009098 Bacteria 13970
59 Ga0105243_10014783 3300009148 Bacteria 5905
60 Ga0105243_10062131 3300009148 Bacteria 2990
61 Ga0105237_10000322 3300009545 Bacteria 67344
62 Ga0105237_10103969 3300009545 Bacteria 2832
63 Ga0105237_10191974 3300009545 Bacteria 2042
64 Ga0105238_10016219 3300009551 Bacteria 7539
65 Ga0105249_10098137 3300009553 Bacteria 2751
66 Ga0105239_10000750 3300010375 Bacteria 46021
67 Ga0105246_10217023 3300011119 Bacteria 1497
68 Ga0157378_10195223 3300013297 Bacteria 1912
69 Ga0157375_10036804 3300013308 Bacteria 4685
70 Ga0157375_10051756 3300013308 Bacteria 4035
71 Ga0157379_10024302 3300014968 Bacteria 5380
72 Ga0213876_10207678 3300021384 Bacteria 1041
73 Ga0207645_10005193 3300025907 Bacteria 9507
74 Ga0207645_10200977 3300025907 Bacteria 1311
75 Ga0207643_10057791 3300025908 Bacteria 2209
76 Ga0207671_10028344 3300025914 Bacteria 4184
77 Ga0207671_10147733 3300025914 Bacteria 1814
78 Ga0207659_10276324 3300025926 Bacteria 1372
79 Ga0207644_10023917 3300025931 Bacteria 4190
80 Ga0207706_10123378 3300025933 Bacteria 2279
81 Ga0207709_10307836 3300025935 Bacteria 1181
82 Ga0207704_10028339 3300025938 Bacteria 3106
83 Ga0207704_10042252 3300025938 Bacteria 2682
84 Ga0207691_10005797 3300025940 Bacteria 11944
85 Ga0207689_10000871 3300025942 Bacteria 29097
86 Ga0207689_10014903 3300025942 Bacteria 6596
87 Ga0207668_10002017 3300025972 Bacteria 11847
88 Ga0207640_10084973 3300025981 Bacteria 2175
89 Ga0207658_10140292 3300025986 Bacteria 1955
90 Ga0207658_10160478 3300025986 Bacteria 1842
91 Ga0207703_10004911 3300026035 Bacteria 10866
92 Ga0207708_10000335 3300026075 Bacteria 37085
93 Ga0207708_10076047 3300026075 Bacteria 2575
94 Ga0207648_10000252 3300026089 Bacteria 57773
95 Ga0207648_10004959 3300026089 Bacteria 13539
96 Ga0207648_10278062 3300026089 Bacteria 1497
97 Ga0207648_10341372 3300026089 Bacteria 1349
98 Ga0207674_10103583 3300026116 Bacteria 2825
99 Ga0207675_100000222 3300026118 Bacteria 53252
100 Ga0207683_10021710 3300026121 Bacteria 5502
101 Ga0307517_10001248 3300028786 Bacteria 42703
102 Ga0307515_10000022 3300028794 Bacteria 404064
103 Ga0307515_10000178 3300028794 Bacteria 157107
104 Ga0307515_10034025 3300028794 Bacteria 8364
105 Ga0307515_10061997 3300028794 Bacteria 5291
106 Ga0307513_10136136 3300031456 Bacteria 2392
107 Ga0307509_10029250 3300031507 Bacteria 6118
108 Ga0307509_10075487 3300031507 Bacteria 3501
109 Ga0307509_10079265 3300031507 Bacteria 3400
110 Ga0307508_10000094 3300031616 Bacteria 104107
111 Ga0307508_10006000 3300031616 Bacteria 11463
112 Ga0307508_10149175 3300031616 Bacteria 1943
113 Ga0307508_10397909 3300031616 Bacteria 968
114 Ga0307411_10000396 3300032005 Bacteria 14902
115 Ga0307510_10058956 3300033180 Bacteria 3969
116 Ga0307510_10208182 3300033180 Bacteria 1481
117 Ga0373948_0007435 3300034817 Bacteria 1842
118 Ga0373950_0030558 3300034818 Bacteria 995
119 Ga0373958_0021777 3300034819 Bacteria 1192
120 Ga0373951_0004141 3300035091 Bacteria 3466
121 Ga0373939_0000087 3300035114 Bacteria 29365
122 Ga0373931_0000620 3300035691 Bacteria 14703
123 Ga0373931_0065532 3300035691 Bacteria 1969
124 Ga0373925_0284030 3300037068 Bacteria 1333
125 Ga0373925_0449755 3300037068 Bacteria 1055
126 Ga0395900_0107421 3300037418 Bacteria 2867
127 Ga0395905_0002409 3300037471 Bacteria 20782
128 Ga0436364_0874760 3300037853 Bacteria 1645
129 Ga0395901_0414352 3300038443 Bacteria 1382
130 Ga0436365_1675917 3300039437 Bacteria 1053
131 Ga0436361_0687444 3300039447 Bacteria 109830
132 Ga0439458_0021552 3300042157 Bacteria 1493
133 Ga0466972_0000296 3300044658 Bacteria 30177
134 Ga0451576_0036016 3300045051 Bacteria 5249
135 Ga0451576_0095366 3300045051 Bacteria 3094
136 Ga0495629_0002454 3300046459 Bacteria 14228
137 Ga0495638_0094047 3300046460 Bacteria 1802
138 Ga0495650_0020423 3300046471 Bacteria 3231
139 Ga0495596_0011860 3300046500 Bacteria 3742
140 Ga0495616_0154268 3300046513 Bacteria 1037
141 Ga0495631_0016181 3300046518 Bacteria 3561
142 Ga0495631_0069041 3300046518 Bacteria 1528
143 Ga0495632_0066966 3300046519 Bacteria 1732
144 Ga0495666_0034058 3300046526 Bacteria 2486
145 Ga0495666_0151229 3300046526 Bacteria 1079
146 Ga0495597_0018219 3300046542 Bacteria 3298
147 Ga0495668_0000448 3300046616 Bacteria 52646
148 Ga0495668_0169770 3300046616 Bacteria 1195
149 Ga0495611_0098276 3300046648 Bacteria 1357
150 Ga0495611_0177338 3300046648 Bacteria 996
151 Ga0495625_0075727 3300046660 Bacteria 2354
152 Ga0495588_0064618 3300046674 Bacteria 1898
153 Ga0495669_0000031 3300046684 Bacteria 101141
154 Ga0495670_0040039 3300046691 Bacteria 2337
155 Ga0495660_0021194 3300046810 Bacteria 3723
156 Ga0495636_0014313 3300047318 Bacteria 3152
157 Ga0495674_0003407 3300047319 Bacteria 15445
158 Ga0495672_0000661 3300047320 Bacteria 38299
159 Ga0495676_0130422 3300047321 Bacteria 1815
160 Ga0495687_001784 3300047443 Bacteria 19007
161 Ga0495677_0023569 3300047445 Bacteria 2234
162 Ga0495673_0061922 3300047469 Bacteria 1600
163 Ga0495686_0005609 3300047472 Bacteria 9855
164 Ga0495682_0032930 3300049460 Bacteria 1914
165 Ga0501299_031344 3300049522 Bacteria 1028
166 Ga0501034_0000271 3300049571 Bacteria 93642
167 Ga0501034_0029250 3300049571 Bacteria 5601
168 Ga0501043_0492255 3300049579 Bacteria 917
169 Ga0501068_0008345 3300049584 Bacteria 5760
170 Ga0501070_0071962 3300049586 Bacteria 2862
171 Ga0501072_0001000 3300049588 Bacteria 20904
172 Ga0501073_0004419 3300049589 Bacteria 10569
173 Ga0501074_0083354 3300049590 Bacteria 2292
174 Ga0501202_037926 3300049652 Bacteria 1031
175 Ga0501207_004812 3300049654 Bacteria 1849
176 Ga0501222_003052 3300049662 Bacteria 2301
177 Ga0501227_015055 3300049665 Bacteria 1725
178 Ga0501235_004043 3300049669 Bacteria 3174
179 Ga0501258_002283 3300049687 Bacteria 1667
180 Ga0501221_001434 3300049704 Bacteria 3945
181 Ga0501080_0006397 3300049742 Bacteria 10570
182 Ga0501232_001907 3300049757 Bacteria 1739
183 Ga0501262_004426 3300049759 Bacteria 1630
184 Ga0501262_013626 3300049759 Bacteria 1050
185 Ga0501267_000531 3300049764 Bacteria 2986
186 Ga0501035_0577795 3300049822 Bacteria 918
187 nmdc:mga03683_53068_c1 3300050489 Bacteria 1696
188 nmdc:mga00v17_3613_c1 3300050491 Bacteria 7991
189 nmdc:mga0k408_188978_c1 3300050493 Bacteria 1229
190 nmdc:mga0k408_339_c1 3300050493 Bacteria 25491
191 nmdc:mga0k408_7162_c1 3300050493 Bacteria 5961
192 nmdc:mga0k408_9311_c1 3300050493 Bacteria 5293
193 nmdc:mga07m45_132090_c1 3300050496 Bacteria 1445
194 nmdc:mga07m45_20793_c1 3300050496 Bacteria 3567
195 nmdc:mga07m45_25921_c1 3300050496 Bacteria 3220
196 nmdc:mga07m45_6397_c1 3300050496 Bacteria 5951
197 nmdc:mga07m45_8882_c1 3300050496 Bacteria 5186
198 Ga0500619_000100 3300053154 Bacteria 22919
199 2644258604 2643221646 Bacteria 6433402
200 2739056694 2738541337 Bacteria 6183410
201 2834642005 2834641062 Bacteria 5559922
202 8003404453 8003400568 Bacteria 5535898
203 Ga0070675_100399623
204 Ga0055531_10000162
205 Ga0070676_10005250
206 Ga0068869_100008629
207 Ga0068869_100009543
208 Ga0070689_100004013
209 Ga0070687_100036448
210 Ga0070692_10004791
211 Ga0070675_100009031
212 Ga0070671_100086950
213 Ga0070667_100121086
214 Ga0070667_100225459
215 Ga0070701_10017793
216 Ga0070705_100104862
217 Ga0070700_100520540
218 Ga0070694_100057427
219 Ga0070678_100005946
220 Ga0070662_100040118
221 Ga0068867_100014791
222 Ga0068867_100090249
223 Ga0070672_100002969
224 Ga0070672_100010260
225 Ga0070686_100001925
226 Ga0070696_100217015
227 Ga0070704_100131305
228 Ga0070664_100079979
229 Ga0070702_100001067
230 Ga0068859_100080940
231 Ga0068864_100007003
232 Ga0068861_100027114
233 Ga0068858_100007475
234 Ga0068858_100012114
235 Ga0068860_100006688
236 Ga0068862_100006346
237 Ga0075363_100020292
238 Ga0075363_100033184
239 Ga0075364_10002931
240 Ga0075362_10002633
241 Ga0075362_10169506
242 Ga0075367_10002879
243 Ga0075367_10058347
244 Ga0075366_10002965
245 Ga0075366_10045335
246 Ga0075366_10085772
247 Ga0097621_100013621
248 Ga0075370_10000713
249 Ga0075370_10001255
250 Ga0075370_10011121
251 Ga0075370_10081491
252 Ga0075370_10086619
253 Ga0068871_100116193
254 Ga0068865_100029778
255 Ga0068865_100703959
256 Ga0097620_100080936
257 Ga0099794_10027882
258 Ga0105240_10027689
259 Ga0105240_10041961
260 Ga0105245_10003536
261 Ga0105243_10014783
262 Ga0105243_10062131
263 Ga0105237_10000322
264 Ga0105237_10103969
265 Ga0105237_10191974
266 Ga0105238_10016219
267 Ga0105249_10098137
268 Ga0105239_10000750
269 Ga0105246_10217023
270 Ga0157378_10195223
271 Ga0157375_10036804
272 Ga0157375_10051756
273 Ga0157379_10024302
274 Ga0213876_10207678
275 Ga0207645_10005193
276 Ga0207645_10200977
277 Ga0207643_10057791
278 Ga0207671_10028344
279 Ga0207671_10147733
280 Ga0207659_10276324
281 Ga0207644_10023917
282 Ga0207706_10123378
283 Ga0207709_10307836
284 Ga0207704_10028339
285 Ga0207704_10042252
286 Ga0207691_10005797
287 Ga0207689_10000871
288 Ga0207689_10014903
289 Ga0207668_10002017
290 Ga0207640_10084973
291 Ga0207658_10140292
292 Ga0207658_10160478
293 Ga0207703_10004911
294 Ga0207708_10000335
295 Ga0207708_10076047
296 Ga0207648_10000252
297 Ga0207648_10004959
298 Ga0207648_10278062
299 Ga0207648_10341372
300 Ga0207674_10103583
301 Ga0207675_100000222
302 Ga0207683_10021710
303 Ga0307517_10001248
304 Ga0307515_10000022
305 Ga0307515_10000178
306 Ga0307515_10034025
307 Ga0307515_10061997
308 Ga0307513_10136136
309 Ga0307509_10029250
310 Ga0307509_10075487
311 Ga0307509_10079265
312 Ga0307508_10000094
313 Ga0307508_10006000
314 Ga0307508_10149175
315 Ga0307508_10397909
316 Ga0307411_10000396
317 Ga0307510_10058956
318 Ga0307510_10208182
319 Ga0373948_0007435
320 Ga0373950_0030558
321 Ga0373958_0021777
322 Ga0373951_0004141
323 Ga0373939_0000087
324 Ga0373931_0000620
325 Ga0373931_0065532
326 Ga0373925_0284030
327 Ga0373925_0449755
328 Ga0395900_0107421
329 Ga0395905_0002409
330 Ga0436364_0874760
331 Ga0395901_0414352
332 Ga0436365_1675917
333 Ga0436361_0687444
334 Ga0439458_0021552
335 Ga0466972_0000296
336 Ga0451576_0036016
337 Ga0451576_0095366
338 Ga0495629_0002454
339 Ga0495638_0094047
340 Ga0495650_0020423
341 Ga0495596_0011860
342 Ga0495616_0154268
343 Ga0495631_0016181
344 Ga0495631_0069041
345 Ga0495632_0066966
346 Ga0495666_0034058
347 Ga0495666_0151229
348 Ga0495597_0018219
349 Ga0495668_0000448
350 Ga0495668_0169770
351 Ga0495611_0098276
352 Ga0495611_0177338
353 Ga0495625_0075727
354 Ga0495588_0064618
355 Ga0495669_0000031
356 Ga0495670_0040039
357 Ga0495660_0021194
358 Ga0495636_0014313
359 Ga0495674_0003407
360 Ga0495672_0000661
361 Ga0495676_0130422
362 Ga0495687_001784
363 Ga0495677_0023569
364 Ga0495673_0061922
365 Ga0495686_0005609
366 Ga0495682_0032930
367 Ga0501299_031344
368 Ga0501034_0000271
369 Ga0501034_0029250
370 Ga0501043_0492255
371 Ga0501068_0008345
372 Ga0501070_0071962
373 Ga0501072_0001000
374 Ga0501073_0004419
375 Ga0501074_0083354
376 Ga0501202_037926
377 Ga0501207_004812
378 Ga0501222_003052
379 Ga0501227_015055
380 Ga0501235_004043
381 Ga0501258_002283
382 Ga0501221_001434
383 Ga0501080_0006397
384 Ga0501232_001907
385 Ga0501262_004426
386 Ga0501262_013626
387 Ga0501267_000531
388 Ga0501035_0577795
389 nmdc:mga03683_53068_c1
390 nmdc:mga00v17_3613_c1
391 nmdc:mga0k408_188978_c1
392 nmdc:mga0k408_339_c1
393 nmdc:mga0k408_7162_c1
394 nmdc:mga0k408_9311_c1
395 nmdc:mga07m45_132090_c1
396 nmdc:mga07m45_20793_c1
397 nmdc:mga07m45_25921_c1
398 nmdc:mga07m45_6397_c1
399 nmdc:mga07m45_8882_c1
400 Ga0500619_000100
401 2644258604
402 2739056694
403 2834642005
404 8003404453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00494

SQS_PSY

Squalene/phytoene synthase

35

294

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hd1-assembly1.cif.gz_A crystal structure of squalene synthase hpnc from alicyclobacillus acidocaldarius 0.9144 5 246
5iys-assembly1.cif.gz_A crystal structure of a dehydrosqualene synthase in complex with ligand 0.8814 6 269
3acx-assembly1.cif.gz_A crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bph-673 0.8768 5 269
3vje-assembly2.cif.gz_B crystal structure of the y248a mutant of c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus in complex with zaragozic acid a 0.8758 5 269
3ae0-assembly2.cif.gz_B crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with geranylgeranyl thiopyrophosphate 0.8724 5 269
ID Description Score Start End Superfamily
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9133 5 248 1.10.600.10
4hd1A00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9122 5 246 1.10.600.10
af_Q17477_122_396_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8907 5 248 1.10.600.10
af_P9WHP3_1_280_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8859 8 269 1.10.600.10
3w7fA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8792 5 269 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A519LF49-F1-model_v4 Squalene synthase HpnC (EC 2.5.1.21) 0.97 15 270 GO:0004311
GO:0008299
GO:0051996
AF-A0A7H0HKZ3-F1-model_v4 Squalene synthase HpnC (EC 2.5.1.21) 0.9649 1 270 GO:0004311
GO:0008299
GO:0051996
AF-A0A3C1YSS3-F1-model_v4 Squalene synthase HpnC 0.964 85 269 GO:0008299
AF-A0A257JD24-F1-model_v4 Squalene synthase HpnC 0.9614 13 225 GO:0008299
AF-A0A519IMR0-F1-model_v4 Squalene synthase HpnC (EC 2.5.1.21) 0.9611 1 274 GO:0004311
GO:0008299
GO:0051996

Map