F309139

General Info

Members Datasets Scaffolds Average Seq Length
201 143 402 152

Family's Representative Sequence

Representative Sequence 3300061719|Ga0466962_0301627|Ga0466962_0301627_99_581
Length 160
Sequence VDDGEGNQMLTCHVESFEQRLPELQRLLPEHYAELALNQDKVPLSPQYDVYIERERRGELLFVTMREAGELVGYFIGFIAPGLHYSTCLTCTMDIFYIRKDKRGQALPGVRLFRFVESELRRRGVDRWFAGSKVKADASALFEFLQFERVEVYYSKWLGD

Samples

Sample ID Description Type Environment
1 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
29 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
30 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
43 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
45 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
46 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
52 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
53 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
54 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
55 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
56 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
57 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
58 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
59 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
68 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
71 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
72 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
73 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
81 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
82 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
85 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
86 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
91 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
105 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
106 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
107 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
115 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
132 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
133 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
134 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
138 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
139 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
140 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
141 2643221556 Massilia sp. Root1485 Isolate Unclassified
142 2643221684 Massilia sp. Root133 Isolate Unclassified
143 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.52
Metatranscriptomes 0.5
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.49
Nodule 0.5
Rhizoplane 5.47
Rhizosphere 87.06
Stem 0
Stem Tuber 0
Unclassified 6.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466962_0301627 3300061719 Unclassified 792
2 MBSR1b_contig_1624056 2162886012 Bacteria 3849
3 MBSR1b_contig_6517372 2162886012 Bacteria 981
4 JGI24739J22299_10000005 3300001989 Bacteria 75837
5 rootL2_10254941 3300003322 Viruses 5031
6 Ga0055529_1017503 3300003763 Bacteria 899
7 Ga0065715_10000181 3300005293 Bacteria 37452
8 Ga0065715_10094549 3300005293 Bacteria 4307
9 Ga0070691_10392248 3300005341 Bacteria 780
10 Ga0070661_100001739 3300005344 Bacteria 15107
11 Ga0070668_100168961 3300005347 Bacteria 1779
12 Ga0070673_100939047 3300005364 Bacteria 803
13 Ga0070710_10041711 3300005437 Bacteria 2535
14 Ga0070711_100071111 3300005439 Bacteria 2451
15 Ga0068867_101143815 3300005459 Bacteria 712
16 Ga0070685_10183929 3300005466 Bacteria 1347
17 Ga0068855_100000654 3300005563 Bacteria 42291
18 Ga0068855_100107092 3300005563 Bacteria 3212
19 Ga0068855_100456293 3300005563 Bacteria 1394
20 Ga0070664_100001022 3300005564 Bacteria 21965
21 Ga0070664_100098895 3300005564 Bacteria 2535
22 Ga0068857_100053719 3300005577 Bacteria 3574
23 Ga0068856_101227884 3300005614 Bacteria 766
24 Ga0070712_100049460 3300006175 Viruses 2919
25 Ga0079104_1026881 3300006946 Viruses 1481
26 Ga0105240_10278115 3300009093 Unclassified 1924
27 Ga0105240_11870270 3300009093 Unclassified 625
28 Ga0105241_10002336 3300009174 Bacteria 14249
29 Ga0105241_10482091 3300009174 Unclassified 1102
30 Ga0105237_10002052 3300009545 Bacteria 25598
31 Ga0105238_10007994 3300009551 Bacteria 10583
32 Ga0105238_10021789 3300009551 Bacteria 6527
33 Ga0105238_10239284 3300009551 Bacteria 1793
34 Ga0105239_10002620 3300010375 Bacteria 22747
35 Ga0157370_10036465 3300013104 Bacteria 4771
36 Ga0157374_10005420 3300013296 Bacteria 10720
37 Ga0157374_10006155 3300013296 Bacteria 10167
38 Ga0182007_10019478 3300015262 Bacteria 2439
39 Ga0182005_1000235 3300015265 Bacteria 35701
40 Ga0209455_1000815 3300025272 Bacteria 16973
41 Ga0207654_10000398 3300025911 Bacteria 25317
42 Ga0207654_10885228 3300025911 Unclassified 647
43 Ga0207695_10130191 3300025913 Bacteria 2474
44 Ga0207671_10002676 3300025914 Bacteria 18681
45 Ga0207693_10038253 3300025915 Bacteria 3779
46 Ga0207649_10001313 3300025920 Bacteria 14817
47 Ga0207694_10000958 3300025924 Bacteria 25491
48 Ga0207694_10922984 3300025924 Bacteria 738
49 Ga0207694_11174481 3300025924 Bacteria 649
50 Ga0207679_10000438 3300025945 Bacteria 29426
51 Ga0207679_10137153 3300025945 Bacteria 1972
52 Ga0207667_10000596 3300025949 Bacteria 46852
53 Ga0207651_11213999 3300025960 Bacteria 677
54 Ga0207668_10156797 3300025972 Bacteria 1769
55 Ga0207674_10059643 3300026116 Bacteria 3860
56 Ga0265356_1001338 3300028017 Unclassified 3673
57 Ga0265762_1002921 3300030760 Bacteria 3052
58 Ga0307411_10072703 3300032005 Viruses 2336
59 Ga0373953_0047499 3300035117 Bacteria 1727
60 Ga0395899_0001263 3300037312 Bacteria 22013
61 Ga0395899_0023036 3300037312 Bacteria 4719
62 Ga0395899_0254841 3300037312 Bacteria 1203
63 Ga0395900_0001440 3300037418 Bacteria 28407
64 Ga0395900_0001888 3300037418 Bacteria 23837
65 Ga0395900_0005789 3300037418 Bacteria 12910
66 Ga0395900_0017329 3300037418 Bacteria 7354
67 Ga0395900_0581026 3300037418 Bacteria 1062
68 Ga0395898_0002932 3300037466 Bacteria 19402
69 Ga0395898_0003695 3300037466 Bacteria 16992
70 Ga0395898_0017466 3300037466 Bacteria 7325
71 Ga0395898_0105886 3300037466 Bacteria 2697
72 Ga0395898_0375877 3300037466 Bacteria 1355
73 Ga0395905_0000817 3300037471 Viruses 40906
74 Ga0395901_0000019 3300038443 Bacteria 317063
75 Ga0395901_0000724 3300038443 Bacteria 37510
76 Ga0395901_0146471 3300038443 Bacteria 2482
77 Ga0395901_0160936 3300038443 Bacteria 2358
78 Ga0451793_0322647 3300041452 Bacteria 1478
79 Ga0451798_0852357 3300041458 Unclassified 641
80 Ga0451802_0488347 3300041460 Viruses 23236
81 Ga0451804_0846998 3300041463 Viruses 10901
82 Ga0439448_0003524 3300042005 Bacteria 4341
83 Ga0439448_0014197 3300042005 Bacteria 2401
84 Ga0439450_013935 3300042008 Bacteria 1623
85 Ga0450889_000001 3300042144 Bacteria 36191
86 Ga0466969_0022873 3300044656 Viruses 3223
87 Ga0466969_0213140 3300044656 Unclassified 879
88 Ga0466965_0209810 3300044683 Bacteria 1035
89 Ga0466966_0000164 3300044684 Bacteria 43341
90 Ga0466966_0047258 3300044684 Bacteria 2745
91 Ga0466961_0004824 3300044693 Bacteria 8486
92 Ga0466961_0050158 3300044693 Bacteria 2666
93 Ga0466963_0000015 3300044694 Bacteria 62151
94 Ga0466970_0000720 3300044765 Bacteria 16197
95 Ga0466970_0316226 3300044765 Bacteria 882
96 Ga0466957_0018865 3300044842 Bacteria 4054
97 Ga0466958_0045830 3300045836 Bacteria 2638
98 Ga0466967_0444215 3300045976 Bacteria 1267
99 Ga0495592_0012311 3300046454 Bacteria 6495
100 Ga0495592_0163472 3300046454 Bacteria 1530
101 Ga0495591_000385 3300046458 Bacteria 37389
102 Ga0495638_0000706 3300046460 Bacteria 36153
103 Ga0495651_0000325 3300046462 Viruses 37010
104 Ga0495651_0012608 3300046462 Bacteria 6524
105 Ga0495651_0515769 3300046462 Unclassified 763
106 Ga0495582_0032612 3300046473 Bacteria 2864
107 Ga0495582_0048522 3300046473 Bacteria 2338
108 Ga0495582_0408188 3300046473 Bacteria 783
109 Ga0495605_0000443 3300046474 Bacteria 37299
110 Ga0495605_0012797 3300046474 Bacteria 4643
111 Ga0495639_0211905 3300046475 Bacteria 951
112 Ga0495607_0000783 3300046501 Bacteria 30260
113 Ga0495608_0019317 3300046511 Viruses 4691
114 Ga0495618_0000197 3300046514 Bacteria 43382
115 Ga0495620_0025171 3300046515 Bacteria 2819
116 Ga0495620_0030587 3300046515 Bacteria 2477
117 Ga0495628_0063581 3300046516 Bacteria 2891
118 Ga0495628_0145224 3300046516 Bacteria 1809
119 Ga0495630_0000273 3300046517 Bacteria 41968
120 Ga0495630_0001077 3300046517 Bacteria 18813
121 Ga0495630_0075553 3300046517 Viruses 2538
122 Ga0495631_0000247 3300046518 Bacteria 37413
123 Ga0495631_0131924 3300046518 Bacteria 1073
124 Ga0495637_0000959 3300046520 Bacteria 18397
125 Ga0495644_0000320 3300046523 Bacteria 22091
126 Ga0495648_0001489 3300046524 Bacteria 22912
127 Ga0495663_0003670 3300046525 Bacteria 4397
128 Ga0495642_0000434 3300046528 Bacteria 22071
129 Ga0495665_0129865 3300046531 Bacteria 1319
130 Ga0495640_0136025 3300046533 Bacteria 1587
131 Ga0495586_0000325 3300046535 Bacteria 30222
132 Ga0495586_0006817 3300046535 Bacteria 6090
133 Ga0495587_0002228 3300046536 Bacteria 12966
134 Ga0495609_0000450 3300046538 Bacteria 33780
135 Ga0495609_0001185 3300046538 Bacteria 17992
136 Ga0495609_0322610 3300046538 Bacteria 626
137 Ga0495597_0000410 3300046542 Viruses 37028
138 Ga0495622_0136432 3300046557 Archaea 1115
139 Ga0495622_0297805 3300046557 Unclassified 703
140 Ga0495633_0000624 3300046558 Bacteria 33223
141 Ga0495667_0014825 3300046559 Bacteria 5267
142 Ga0495667_0033397 3300046559 Bacteria 3444
143 Ga0495668_0000771 3300046616 Bacteria 37352
144 Ga0495668_0004812 3300046616 Bacteria 9396
145 Ga0495634_0000431 3300046642 Bacteria 41714
146 Ga0495611_0000267 3300046648 Bacteria 35806
147 Ga0495661_0000023 3300046665 Bacteria 189053
148 Ga0495661_0000826 3300046665 Bacteria 29049
149 Ga0495661_0031841 3300046665 Bacteria 3339
150 Ga0495657_0023765 3300046675 Viruses 4376
151 Ga0495599_0081422 3300046678 Unclassified 2022
152 Ga0495599_0326604 3300046678 Unclassified 923
153 Ga0495658_0004154 3300046683 Bacteria 7133
154 Ga0495658_0052064 3300046683 Bacteria 2320
155 Ga0495658_0203254 3300046683 Bacteria 1235
156 Ga0495669_0000337 3300046684 Bacteria 24840
157 Ga0495669_0023975 3300046684 Bacteria 2658
158 Ga0495670_0003099 3300046691 Bacteria 8199
159 Ga0495671_0176703 3300046692 Bacteria 1037
160 Ga0495649_0063920 3300046694 Bacteria 1977
161 Ga0495589_0000400 3300046794 Bacteria 32671
162 Ga0495660_0000429 3300046810 Bacteria 35486
163 Ga0495581_0260120 3300047315 Bacteria 1015
164 Ga0495604_0003030 3300047317 Bacteria 13433
165 Ga0495636_0000847 3300047318 Bacteria 11273
166 Ga0495674_0016381 3300047319 Bacteria 6913
167 Ga0495674_0285417 3300047319 Bacteria 1351
168 Ga0495683_0022536 3300047323 Bacteria 3238
169 Ga0495675_0000963 3300047444 Bacteria 17493
170 Ga0495677_0008958 3300047445 Bacteria 3702
171 Ga0495685_000118 3300047447 Bacteria 27333
172 Ga0495684_0000252 3300047471 Bacteria 42321
173 Ga0495686_0000236 3300047472 Bacteria 100482
174 Ga0495593_0594657 3300047673 Bacteria 555
175 Ga0495602_0047792 3300048088 Viruses 3852
176 Ga0495614_0075284 3300048089 Bacteria 1458
177 Ga0495615_0228693 3300048090 Bacteria 583
178 Ga0495626_0000774 3300048091 Bacteria 29205
179 Ga0495626_0008516 3300048091 Bacteria 5612
180 Ga0496104_0000412 3300048907 Bacteria 37496
181 Ga0496105_0000236 3300048908 Bacteria 37377
182 Ga0496106_0008068 3300048909 Bacteria 7775
183 Ga0496106_0474369 3300048909 Bacteria 1005
184 Ga0496110_0731846 3300048913 Bacteria 892
185 Ga0496115_0069969 3300048918 Bacteria 2844
186 Ga0496118_0005949 3300048921 Viruses 13623
187 Ga0496119_0034130 3300048922 Bacteria 3358
188 Ga0496124_0007023 3300048927 Bacteria 12063
189 Ga0495678_029438 3300049459 Unclassified 2305
190 Ga0501242_000125 3300049674 Bacteria 5447
191 Ga0501250_009158 3300049680 Unclassified 1108
192 Ga0501283_000092 3300049779 Bacteria 10970
193 Ga0500556_0003135 3300053104 Viruses 4932
194 Ga0500562_000438 3300053108 Bacteria 10147
195 Ga0500574_135474 3300053141 Bacteria 725
196 2501411029 2501025504 Bacteria 8008976
197 2511096518 2510917014 Bacteria 8296963
198 2599906295 2599185292 Bacteria 6290804
199 2643801696 2643221556 Bacteria 7251154
200 2644474528 2643221684 Bacteria 7145183
201 2881416454 2881412998 Bacteria 6492157
202 Ga0466962_0301627
203 MBSR1b_contig_1624056
204 MBSR1b_contig_6517372
205 JGI24739J22299_10000005
206 rootL2_10254941
207 Ga0055529_1017503
208 Ga0065715_10000181
209 Ga0065715_10094549
210 Ga0070691_10392248
211 Ga0070661_100001739
212 Ga0070668_100168961
213 Ga0070673_100939047
214 Ga0070710_10041711
215 Ga0070711_100071111
216 Ga0068867_101143815
217 Ga0070685_10183929
218 Ga0068855_100000654
219 Ga0068855_100107092
220 Ga0068855_100456293
221 Ga0070664_100001022
222 Ga0070664_100098895
223 Ga0068857_100053719
224 Ga0068856_101227884
225 Ga0070712_100049460
226 Ga0079104_1026881
227 Ga0105240_10278115
228 Ga0105240_11870270
229 Ga0105241_10002336
230 Ga0105241_10482091
231 Ga0105237_10002052
232 Ga0105238_10007994
233 Ga0105238_10021789
234 Ga0105238_10239284
235 Ga0105239_10002620
236 Ga0157370_10036465
237 Ga0157374_10005420
238 Ga0157374_10006155
239 Ga0182007_10019478
240 Ga0182005_1000235
241 Ga0209455_1000815
242 Ga0207654_10000398
243 Ga0207654_10885228
244 Ga0207695_10130191
245 Ga0207671_10002676
246 Ga0207693_10038253
247 Ga0207649_10001313
248 Ga0207694_10000958
249 Ga0207694_10922984
250 Ga0207694_11174481
251 Ga0207679_10000438
252 Ga0207679_10137153
253 Ga0207667_10000596
254 Ga0207651_11213999
255 Ga0207668_10156797
256 Ga0207674_10059643
257 Ga0265356_1001338
258 Ga0265762_1002921
259 Ga0307411_10072703
260 Ga0373953_0047499
261 Ga0395899_0001263
262 Ga0395899_0023036
263 Ga0395899_0254841
264 Ga0395900_0001440
265 Ga0395900_0001888
266 Ga0395900_0005789
267 Ga0395900_0017329
268 Ga0395900_0581026
269 Ga0395898_0002932
270 Ga0395898_0003695
271 Ga0395898_0017466
272 Ga0395898_0105886
273 Ga0395898_0375877
274 Ga0395905_0000817
275 Ga0395901_0000019
276 Ga0395901_0000724
277 Ga0395901_0146471
278 Ga0395901_0160936
279 Ga0451793_0322647
280 Ga0451798_0852357
281 Ga0451802_0488347
282 Ga0451804_0846998
283 Ga0439448_0003524
284 Ga0439448_0014197
285 Ga0439450_013935
286 Ga0450889_000001
287 Ga0466969_0022873
288 Ga0466969_0213140
289 Ga0466965_0209810
290 Ga0466966_0000164
291 Ga0466966_0047258
292 Ga0466961_0004824
293 Ga0466961_0050158
294 Ga0466963_0000015
295 Ga0466970_0000720
296 Ga0466970_0316226
297 Ga0466957_0018865
298 Ga0466958_0045830
299 Ga0466967_0444215
300 Ga0495592_0012311
301 Ga0495592_0163472
302 Ga0495591_000385
303 Ga0495638_0000706
304 Ga0495651_0000325
305 Ga0495651_0012608
306 Ga0495651_0515769
307 Ga0495582_0032612
308 Ga0495582_0048522
309 Ga0495582_0408188
310 Ga0495605_0000443
311 Ga0495605_0012797
312 Ga0495639_0211905
313 Ga0495607_0000783
314 Ga0495608_0019317
315 Ga0495618_0000197
316 Ga0495620_0025171
317 Ga0495620_0030587
318 Ga0495628_0063581
319 Ga0495628_0145224
320 Ga0495630_0000273
321 Ga0495630_0001077
322 Ga0495630_0075553
323 Ga0495631_0000247
324 Ga0495631_0131924
325 Ga0495637_0000959
326 Ga0495644_0000320
327 Ga0495648_0001489
328 Ga0495663_0003670
329 Ga0495642_0000434
330 Ga0495665_0129865
331 Ga0495640_0136025
332 Ga0495586_0000325
333 Ga0495586_0006817
334 Ga0495587_0002228
335 Ga0495609_0000450
336 Ga0495609_0001185
337 Ga0495609_0322610
338 Ga0495597_0000410
339 Ga0495622_0136432
340 Ga0495622_0297805
341 Ga0495633_0000624
342 Ga0495667_0014825
343 Ga0495667_0033397
344 Ga0495668_0000771
345 Ga0495668_0004812
346 Ga0495634_0000431
347 Ga0495611_0000267
348 Ga0495661_0000023
349 Ga0495661_0000826
350 Ga0495661_0031841
351 Ga0495657_0023765
352 Ga0495599_0081422
353 Ga0495599_0326604
354 Ga0495658_0004154
355 Ga0495658_0052064
356 Ga0495658_0203254
357 Ga0495669_0000337
358 Ga0495669_0023975
359 Ga0495670_0003099
360 Ga0495671_0176703
361 Ga0495649_0063920
362 Ga0495589_0000400
363 Ga0495660_0000429
364 Ga0495581_0260120
365 Ga0495604_0003030
366 Ga0495636_0000847
367 Ga0495674_0016381
368 Ga0495674_0285417
369 Ga0495683_0022536
370 Ga0495675_0000963
371 Ga0495677_0008958
372 Ga0495685_000118
373 Ga0495684_0000252
374 Ga0495686_0000236
375 Ga0495593_0594657
376 Ga0495602_0047792
377 Ga0495614_0075284
378 Ga0495615_0228693
379 Ga0495626_0000774
380 Ga0495626_0008516
381 Ga0496104_0000412
382 Ga0496105_0000236
383 Ga0496106_0008068
384 Ga0496106_0474369
385 Ga0496110_0731846
386 Ga0496115_0069969
387 Ga0496118_0005949
388 Ga0496119_0034130
389 Ga0496124_0007023
390 Ga0495678_029438
391 Ga0501242_000125
392 Ga0501250_009158
393 Ga0501283_000092
394 Ga0500556_0003135
395 Ga0500562_000438
396 Ga0500574_135474
397 2501411029
398 2511096518
399 2599906295
400 2643801696
401 2644474528
402 2881416454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8008 49 137
2z3l-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7942 41 99
7n1l-assembly6.cif.gz_L crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.7917 1 151
7n1l-assembly2.cif.gz_E crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.7896 2 149
6yug-assembly1.cif.gz_B crystal structure of c. parvum gna1 in complex with acetyl-coa and glucose 6p. 0.7888 1 147
ID Description Score Start End Superfamily
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8734 82 146 3.40.630.30
af_O13738_1_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8401 51 137 3.40.630.30
af_E7FBQ5_16_147_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8359 62 143 3.40.630.30
af_A0A0P0WGU7_189_301_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.833 51 142 3.40.630.30
af_K7LHF0_767_874_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8318 50 142 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4V2LSA7-F1-model_v4 GNAT family N-acetyltransferase 0.9804 1 151 GO:0016747
AF-A0A158RXN3-F1-model_v4 GCN5-related N-acetyltransferase 0.9778 1 149 GO:0016747
AF-A0A4V2LSA7-F1-model_v4 GNAT family N-acetyltransferase 0.974 1 151 GO:0016747
AF-A0A158DMM2-F1-model_v4 GCN5-like N-acetyltransferase 0.9709 1 149 GO:0016747
AF-A0A246IV20-F1-model_v4 N-acetyltransferase domain-containing protein 0.9699 1 149 GO:0016747

Map