F309129

General Info

Members Datasets Scaffolds Average Seq Length
201 139 402 330

Family's Representative Sequence

Representative Sequence 3300053177|Ga0500636_0011877|Ga0500636_0011877_3083_4213
Length 376
Sequence MCCEGLSSRSAHGFLRARWRPENNQKTTEEAFMERRTFLAGAAVAXXXLAVKSAAADTLPLGNLPNTRYPDPRVEVIDPRFKYKIGNGAIERIATGFRWAEGPVYIRDYRRLIWSDIPNNRMMSWNEEDGHVSVFRQPSNYSNGNTRDRQGRLLTCEHDARRVSRTEHDGTISTILDSFDGKKLNAPNDIVVASDDSIWFTDPGYGILGNYEGHLDKSEQPPRVYRVDGKTGKATMVVDSFDKPNGIAFSPDEKKLYIIDSGITHGGRSNMRVFDVDVATGKVTNDKVFAENFAPGFTDGVRTDIDGNVWCSMGWADPKEDGVRCYAPGGDLIGKIHLPETCANLCFGGPKRNRLFMCASTSVYATYVETQGALMP

Samples

Sample ID Description Type Environment
1 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
81 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
82 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
83 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
136 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
139 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 1
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 1.49
Rhizosphere 93.53
Stem 0
Stem Tuber 0
Unclassified 2.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500636_0011877 3300053177 Bacteria 5101
2 rootH2_10062141 3300003320 Bacteria 7638
3 rootH1_10361622 3300003323 Bacteria 1287
4 Ga0065712_10178059 3300005290 Bacteria 1207
5 Ga0070683_100215176 3300005329 Bacteria 1826
6 Ga0068868_100042086 3300005338 Bacteria 3562
7 Ga0070661_100055926 3300005344 Bacteria 2889
8 Ga0070661_100107770 3300005344 Unclassified 2078
9 Ga0070673_100098800 3300005364 Bacteria 2400
10 Ga0070659_100225551 3300005366 Bacteria 1547
11 Ga0070709_10000398 3300005434 Bacteria 26579
12 Ga0070709_10138178 3300005434 Bacteria 1671
13 Ga0070714_100012894 3300005435 Bacteria 6683
14 Ga0070714_100476436 3300005435 Bacteria 1188
15 Ga0070713_100000552 3300005436 Bacteria 23819
16 Ga0070713_100039962 3300005436 Bacteria 3812
17 Ga0070713_100060559 3300005436 Bacteria 3165
18 Ga0070710_10006582 3300005437 Bacteria 5586
19 Ga0070710_10046232 3300005437 Bacteria 2423
20 Ga0070710_10048069 3300005437 Bacteria 2382
21 Ga0070711_100080215 3300005439 Unclassified 2323
22 Ga0070681_10184713 3300005458 Bacteria 2006
23 Ga0070698_100017174 3300005471 Bacteria 7628
24 Ga0070698_100120507 3300005471 Bacteria 2584
25 Ga0070679_100011260 3300005530 Bacteria 8525
26 Ga0068853_100047612 3300005539 Bacteria 3680
27 Ga0068853_100158452 3300005539 Bacteria 2041
28 Ga0070696_100030161 3300005546 Bacteria 3712
29 Ga0070665_100023749 3300005548 Bacteria 6176
30 Ga0070665_100287099 3300005548 Bacteria 1647
31 Ga0070664_100260439 3300005564 Bacteria 1561
32 Ga0068856_100245664 3300005614 Bacteria 1805
33 Ga0068852_100342231 3300005616 Bacteria 1458
34 Ga0070717_10002467 3300006028 Bacteria 13057
35 Ga0070717_10171581 3300006028 Bacteria 1887
36 Ga0070715_10079313 3300006163 Bacteria 1486
37 Ga0070712_100000397 3300006175 Bacteria 24792
38 Ga0070712_100017210 3300006175 Bacteria 4677
39 Ga0075436_100019704 3300006914 Bacteria 4625
40 Ga0075436_100054436 3300006914 Bacteria 2762
41 Ga0099794_10049756 3300007265 Bacteria 2015
42 Ga0105240_10038232 3300009093 Bacteria 6157
43 Ga0105240_10407688 3300009093 Bacteria 1530
44 Ga0111539_10041142 3300009094 Bacteria 5558
45 Ga0105241_10094968 3300009174 Bacteria 2359
46 Ga0105248_10000004 3300009177 Bacteria 695244
47 Ga0105248_10001116 3300009177 Bacteria 29851
48 Ga0105237_10000566 3300009545 Bacteria 51699
49 Ga0105238_10452700 3300009551 Bacteria 1281
50 Ga0105239_10001377 3300010375 Bacteria 32591
51 Ga0157369_10054619 3300013105 Bacteria 4313
52 Ga0157374_10001946 3300013296 Bacteria 17314
53 Ga0157374_10150181 3300013296 Bacteria 2265
54 Ga0157372_10117322 3300013307 Bacteria 3053
55 Ga0157372_10179222 3300013307 Bacteria 2453
56 Ga0157372_10403777 3300013307 Bacteria 1592
57 Ga0163163_10009239 3300014325 Bacteria 8792
58 Ga0182008_10102784 3300014497 Bacteria 1413
59 Ga0157379_10493749 3300014968 Bacteria 1134
60 Ga0206352_10520830 3300020078 Bacteria 1378
61 Ga0207692_10012948 3300025898 Unclassified 3601
62 Ga0207685_10046475 3300025905 Bacteria 1652
63 Ga0207699_10000395 3300025906 Bacteria 22618
64 Ga0207705_10106080 3300025909 Bacteria 2072
65 Ga0207707_10002763 3300025912 Bacteria 15647
66 Ga0207671_10001629 3300025914 Bacteria 25557
67 Ga0207693_10000033 3300025915 Bacteria 114840
68 Ga0207693_10012768 3300025915 Bacteria 6779
69 Ga0207657_10003272 3300025919 Bacteria 17341
70 Ga0207652_10335306 3300025921 Bacteria 1365
71 Ga0207652_10410887 3300025921 Bacteria 1221
72 Ga0207700_10001440 3300025928 Bacteria 13501
73 Ga0207700_10045621 3300025928 Unclassified 3235
74 Ga0207700_10091947 3300025928 Bacteria 2398
75 Ga0207700_10399046 3300025928 Bacteria 1205
76 Ga0207664_10060153 3300025929 Bacteria 3027
77 Ga0207706_10039512 3300025933 Bacteria 4184
78 Ga0207665_10063655 3300025939 Bacteria 2505
79 Ga0207665_10105665 3300025939 Bacteria 1972
80 Ga0207711_10000008 3300025941 Bacteria 597686
81 Ga0207711_10000010 3300025941 Bacteria 557970
82 Ga0207661_10436077 3300025944 Bacteria 1192
83 Ga0207640_10403961 3300025981 Bacteria 1113
84 Ga0207639_10020220 3300026041 Bacteria 4762
85 Ga0207639_10275818 3300026041 Bacteria 1477
86 Ga0207702_10424989 3300026078 Bacteria 1285
87 Ga0207675_100393720 3300026118 Bacteria 1364
88 Ga0207698_10030230 3300026142 Bacteria 3892
89 Ga0207698_10140322 3300026142 Bacteria 2081
90 Ga0207698_10308416 3300026142 Bacteria 1477
91 Ga0209588_1002903 3300027671 Bacteria 4709
92 Ga0265356_1006587 3300028017 Bacteria 1353
93 Ga0268266_10000090 3300028379 Bacteria 195839
94 Ga0268266_10081856 3300028379 Bacteria 2815
95 Ga0268266_10187301 3300028379 Bacteria 1888
96 Ga0265337_1001065 3300028556 Bacteria 14149
97 Ga0265334_10002285 3300028573 Bacteria 9003
98 Ga0265338_10005824 3300028800 Bacteria 15902
99 Ga0265338_10008437 3300028800 Bacteria 12510
100 Ga0265338_10272533 3300028800 Unclassified 1240
101 Ga0265762_1000112 3300030760 Bacteria 12060
102 Ga0265330_10025529 3300031235 Bacteria 2678
103 Ga0265328_10025410 3300031239 Bacteria 2231
104 Ga0265325_10018489 3300031241 Bacteria 3865
105 Ga0265339_10000750 3300031249 Bacteria 25047
106 Ga0265331_10013865 3300031250 Bacteria 4314
107 Ga0265327_10017422 3300031251 Bacteria 4508
108 Ga0265313_10067899 3300031595 Bacteria 1648
109 Ga0265313_10078790 3300031595 Bacteria 1501
110 Ga0265314_10003378 3300031711 Bacteria 15476
111 Ga0265314_10146733 3300031711 Bacteria 1452
112 Ga0265342_10036916 3300031712 Bacteria 2982
113 Ga0307410_10158378 3300031852 Bacteria 1694
114 Ga0326468_10009126 3300031889 Bacteria 976
115 Ga0373926_0013639 3300035083 Bacteria 2757
116 Ga0373934_0038339 3300035086 Bacteria 1887
117 Ga0373923_0040323 3300035111 Bacteria 1921
118 Ga0373953_0016438 3300035117 Bacteria 2700
119 Ga0373956_0045202 3300035119 Bacteria 1964
120 Ga0373957_0015618 3300035120 Bacteria 2616
121 Ga0373957_0038914 3300035120 Bacteria 1782
122 Ga0373943_0056098 3300035170 Bacteria 1954
123 Ga0373943_0103593 3300035170 Bacteria 1492
124 Ga0373943_0163526 3300035170 Bacteria 1213
125 Ga0373946_0010845 3300035171 Bacteria 3385
126 Ga0373946_0032845 3300035171 Bacteria 2086
127 Ga0373924_0038142 3300035410 Bacteria 1959
128 Ga0373924_0070981 3300035410 Bacteria 1469
129 Ga0373935_0010764 3300035692 Bacteria 5494
130 Ga0373935_0025416 3300035692 Bacteria 3650
131 Ga0373927_0005127 3300035695 Bacteria 9067
132 Ga0373933_0001156 3300035724 Bacteria 15659
133 Ga0373933_0124669 3300035724 Bacteria 1615
134 Ga0373947_0001897 3300035725 Bacteria 12768
135 Ga0373947_0026809 3300035725 Bacteria 3370
136 Ga0373947_0316196 3300035725 Bacteria 1043
137 Ga0373937_0001827 3300036401 Bacteria 17865
138 Ga0373937_0002205 3300036401 Bacteria 16281
139 Ga0373937_0008418 3300036401 Bacteria 8967
140 Ga0373937_0039576 3300036401 Bacteria 4296
141 Ga0373937_0164202 3300036401 Bacteria 2082
142 Ga0373937_0559829 3300036401 Bacteria 1086
143 Ga0373925_0016265 3300037068 Bacteria 5385
144 Ga0373925_0026446 3300037068 Bacteria 4245
145 Ga0373925_0357652 3300037068 Bacteria 1186
146 Ga0373925_0369664 3300037068 Bacteria 1166
147 Ga0395900_0191564 3300037418 Bacteria 2074
148 Ga0395898_0046477 3300037466 Bacteria 4264
149 Ga0436364_0463315 3300037853 Bacteria 4349
150 Ga0436364_0518886 3300037853 Bacteria 6894
151 Ga0436364_0924964 3300037853 Bacteria 5173
152 Ga0439459_0016772 3300042438 Bacteria 1357
153 Ga0495651_0031077 3300046462 Bacteria 4165
154 Ga0495651_0032334 3300046462 Bacteria 4081
155 Ga0495653_0171518 3300046463 Bacteria 1497
156 Ga0495653_0220245 3300046463 Bacteria 1276
157 Ga0495664_0003516 3300046477 Bacteria 8538
158 Ga0495608_0006830 3300046511 Bacteria 8090
159 Ga0495618_0038530 3300046514 Bacteria 3005
160 Ga0495628_0017401 3300046516 Bacteria 5987
161 Ga0495630_0222983 3300046517 Bacteria 1439
162 Ga0495587_0004001 3300046536 Bacteria 9769
163 Ga0495587_0082218 3300046536 Bacteria 1866
164 Ga0495645_0002815 3300046543 Bacteria 11798
165 Ga0495635_0007780 3300046663 Bacteria 7484
166 Ga0495657_0053566 3300046675 Bacteria 2699
167 Ga0495657_0210151 3300046675 Bacteria 1183
168 Ga0495599_0030654 3300046678 Bacteria 3376
169 Ga0495613_0319705 3300046689 Bacteria 1071
170 Ga0495600_0157020 3300046809 Bacteria 1471
171 Ga0495604_0017408 3300047317 Bacteria 5752
172 Ga0495674_0023055 3300047319 Bacteria 5736
173 Ga0495674_0088699 3300047319 Bacteria 2645
174 Ga0495676_0154275 3300047321 Bacteria 1631
175 Ga0495680_0085295 3300047322 Bacteria 2378
176 Ga0495675_0005201 3300047444 Bacteria 7919
177 Ga0495675_0085164 3300047444 Bacteria 1988
178 Ga0495684_0038475 3300047471 Bacteria 3668
179 Ga0495684_0172707 3300047471 Bacteria 1606
180 Ga0495602_0001287 3300048088 Bacteria 24718
181 Ga0496108_0093893 3300048911 Bacteria 2553
182 Ga0496112_0358743 3300048915 Bacteria 1400
183 Ga0496114_0398900 3300048917 Bacteria 1218
184 Ga0496119_0010153 3300048922 Bacteria 7952
185 Ga0501032_0130129 3300049569 Bacteria 1661
186 Ga0501033_0125431 3300049570 Bacteria 1862
187 Ga0501035_0087034 3300049822 Bacteria 2753
188 Ga0501044_0078772 3300049823 Bacteria 3339
189 nmdc:mga08y16_206783_c1 3300050511 Bacteria 2033
190 nmdc:mga08y16_49029_c1 3300050511 Bacteria 4419
191 nmdc:mga08x19_105491_c1 3300050514 Bacteria 1874
192 nmdc:mga08x19_343_c1 3300050514 Bacteria 33683
193 Ga0495601_0001243 3300053077 Bacteria 13971
194 Ga0495612_0027802 3300053078 Bacteria 2275
195 Ga0495595_0055039 3300053084 Bacteria 1851
196 Ga0495619_0007451 3300053085 Bacteria 6933
197 Ga0500644_0033054 3300053088 Bacteria 1658
198 Ga0500595_030712 3300053119 Bacteria 1807
199 Ga0501084_0098214 3300054114 Bacteria 2459
200 2889307455 2889306138 Bacteria 6358934
201 3003672590 3003665799 Bacteria 7279786
202 Ga0500636_0011877
203 rootH2_10062141
204 rootH1_10361622
205 Ga0065712_10178059
206 Ga0070683_100215176
207 Ga0068868_100042086
208 Ga0070661_100055926
209 Ga0070661_100107770
210 Ga0070673_100098800
211 Ga0070659_100225551
212 Ga0070709_10000398
213 Ga0070709_10138178
214 Ga0070714_100012894
215 Ga0070714_100476436
216 Ga0070713_100000552
217 Ga0070713_100039962
218 Ga0070713_100060559
219 Ga0070710_10006582
220 Ga0070710_10046232
221 Ga0070710_10048069
222 Ga0070711_100080215
223 Ga0070681_10184713
224 Ga0070698_100017174
225 Ga0070698_100120507
226 Ga0070679_100011260
227 Ga0068853_100047612
228 Ga0068853_100158452
229 Ga0070696_100030161
230 Ga0070665_100023749
231 Ga0070665_100287099
232 Ga0070664_100260439
233 Ga0068856_100245664
234 Ga0068852_100342231
235 Ga0070717_10002467
236 Ga0070717_10171581
237 Ga0070715_10079313
238 Ga0070712_100000397
239 Ga0070712_100017210
240 Ga0075436_100019704
241 Ga0075436_100054436
242 Ga0099794_10049756
243 Ga0105240_10038232
244 Ga0105240_10407688
245 Ga0111539_10041142
246 Ga0105241_10094968
247 Ga0105248_10000004
248 Ga0105248_10001116
249 Ga0105237_10000566
250 Ga0105238_10452700
251 Ga0105239_10001377
252 Ga0157369_10054619
253 Ga0157374_10001946
254 Ga0157374_10150181
255 Ga0157372_10117322
256 Ga0157372_10179222
257 Ga0157372_10403777
258 Ga0163163_10009239
259 Ga0182008_10102784
260 Ga0157379_10493749
261 Ga0206352_10520830
262 Ga0207692_10012948
263 Ga0207685_10046475
264 Ga0207699_10000395
265 Ga0207705_10106080
266 Ga0207707_10002763
267 Ga0207671_10001629
268 Ga0207693_10000033
269 Ga0207693_10012768
270 Ga0207657_10003272
271 Ga0207652_10335306
272 Ga0207652_10410887
273 Ga0207700_10001440
274 Ga0207700_10045621
275 Ga0207700_10091947
276 Ga0207700_10399046
277 Ga0207664_10060153
278 Ga0207706_10039512
279 Ga0207665_10063655
280 Ga0207665_10105665
281 Ga0207711_10000008
282 Ga0207711_10000010
283 Ga0207661_10436077
284 Ga0207640_10403961
285 Ga0207639_10020220
286 Ga0207639_10275818
287 Ga0207702_10424989
288 Ga0207675_100393720
289 Ga0207698_10030230
290 Ga0207698_10140322
291 Ga0207698_10308416
292 Ga0209588_1002903
293 Ga0265356_1006587
294 Ga0268266_10000090
295 Ga0268266_10081856
296 Ga0268266_10187301
297 Ga0265337_1001065
298 Ga0265334_10002285
299 Ga0265338_10005824
300 Ga0265338_10008437
301 Ga0265338_10272533
302 Ga0265762_1000112
303 Ga0265330_10025529
304 Ga0265328_10025410
305 Ga0265325_10018489
306 Ga0265339_10000750
307 Ga0265331_10013865
308 Ga0265327_10017422
309 Ga0265313_10067899
310 Ga0265313_10078790
311 Ga0265314_10003378
312 Ga0265314_10146733
313 Ga0265342_10036916
314 Ga0307410_10158378
315 Ga0326468_10009126
316 Ga0373926_0013639
317 Ga0373934_0038339
318 Ga0373923_0040323
319 Ga0373953_0016438
320 Ga0373956_0045202
321 Ga0373957_0015618
322 Ga0373957_0038914
323 Ga0373943_0056098
324 Ga0373943_0103593
325 Ga0373943_0163526
326 Ga0373946_0010845
327 Ga0373946_0032845
328 Ga0373924_0038142
329 Ga0373924_0070981
330 Ga0373935_0010764
331 Ga0373935_0025416
332 Ga0373927_0005127
333 Ga0373933_0001156
334 Ga0373933_0124669
335 Ga0373947_0001897
336 Ga0373947_0026809
337 Ga0373947_0316196
338 Ga0373937_0001827
339 Ga0373937_0002205
340 Ga0373937_0008418
341 Ga0373937_0039576
342 Ga0373937_0164202
343 Ga0373937_0559829
344 Ga0373925_0016265
345 Ga0373925_0026446
346 Ga0373925_0357652
347 Ga0373925_0369664
348 Ga0395900_0191564
349 Ga0395898_0046477
350 Ga0436364_0463315
351 Ga0436364_0518886
352 Ga0436364_0924964
353 Ga0439459_0016772
354 Ga0495651_0031077
355 Ga0495651_0032334
356 Ga0495653_0171518
357 Ga0495653_0220245
358 Ga0495664_0003516
359 Ga0495608_0006830
360 Ga0495618_0038530
361 Ga0495628_0017401
362 Ga0495630_0222983
363 Ga0495587_0004001
364 Ga0495587_0082218
365 Ga0495645_0002815
366 Ga0495635_0007780
367 Ga0495657_0053566
368 Ga0495657_0210151
369 Ga0495599_0030654
370 Ga0495613_0319705
371 Ga0495600_0157020
372 Ga0495604_0017408
373 Ga0495674_0023055
374 Ga0495674_0088699
375 Ga0495676_0154275
376 Ga0495680_0085295
377 Ga0495675_0005201
378 Ga0495675_0085164
379 Ga0495684_0038475
380 Ga0495684_0172707
381 Ga0495602_0001287
382 Ga0496108_0093893
383 Ga0496112_0358743
384 Ga0496114_0398900
385 Ga0496119_0010153
386 Ga0501032_0130129
387 Ga0501033_0125431
388 Ga0501035_0087034
389 Ga0501044_0078772
390 nmdc:mga08y16_206783_c1
391 nmdc:mga08y16_49029_c1
392 nmdc:mga08x19_105491_c1
393 nmdc:mga08x19_343_c1
394 Ga0495601_0001243
395 Ga0495612_0027802
396 Ga0495595_0055039
397 Ga0495619_0007451
398 Ga0500644_0033054
399 Ga0500595_030712
400 Ga0501084_0098214
401 2889307455
402 3003672590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

99

361

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dr2-assembly1.cif.gz_A structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9601 32 325
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.958 32 325
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9557 35 331
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.93 35 331
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8952 32 325
ID Description Score Start End Superfamily
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9601 32 325 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9559 35 331 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.93 35 331 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8943 32 325 2.120.10.30
af_F1Q9A6_243_506_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8582 57 298 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A537YCQ9-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9973 48 195 GO:0016787
AF-A0A6N8W586-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9963 36 153 GO:0016787
AF-A0A382VLL5-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9958 35 187 GO:0016787
AF-A0A529HQS4-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9909 41 182 GO:0016787
AF-A0A529X5G7-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9904 35 124 GO:0016787

Map