F309004

General Info

Members Datasets Scaffolds Average Seq Length
201 152 402 160

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0275460|Ga0496114_0275460_125_637
Length 170
Sequence MTDTQEEPTRTIPHVGDAAPSVELPDENRTVHRLEDQRGRWTILYFYPEDDTSGCTTEACQFRDLHRDIVASDADVWGVSPDGADSHQRFRTKYGLPFTLLSDEDHDVSTRYGAWALKTNYGKTYMGIVRSSFLIDPDGRIAKVWPRVKADGHAAEVKTALDEARAARPA

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.47
Rhizosphere 93.03
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0275460 3300048917 Bacteria 1483
2 rootH2_10111045 3300003320 Bacteria 1438
3 Ga0068869_100171557 3300005334 Bacteria 1695
4 Ga0068869_100774904 3300005334 Bacteria 823
5 Ga0068869_101252308 3300005334 Bacteria 653
6 Ga0070666_10221371 3300005335 Bacteria 1335
7 Ga0068868_100670451 3300005338 Bacteria 925
8 Ga0068868_100889521 3300005338 Bacteria 809
9 Ga0070691_10003510 3300005341 Bacteria 7069
10 Ga0070691_10677907 3300005341 Bacteria 617
11 Ga0070668_100504301 3300005347 Bacteria 1048
12 Ga0070669_100362411 3300005353 Bacteria 1179
13 Ga0070675_100984706 3300005354 Bacteria 774
14 Ga0070674_101586875 3300005356 Bacteria 590
15 Ga0070713_101128460 3300005436 Bacteria 758
16 Ga0070711_100557658 3300005439 Unclassified 951
17 Ga0070705_100202173 3300005440 Bacteria 1363
18 Ga0070700_100446753 3300005441 Bacteria 983
19 Ga0070708_100002258 3300005445 Bacteria 14897
20 Ga0070708_100025604 3300005445 Bacteria 5044
21 Ga0070708_100037693 3300005445 Bacteria 4220
22 Ga0070678_100088914 3300005456 Bacteria 2363
23 Ga0070681_10435539 3300005458 Bacteria 1223
24 Ga0068867_101662954 3300005459 Bacteria 598
25 Ga0070706_100063872 3300005467 Bacteria 3403
26 Ga0070706_100461349 3300005467 Bacteria 1182
27 Ga0070707_100293900 3300005468 Bacteria 1579
28 Ga0070707_100344404 3300005468 Bacteria 1448
29 Ga0070698_100741490 3300005471 Bacteria 925
30 Ga0070699_100157794 3300005518 Bacteria 2008
31 Ga0070697_100023413 3300005536 Bacteria 4911
32 Ga0070697_100089198 3300005536 Bacteria 2547
33 Ga0070697_100165894 3300005536 Bacteria 1867
34 Ga0070696_100257686 3300005546 Bacteria 1321
35 Ga0070696_100590783 3300005546 Bacteria 894
36 Ga0068854_100745822 3300005578 Bacteria 849
37 Ga0068856_100171455 3300005614 Bacteria 2182
38 Ga0070702_100342396 3300005615 Bacteria 1050
39 Ga0068864_100030926 3300005618 Bacteria 4540
40 Ga0068864_101116184 3300005618 Bacteria 785
41 Ga0070716_100593258 3300006173 Bacteria 832
42 Ga0070712_100072890 3300006175 Bacteria 2461
43 Ga0097621_100278791 3300006237 Bacteria 1471
44 Ga0075428_100001046 3300006844 Bacteria 29389
45 Ga0075430_100615630 3300006846 Bacteria 896
46 Ga0075433_10048319 3300006852 Bacteria 3700
47 Ga0075433_10194835 3300006852 Bacteria 1802
48 Ga0075433_10862464 3300006852 Bacteria 790
49 Ga0075429_100252604 3300006880 Bacteria 1544
50 Ga0068865_100302422 3300006881 Bacteria 1281
51 Ga0075436_100270787 3300006914 Bacteria 1213
52 Ga0075436_100670923 3300006914 Bacteria 767
53 Ga0075435_100469752 3300007076 Bacteria 1086
54 Ga0111539_10196091 3300009094 Bacteria 2355
55 Ga0111539_10265610 3300009094 Bacteria 1997
56 Ga0105245_10160942 3300009098 Unclassified 2130
57 Ga0114129_10001961 3300009147 Bacteria 28152
58 Ga0114129_10558494 3300009147 Bacteria 1488
59 Ga0114129_11861121 3300009147 Bacteria 731
60 Ga0105243_10151662 3300009148 Bacteria 1989
61 Ga0105243_10430882 3300009148 Bacteria 1233
62 Ga0105243_10525623 3300009148 Bacteria 1126
63 Ga0105241_10000115 3300009174 Bacteria 57755
64 Ga0105237_10000033 3300009545 Bacteria 191935
65 Ga0105239_11004256 3300010375 Bacteria 959
66 Ga0105246_10016330 3300011119 Bacteria 4700
67 Ga0157373_10325439 3300013100 Bacteria 1094
68 Ga0157378_10211863 3300013297 Bacteria 1838
69 Ga0163162_10890346 3300013306 Bacteria 1004
70 Ga0157375_11370349 3300013308 Bacteria 833
71 Ga0163163_10074110 3300014325 Bacteria 3395
72 Ga0163163_10159696 3300014325 Bacteria 2299
73 Ga0163163_11735082 3300014325 Bacteria 685
74 Ga0157379_10546828 3300014968 Bacteria 1077
75 Ga0163161_10192580 3300017792 Bacteria 1568
76 Ga0207653_10226637 3300025885 Bacteria 711
77 Ga0207680_10226398 3300025903 Bacteria 1284
78 Ga0207684_10066855 3300025910 Bacteria 3053
79 Ga0207684_10365046 3300025910 Bacteria 1242
80 Ga0207654_10000253 3300025911 Bacteria 32393
81 Ga0207707_10717031 3300025912 Bacteria 839
82 Ga0207671_10000006 3300025914 Bacteria 836809
83 Ga0207693_10246233 3300025915 Bacteria 1403
84 Ga0207663_10536500 3300025916 Unclassified 913
85 Ga0207646_10057629 3300025922 Bacteria 3471
86 Ga0207646_10451338 3300025922 Bacteria 1160
87 Ga0207687_10022321 3300025927 Bacteria 4210
88 Ga0207644_10776934 3300025931 Bacteria 801
89 Ga0207709_10143766 3300025935 Bacteria 1643
90 Ga0207669_11159866 3300025937 Bacteria 654
91 Ga0207691_11042132 3300025940 Bacteria 682
92 Ga0207689_10590026 3300025942 Bacteria 934
93 Ga0207651_11297138 3300025960 Bacteria 655
94 Ga0207712_10385356 3300025961 Bacteria 1174
95 Ga0207668_10336485 3300025972 Bacteria 1258
96 Ga0207703_10348634 3300026035 Bacteria 1362
97 Ga0207702_10590169 3300026078 Bacteria 1089
98 Ga0207641_10380833 3300026088 Bacteria 1351
99 Ga0207648_10297658 3300026089 Bacteria 1446
100 Ga0207676_10412951 3300026095 Bacteria 1264
101 Ga0207675_101366721 3300026118 Bacteria 729
102 Ga0209998_10020154 3300027717 Bacteria 1425
103 Ga0207428_10343432 3300027907 Bacteria 1099
104 Ga0268264_10069909 3300028381 Bacteria 2970
105 Ga0268264_10512773 3300028381 Bacteria 1171
106 Ga0265338_10187616 3300028800 Bacteria 1570
107 Ga0265330_10115428 3300031235 Bacteria 1145
108 Ga0265332_10174196 3300031238 Bacteria 897
109 Ga0265339_10529742 3300031249 Eukaryota 543
110 Ga0265327_10047457 3300031251 Bacteria 2266
111 Ga0307408_100878643 3300031548 Bacteria 819
112 Ga0307408_101513187 3300031548 Bacteria 635
113 Ga0265314_10017474 3300031711 Bacteria 5630
114 Ga0265314_10455707 3300031711 Bacteria 680
115 Ga0265342_10057502 3300031712 Bacteria 2302
116 Ga0307405_11355156 3300031731 Bacteria 621
117 Ga0307413_10230286 3300031824 Bacteria 1360
118 Ga0307410_10247559 3300031852 Bacteria 1384
119 Ga0307410_10610618 3300031852 Bacteria 911
120 Ga0307406_10314348 3300031901 Bacteria 1209
121 Ga0307406_10529290 3300031901 Bacteria 961
122 Ga0307407_10007900 3300031903 Bacteria 4849
123 Ga0307412_10753160 3300031911 Bacteria 841
124 Ga0307409_100682573 3300031995 Bacteria 1024
125 Ga0307416_100630059 3300032002 Bacteria 1155
126 Ga0307414_10491861 3300032004 Bacteria 1084
127 Ga0307415_100103521 3300032126 Bacteria 2095
128 Ga0307415_100347915 3300032126 Bacteria 1246
129 Ga0373936_0245251 3300035113 Bacteria 799
130 Ga0373946_0099220 3300035171 Bacteria 1303
131 Ga0373962_0002706 3300035242 Bacteria 4217
132 Ga0395905_0055266 3300037471 Bacteria 3716
133 Ga0395901_0115474 3300038443 Bacteria 2820
134 Ga0451807_0137919 3300041486 Bacteria 894
135 Ga0451853_3785232 3300041512 Bacteria 522
136 Ga0451577_0127991 3300042876 Bacteria 2277
137 Ga0451577_0181276 3300042876 Bacteria 1899
138 Ga0451577_0215509 3300042876 Bacteria 1735
139 Ga0451577_0219193 3300042876 Bacteria 1720
140 Ga0451577_0289332 3300042876 Bacteria 1485
141 Ga0466964_0296092 3300044706 Bacteria 814
142 Ga0453684_1572626 3300044712 Bacteria 676
143 Ga0451576_0201703 3300045051 Bacteria 2077
144 Ga0451576_1212451 3300045051 Bacteria 788
145 Ga0451576_1427469 3300045051 Bacteria 720
146 Ga0466967_0577459 3300045976 Bacteria 1108
147 Ga0495592_0182994 3300046454 Bacteria 1426
148 Ga0495629_0772543 3300046459 Unclassified 635
149 Ga0495651_0561896 3300046462 Bacteria 724
150 Ga0495652_0617600 3300046529 Bacteria 738
151 Ga0495586_0013577 3300046535 Bacteria 4320
152 Ga0495674_0113959 3300047319 Bacteria 2290
153 Ga0495680_0201404 3300047322 Bacteria 1428
154 Ga0495602_0221064 3300048088 Bacteria 1430
155 Ga0496100_1143036 3300048903 Bacteria 614
156 Ga0496101_0012884 3300048904 Bacteria 5593
157 Ga0496102_1400962 3300048905 Bacteria 618
158 Ga0496104_0962734 3300048907 Bacteria 758
159 Ga0496106_0040675 3300048909 Bacteria 3482
160 Ga0496106_0921570 3300048909 Bacteria 689
161 Ga0496109_1215194 3300048912 Bacteria 690
162 Ga0496115_0002072 3300048918 Bacteria 14357
163 Ga0496115_0112486 3300048918 Bacteria 2237
164 Ga0501032_0256222 3300049569 Bacteria 1135
165 Ga0501034_0312967 3300049571 Bacteria 1504
166 Ga0501034_0749528 3300049571 Bacteria 872
167 Ga0501034_1224265 3300049571 Unclassified 629
168 Ga0501036_0274689 3300049572 Bacteria 1411
169 Ga0501038_0204092 3300049574 Bacteria 1585
170 Ga0501038_0324919 3300049574 Bacteria 1203
171 Ga0501038_0698129 3300049574 Bacteria 760
172 Ga0501039_0388077 3300049575 Bacteria 1097
173 Ga0501039_0416854 3300049575 Bacteria 1055
174 Ga0501040_0421254 3300049576 Bacteria 960
175 Ga0501041_0714498 3300049577 Bacteria 641
176 Ga0501042_0780027 3300049578 Bacteria 695
177 Ga0501043_0043892 3300049579 Bacteria 3515
178 Ga0501047_0015475 3300049581 Bacteria 7269
179 Ga0501048_0234963 3300049582 Bacteria 1301
180 Ga0501068_0171850 3300049584 Bacteria 1368
181 Ga0501071_0174946 3300049587 Bacteria 1608
182 Ga0501080_0145139 3300049742 Bacteria 2194
183 Ga0501081_0133843 3300049743 Bacteria 1773
184 Ga0501081_0616578 3300049743 Bacteria 813
185 Ga0501081_0927884 3300049743 Bacteria 657
186 Ga0501083_0967456 3300049744 Bacteria 554
187 Ga0501035_0003770 3300049822 Bacteria 14445
188 Ga0501044_0001835 3300049823 Bacteria 24736
189 nmdc:mga05p37_41_c1 3300050507 Bacteria 108003
190 nmdc:mga05p37_492849_c1 3300050507 Bacteria 1408
191 nmdc:mga0qj67_543311_c1 3300050509 Bacteria 932
192 nmdc:mga08y16_233012_c1 3300050511 Bacteria 1904
193 nmdc:mga0n895_343039_c1 3300050512 Bacteria 1513
194 nmdc:mga0n895_833092_c1 3300050512 Bacteria 911
195 nmdc:mga0rr50_76311_c1 3300050513 Bacteria 2572
196 nmdc:mga08x19_779610_c1 3300050514 Bacteria 679
197 nmdc:mga0a205_123789_c1 3300050515 Bacteria 2486
198 nmdc:mga0a205_264375_c1 3300050515 Bacteria 1598
199 Ga0495601_0530465 3300053077 Unclassified 758
200 Ga0495601_0857727 3300053077 Bacteria 575
201 2687236462 2684623219 Bacteria 8442773
202 Ga0496114_0275460
203 rootH2_10111045
204 Ga0068869_100171557
205 Ga0068869_100774904
206 Ga0068869_101252308
207 Ga0070666_10221371
208 Ga0068868_100670451
209 Ga0068868_100889521
210 Ga0070691_10003510
211 Ga0070691_10677907
212 Ga0070668_100504301
213 Ga0070669_100362411
214 Ga0070675_100984706
215 Ga0070674_101586875
216 Ga0070713_101128460
217 Ga0070711_100557658
218 Ga0070705_100202173
219 Ga0070700_100446753
220 Ga0070708_100002258
221 Ga0070708_100025604
222 Ga0070708_100037693
223 Ga0070678_100088914
224 Ga0070681_10435539
225 Ga0068867_101662954
226 Ga0070706_100063872
227 Ga0070706_100461349
228 Ga0070707_100293900
229 Ga0070707_100344404
230 Ga0070698_100741490
231 Ga0070699_100157794
232 Ga0070697_100023413
233 Ga0070697_100089198
234 Ga0070697_100165894
235 Ga0070696_100257686
236 Ga0070696_100590783
237 Ga0068854_100745822
238 Ga0068856_100171455
239 Ga0070702_100342396
240 Ga0068864_100030926
241 Ga0068864_101116184
242 Ga0070716_100593258
243 Ga0070712_100072890
244 Ga0097621_100278791
245 Ga0075428_100001046
246 Ga0075430_100615630
247 Ga0075433_10048319
248 Ga0075433_10194835
249 Ga0075433_10862464
250 Ga0075429_100252604
251 Ga0068865_100302422
252 Ga0075436_100270787
253 Ga0075436_100670923
254 Ga0075435_100469752
255 Ga0111539_10196091
256 Ga0111539_10265610
257 Ga0105245_10160942
258 Ga0114129_10001961
259 Ga0114129_10558494
260 Ga0114129_11861121
261 Ga0105243_10151662
262 Ga0105243_10430882
263 Ga0105243_10525623
264 Ga0105241_10000115
265 Ga0105237_10000033
266 Ga0105239_11004256
267 Ga0105246_10016330
268 Ga0157373_10325439
269 Ga0157378_10211863
270 Ga0163162_10890346
271 Ga0157375_11370349
272 Ga0163163_10074110
273 Ga0163163_10159696
274 Ga0163163_11735082
275 Ga0157379_10546828
276 Ga0163161_10192580
277 Ga0207653_10226637
278 Ga0207680_10226398
279 Ga0207684_10066855
280 Ga0207684_10365046
281 Ga0207654_10000253
282 Ga0207707_10717031
283 Ga0207671_10000006
284 Ga0207693_10246233
285 Ga0207663_10536500
286 Ga0207646_10057629
287 Ga0207646_10451338
288 Ga0207687_10022321
289 Ga0207644_10776934
290 Ga0207709_10143766
291 Ga0207669_11159866
292 Ga0207691_11042132
293 Ga0207689_10590026
294 Ga0207651_11297138
295 Ga0207712_10385356
296 Ga0207668_10336485
297 Ga0207703_10348634
298 Ga0207702_10590169
299 Ga0207641_10380833
300 Ga0207648_10297658
301 Ga0207676_10412951
302 Ga0207675_101366721
303 Ga0209998_10020154
304 Ga0207428_10343432
305 Ga0268264_10069909
306 Ga0268264_10512773
307 Ga0265338_10187616
308 Ga0265330_10115428
309 Ga0265332_10174196
310 Ga0265339_10529742
311 Ga0265327_10047457
312 Ga0307408_100878643
313 Ga0307408_101513187
314 Ga0265314_10017474
315 Ga0265314_10455707
316 Ga0265342_10057502
317 Ga0307405_11355156
318 Ga0307413_10230286
319 Ga0307410_10247559
320 Ga0307410_10610618
321 Ga0307406_10314348
322 Ga0307406_10529290
323 Ga0307407_10007900
324 Ga0307412_10753160
325 Ga0307409_100682573
326 Ga0307416_100630059
327 Ga0307414_10491861
328 Ga0307415_100103521
329 Ga0307415_100347915
330 Ga0373936_0245251
331 Ga0373946_0099220
332 Ga0373962_0002706
333 Ga0395905_0055266
334 Ga0395901_0115474
335 Ga0451807_0137919
336 Ga0451853_3785232
337 Ga0451577_0127991
338 Ga0451577_0181276
339 Ga0451577_0215509
340 Ga0451577_0219193
341 Ga0451577_0289332
342 Ga0466964_0296092
343 Ga0453684_1572626
344 Ga0451576_0201703
345 Ga0451576_1212451
346 Ga0451576_1427469
347 Ga0466967_0577459
348 Ga0495592_0182994
349 Ga0495629_0772543
350 Ga0495651_0561896
351 Ga0495652_0617600
352 Ga0495586_0013577
353 Ga0495674_0113959
354 Ga0495680_0201404
355 Ga0495602_0221064
356 Ga0496100_1143036
357 Ga0496101_0012884
358 Ga0496102_1400962
359 Ga0496104_0962734
360 Ga0496106_0040675
361 Ga0496106_0921570
362 Ga0496109_1215194
363 Ga0496115_0002072
364 Ga0496115_0112486
365 Ga0501032_0256222
366 Ga0501034_0312967
367 Ga0501034_0749528
368 Ga0501034_1224265
369 Ga0501036_0274689
370 Ga0501038_0204092
371 Ga0501038_0324919
372 Ga0501038_0698129
373 Ga0501039_0388077
374 Ga0501039_0416854
375 Ga0501040_0421254
376 Ga0501041_0714498
377 Ga0501042_0780027
378 Ga0501043_0043892
379 Ga0501047_0015475
380 Ga0501048_0234963
381 Ga0501068_0171850
382 Ga0501071_0174946
383 Ga0501080_0145139
384 Ga0501081_0133843
385 Ga0501081_0616578
386 Ga0501081_0927884
387 Ga0501083_0967456
388 Ga0501035_0003770
389 Ga0501044_0001835
390 nmdc:mga05p37_41_c1
391 nmdc:mga05p37_492849_c1
392 nmdc:mga0qj67_543311_c1
393 nmdc:mga08y16_233012_c1
394 nmdc:mga0n895_343039_c1
395 nmdc:mga0n895_833092_c1
396 nmdc:mga0rr50_76311_c1
397 nmdc:mga08x19_779610_c1
398 nmdc:mga0a205_123789_c1
399 nmdc:mga0a205_264375_c1
400 Ga0495601_0530465
401 Ga0495601_0857727
402 2687236462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

15

144

0.98

PF08534

Redoxin

Redoxin

14

161

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.963 13 155
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9605 13 156
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9601 13 156
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9409 2 154
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.9373 5 156
ID Description Score Start End Superfamily
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9768 5 153 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9664 6 155 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9639 5 152 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.963 13 155 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9578 5 153 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A432TGI5-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9884 7 93 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-X5DNZ6-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9878 3 152 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2U8FE03-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9872 2 156 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A376CKT9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9862 3 150 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A1Y5N691-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9841 5 153 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map