F308661

General Info

Members Datasets Scaffolds Average Seq Length
201 152 191 162

Family's Representative Sequence

Representative Sequence 3300031249|Ga0265339_10239307|Ga0265339_102393072
Length 191
Sequence VTDRRETREPIRVCFVCLGNICRSPTAEAIMRHLLAEEAEEGRRPEQDDEATGARAIPIEVESAGTGDWHVGEPRDRRSRAAGERRGIPLSGRARQFTATDFARFHHVVAMDRKNLADLEAMAPDAAARAKLSLLRAHTPEGELDVPDPYDGGEEGFDRVFDICLTACRALLARLRRGPASAIGPDPAPPP

Samples

Sample ID Description Type Environment
1 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
2 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
3 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
4 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
5 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
6 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
7 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
8 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
51 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
52 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
67 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
81 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
82 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
83 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
94 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
112 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
130 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
131 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
132 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
133 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
134 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
144 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
145 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
146 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
147 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
148 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
152 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 0.5
Isolates 4.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.45
Nodule 0.5
Rhizoplane 2.49
Rhizosphere 83.08
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10010585 3300002067 Bacteria 2939
2 JGI25406J46586_10126645 3300003203 Bacteria 750
3 Ga0006562J51391_1201760 3300003578 Bacteria 2110
4 Ga0055529_1011871 3300003763 Bacteria 1119
5 Ga0070658_10003946 3300005327 Bacteria 12162
6 Ga0070660_100028701 3300005339 Bacteria 4164
7 Ga0070660_100182846 3300005339 Bacteria 1697
8 Ga0070714_102050645 3300005435 Bacteria 558
9 Ga0070713_100461135 3300005436 Bacteria 1195
10 Ga0070681_10026754 3300005458 Bacteria 5800
11 Ga0070697_100014775 3300005536 Bacteria 6127
12 Ga0070696_100063864 3300005546 Bacteria 2580
13 Ga0068855_100156312 3300005563 Bacteria 2590
14 Ga0068855_100353805 3300005563 Bacteria 1617
15 Ga0068857_100173821 3300005577 Bacteria 1959
16 Ga0068854_100558209 3300005578 Bacteria 972
17 Ga0068852_100006551 3300005616 Bacteria 8426
18 Ga0081538_10041676 3300005981 Bacteria 2909
19 Ga0081539_10000556 3300005985 Bacteria 77121
20 Ga0075364_10345432 3300006051 Bacteria 1014
21 Ga0075367_10174354 3300006178 Bacteria 1340
22 Ga0075428_100812300 3300006844 Bacteria 994
23 Ga0075431_100573378 3300006847 Bacteria 1114
24 Ga0105240_10009785 3300009093 Bacteria 13536
25 Ga0105237_10000205 3300009545 Bacteria 84204
26 Ga0105238_10031291 3300009551 Bacteria 5416
27 Ga0105238_11606888 3300009551 Bacteria 680
28 Ga0105239_10251605 3300010375 Bacteria 1985
29 Ga0157373_10000442 3300013100 Bacteria 32910
30 Ga0157374_10282541 3300013296 Bacteria 1639
31 Ga0157380_11978638 3300014326 Bacteria 644
32 Ga0213875_10000855 3300021388 Bacteria 22512
33 Ga0209148_1000579 3300025254 Bacteria 33716
34 Ga0209455_1000804 3300025272 Bacteria 17250
35 Ga0207647_10045315 3300025904 Bacteria 2744
36 Ga0207705_10011874 3300025909 Bacteria 6294
37 Ga0207705_10081775 3300025909 Bacteria 2354
38 Ga0207707_10054147 3300025912 Bacteria 3493
39 Ga0207695_10014915 3300025913 Bacteria 9173
40 Ga0207671_10000224 3300025914 Bacteria 84986
41 Ga0207693_10218860 3300025915 Bacteria 1496
42 Ga0207652_10036271 3300025921 Bacteria 4168
43 Ga0207694_10121880 3300025924 Bacteria 2082
44 Ga0207674_10263606 3300026116 Bacteria 1670
45 Ga0207698_10004687 3300026142 Bacteria 8360
46 Ga0265334_10040003 3300028573 Bacteria 1838
47 Ga0265318_10000396 3300028577 Bacteria 34105
48 Ga0265318_10037688 3300028577 Bacteria 1851
49 Ga0265322_10052082 3300028654 Bacteria 1161
50 Ga0265338_10039130 3300028800 Bacteria 4480
51 Ga0265338_10139216 3300028800 Bacteria 1903
52 Ga0265330_10000271 3300031235 Bacteria 38160
53 Ga0265330_10004988 3300031235 Bacteria 6672
54 Ga0265330_10028439 3300031235 Bacteria 2519
55 Ga0265332_10000909 3300031238 Bacteria 17757
56 Ga0265332_10022364 3300031238 Bacteria 2791
57 Ga0265328_10000827 3300031239 Bacteria 14309
58 Ga0265328_10003648 3300031239 Bacteria 6784
59 Ga0265320_10002739 3300031240 Bacteria 12189
60 Ga0265320_10003526 3300031240 Bacteria 10475
61 Ga0265320_10004074 3300031240 Bacteria 9600
62 Ga0265329_10000602 3300031242 Bacteria 18508
63 Ga0265329_10005707 3300031242 Bacteria 5002
64 Ga0265340_10209898 3300031247 Bacteria 874
65 Ga0265339_10007059 3300031249 Bacteria 7293
66 Ga0265339_10008005 3300031249 Bacteria 6775
67 Ga0265339_10239307 3300031249 Bacteria 882
68 Ga0265331_10001472 3300031250 Bacteria 17338
69 Ga0265331_10050360 3300031250 Bacteria 1997
70 Ga0265316_10000029 3300031344 Bacteria 164218
71 Ga0265316_10010804 3300031344 Bacteria 8295
72 Ga0265316_10036690 3300031344 Bacteria 3962
73 Ga0265316_10060968 3300031344 Bacteria 2931
74 Ga0265313_10023296 3300031595 Bacteria 3338
75 Ga0265313_10112209 3300031595 Bacteria 1197
76 Ga0265314_10001335 3300031711 Bacteria 27972
77 Ga0265314_10002250 3300031711 Bacteria 19988
78 Ga0265314_10003085 3300031711 Bacteria 16415
79 Ga0265314_10014207 3300031711 Bacteria 6385
80 Ga0265314_10047093 3300031711 Bacteria 3037
81 Ga0265342_10000980 3300031712 Bacteria 28257
82 Ga0265342_10001318 3300031712 Bacteria 23274
83 Ga0265342_10002528 3300031712 Bacteria 15752
84 Ga0265342_10010034 3300031712 Bacteria 6608
85 Ga0373934_0004505 3300035086 Bacteria 5148
86 Ga0373953_0000068 3300035117 Bacteria 25605
87 Ga0373956_0000758 3300035119 Bacteria 13358
88 Ga0373956_0126931 3300035119 Bacteria 1193
89 Ga0373957_0170899 3300035120 Bacteria 898
90 Ga0373955_0000141 3300035172 Bacteria 28366
91 Ga0373955_0113664 3300035172 Bacteria 1567
92 Ga0373924_0000209 3300035410 Bacteria 17849
93 Ga0373933_0000040 3300035724 Bacteria 79834
94 Ga0373933_0000439 3300035724 Bacteria 26018
95 Ga0373937_0000034 3300036401 Bacteria 116552
96 Ga0373937_0017942 3300036401 Bacteria 6313
97 Ga0373925_1782962 3300037068 Bacteria 502
98 Ga0395899_0423166 3300037312 Bacteria 877
99 Ga0395898_0010354 3300037466 Bacteria 9753
100 Ga0395905_0356288 3300037471 Bacteria 1356
101 Ga0436364_0047432 3300037853 Bacteria 88437
102 Ga0395901_0017972 3300038443 Bacteria 7217
103 Ga0439439_0142824 3300041406 Bacteria 677
104 Ga0451789_0519630 3300041443 Bacteria 702
105 Ga0451802_0760784 3300041460 Bacteria 763
106 Ga0451806_186007 3300041462 Bacteria 989
107 Ga0466961_0591764 3300044693 Bacteria 667
108 Ga0466968_0158602 3300044735 Bacteria 1043
109 Ga0495592_0000500 3300046454 Bacteria 28524
110 Ga0495651_0000005 3300046462 Bacteria 173396
111 Ga0495653_0012959 3300046463 Bacteria 6802
112 Ga0495608_0000464 3300046511 Bacteria 28326
113 Ga0495628_0000930 3300046516 Bacteria 26870
114 Ga0495630_0238605 3300046517 Bacteria 1389
115 Ga0495652_0001259 3300046529 Bacteria 28353
116 Ga0495652_0819578 3300046529 Bacteria 618
117 Ga0495587_0000030 3300046536 Bacteria 135844
118 Ga0495609_0039811 3300046538 Bacteria 2115
119 Ga0495645_0188205 3300046543 Bacteria 1409
120 Ga0495667_0001129 3300046559 Bacteria 17370
121 Ga0495657_0000018 3300046675 Bacteria 173397
122 Ga0495599_0000325 3300046678 Bacteria 28377
123 Ga0495623_0000381 3300046679 Bacteria 29058
124 Ga0495646_0033504 3300046680 Bacteria 3193
125 Ga0495600_0012593 3300046809 Bacteria 5294
126 Ga0495604_0000083 3300047317 Bacteria 82509
127 Ga0495674_0040341 3300047319 Bacteria 4176
128 Ga0495676_0126716 3300047321 Bacteria 1849
129 Ga0495680_0001196 3300047322 Bacteria 28462
130 Ga0495675_0000459 3300047444 Bacteria 26886
131 Ga0495685_019637 3300047447 Bacteria 2322
132 Ga0495602_0000921 3300048088 Bacteria 28383
133 Ga0496112_0328732 3300048915 Bacteria 1473
134 Ga0496114_1174580 3300048917 Bacteria 653
135 Ga0496119_0039902 3300048922 Bacteria 3012
136 Ga0496120_0038638 3300048923 Bacteria 2822
137 Ga0501032_0083594 3300049569 Bacteria 2123
138 Ga0501033_0002140 3300049570 Bacteria 17092
139 Ga0501033_0063941 3300049570 Bacteria 2708
140 Ga0501034_0015568 3300049571 Bacteria 7811
141 Ga0501034_0026026 3300049571 Bacteria 5959
142 Ga0501036_0004186 3300049572 Bacteria 11621
143 Ga0501038_0010423 3300049574 Bacteria 8500
144 Ga0501039_0119453 3300049575 Bacteria 2065
145 Ga0501042_0280506 3300049578 Bacteria 1203
146 Ga0501043_0058903 3300049579 Bacteria 3014
147 Ga0501043_0382750 3300049579 Bacteria 1065
148 Ga0501046_0000009 3300049580 Bacteria 335813
149 Ga0501046_0064484 3300049580 Bacteria 2860
150 Ga0501047_0079063 3300049581 Bacteria 3162
151 Ga0501047_0281398 3300049581 Bacteria 1508
152 Ga0501048_0299783 3300049582 Bacteria 1143
153 Ga0501048_0914338 3300049582 Bacteria 631
154 Ga0501069_0073265 3300049585 Bacteria 1920
155 Ga0501069_0126258 3300049585 Bacteria 1463
156 Ga0501070_0034923 3300049586 Bacteria 4202
157 Ga0501071_0480160 3300049587 Bacteria 952
158 Ga0501073_0123423 3300049589 Bacteria 1795
159 Ga0501076_1183064 3300049592 Bacteria 629
160 Ga0501216_004724 3300049660 Bacteria 2028
161 Ga0501227_000491 3300049665 Bacteria 8431
162 Ga0501233_016307 3300049668 Bacteria 1539
163 Ga0501236_022393 3300049670 Bacteria 944
164 Ga0501225_0003456 3300049705 Bacteria 4776
165 Ga0501234_069436 3300049707 Bacteria 607
166 Ga0501035_0006806 3300049822 Bacteria 10680
167 Ga0501035_0088478 3300049822 Bacteria 2729
168 Ga0501045_0057222 3300049824 Bacteria 2853
169 Ga0501045_0182475 3300049824 Bacteria 1564
170 Ga0501212_039587 3300049851 Bacteria 777
171 nmdc:mga00v17_290569_c1 3300050491 Bacteria 1061
172 nmdc:mga06z11_152643_c1 3300050494 Bacteria 1314
173 nmdc:mga06r32_3557_c1 3300050510 Bacteria 13919
174 Ga0495612_0093851 3300053078 Bacteria 1273
175 Ga0495595_0000490 3300053084 Bacteria 15092
176 Ga0500650_0026343 3300053098 Bacteria 2608
177 Ga0500556_0000008 3300053104 Bacteria 304943
178 Ga0500559_0001023 3300053136 Bacteria 17163
179 Ga0500559_0002050 3300053136 Bacteria 10788
180 Ga0500568_0000003 3300053139 Bacteria 863587
181 Ga0500573_0010185 3300053140 Bacteria 5241
182 Ga0500573_0032544 3300053140 Bacteria 3009
183 Ga0500573_0063161 3300053140 Bacteria 2119
184 Ga0500573_0176277 3300053140 Bacteria 1152
185 Ga0500573_0179024 3300053140 Bacteria 1141
186 Ga0500577_0034408 3300053142 Bacteria 1799
187 Ga0500577_0067332 3300053142 Bacteria 1395
188 Ga0501084_0182148 3300054114 Bacteria 1773
189 Ga0501084_1293566 3300054114 Bacteria 611
190 Ga0501082_0026374 3300060353 Bacteria 5006
191 Ga0501082_1148880 3300060353 Bacteria 679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_100014775 Ga0070697_1000147754 123
2 iso_pu_bacteria 2808606384 2808972715 127
3 iso_pu_bacteria 2808606390 2809007697 127
4 iso_pu_bacteria 2808606391 2809014763 127
5 3300050510 nmdc:mga06r32_3557_c1 nmdc:mga06r32_3557_c1_10380_10844 128
6 3300028573 Ga0265334_10040003 Ga0265334_100400033 129
7 3300028577 Ga0265318_10000396 Ga0265318_1000039622 129
8 3300031235 Ga0265330_10000271 Ga0265330_1000027122 129
9 3300031238 Ga0265332_10000909 Ga0265332_100009098 129
10 3300031239 Ga0265328_10000827 Ga0265328_100008278 129
11 3300031240 Ga0265320_10002739 Ga0265320_100027399 129
12 3300031242 Ga0265329_10000602 Ga0265329_100006028 129
13 3300031250 Ga0265331_10001472 Ga0265331_100014725 129
14 3300031344 Ga0265316_10000029 Ga0265316_1000002922 129
15 3300031711 Ga0265314_10002250 Ga0265314_100022508 129
16 3300028800 Ga0265338_10039130 Ga0265338_100391305 130
17 3300028800 Ga0265338_10139216 Ga0265338_101392162 130
18 3300031238 Ga0265332_10022364 Ga0265332_100223642 130
19 3300031239 Ga0265328_10003648 Ga0265328_100036482 130
20 3300031240 Ga0265320_10003526 Ga0265320_100035267 130
21 3300031240 Ga0265320_10004074 Ga0265320_100040747 130
22 3300031249 Ga0265339_10007059 Ga0265339_100070593 130
23 3300031249 Ga0265339_10008005 Ga0265339_100080053 130
24 3300031711 Ga0265314_10001335 Ga0265314_1000133524 130
25 3300031711 Ga0265314_10047093 Ga0265314_100470932 130
26 3300031712 Ga0265342_10001318 Ga0265342_1000131810 130
27 3300031712 Ga0265342_10002528 Ga0265342_100025284 130
28 3300037068 Ga0373925_1782962 Ga0373925_1782962_47_472 130
29 3300005577 Ga0068857_100173821 Ga0068857_1001738212 131
30 3300025914 Ga0207671_10000224 Ga0207671_1000022471 131
31 3300026116 Ga0207674_10263606 Ga0207674_102636062 131
32 3300005435 Ga0070714_102050645 Ga0070714_1020506451 132
33 3300053104 Ga0500556_0000008 Ga0500556_0000008_298514_298957 137
34 3300053139 Ga0500568_0000003 Ga0500568_0000003_5977_6420 137
35 3300035117 Ga0373953_0000068 Ga0373953_0000068_20373_20834 138
36 3300035119 Ga0373956_0000758 Ga0373956_0000758_4754_5215 138
37 3300035172 Ga0373955_0000141 Ga0373955_0000141_23132_23593 138
38 3300035410 Ga0373924_0000209 Ga0373924_0000209_12643_13104 138
39 3300035724 Ga0373933_0000040 Ga0373933_0000040_1891_2352 138
40 3300036401 Ga0373937_0000034 Ga0373937_0000034_4757_5218 138
41 3300046454 Ga0495592_0000500 Ga0495592_0000500_4773_5234 138
42 3300046462 Ga0495651_0000005 Ga0495651_0000005_4773_5234 138
43 3300046463 Ga0495653_0012959 Ga0495653_0012959_1568_2029 138
44 3300046511 Ga0495608_0000464 Ga0495608_0000464_23100_23561 138
45 3300046516 Ga0495628_0000930 Ga0495628_0000930_3141_3602 138
46 3300046529 Ga0495652_0001259 Ga0495652_0001259_23119_23580 138
47 3300046529 Ga0495652_0819578 Ga0495652_0819578_69_530 138
48 3300046536 Ga0495587_0000030 Ga0495587_0000030_4774_5235 138
49 3300046543 Ga0495645_0188205 Ga0495645_0188205_467_928 138
50 3300046559 Ga0495667_0001129 Ga0495667_0001129_13200_13661 138
51 3300046675 Ga0495657_0000018 Ga0495657_0000018_4774_5235 138
52 3300046678 Ga0495599_0000325 Ga0495599_0000325_23143_23604 138
53 3300046679 Ga0495623_0000381 Ga0495623_0000381_4771_5232 138
54 3300046680 Ga0495646_0033504 Ga0495646_0033504_872_1333 138
55 3300046809 Ga0495600_0012593 Ga0495600_0012593_60_521 138
56 3300047317 Ga0495604_0000083 Ga0495604_0000083_77275_77736 138
57 3300047322 Ga0495680_0001196 Ga0495680_0001196_23229_23690 138
58 3300047444 Ga0495675_0000459 Ga0495675_0000459_4774_5235 138
59 3300048088 Ga0495602_0000921 Ga0495602_0000921_23150_23611 138
60 3300053084 Ga0495595_0000490 Ga0495595_0000490_12853_13314 138
61 3300044735 Ga0466968_0158602 Ga0466968_0158602_407_910 143
62 3300003203 JGI25406J46586_10126645 JGI25406J46586_101266452 144
63 3300005985 Ga0081539_10000556 Ga0081539_1000055682 144
64 3300049569 Ga0501032_0083594 Ga0501032_0083594_43_534 144
65 3300049570 Ga0501033_0063941 Ga0501033_0063941_950_1441 144
66 3300049571 Ga0501034_0015568 Ga0501034_0015568_4342_4833 144
67 3300049572 Ga0501036_0004186 Ga0501036_0004186_3548_4039 144
68 3300049574 Ga0501038_0010423 Ga0501038_0010423_4804_5295 144
69 3300049575 Ga0501039_0119453 Ga0501039_0119453_891_1382 144
70 3300049578 Ga0501042_0280506 Ga0501042_0280506_700_1191 144
71 3300049579 Ga0501043_0058903 Ga0501043_0058903_413_904 144
72 3300049580 Ga0501046_0064484 Ga0501046_0064484_1894_2385 144
73 3300049581 Ga0501047_0079063 Ga0501047_0079063_1443_1934 144
74 3300049582 Ga0501048_0299783 Ga0501048_0299783_70_561 144
75 3300049585 Ga0501069_0073265 Ga0501069_0073265_376_861 144
76 3300049589 Ga0501073_0123423 Ga0501073_0123423_182_673 144
77 3300049822 Ga0501035_0006806 Ga0501035_0006806_6126_6617 144
78 3300049824 Ga0501045_0057222 Ga0501045_0057222_325_816 144
79 3300005616 Ga0068852_100006551 Ga0068852_1000065519 145
80 3300026142 Ga0207698_10004687 Ga0207698_100046872 145
81 3300005981 Ga0081538_10041676 Ga0081538_100416764 146
82 3300006844 Ga0075428_100812300 Ga0075428_1008123002 146
83 3300006847 Ga0075431_100573378 Ga0075431_1005733782 146
84 3300049580 Ga0501046_0000009 Ga0501046_0000009_48250_48741 146
85 3300049581 Ga0501047_0281398 Ga0501047_0281398_322_813 146
86 3300053098 Ga0500650_0026343 Ga0500650_0026343_797_1318 146
87 3300049582 Ga0501048_0914338 Ga0501048_0914338_125_598 147
88 3300049586 Ga0501070_0034923 Ga0501070_0034923_393_950 147
89 3300049592 Ga0501076_1183064 Ga0501076_1183064_80_553 147
90 3300049824 Ga0501045_0182475 Ga0501045_0182475_205_678 147
91 3300054114 Ga0501084_0182148 Ga0501084_0182148_402_875 147
92 3300054114 Ga0501084_1293566 Ga0501084_1293566_30_497 147
93 3300060353 Ga0501082_0026374 Ga0501082_0026374_3294_3794 147
94 3300005436 Ga0070713_100461135 Ga0070713_1004611352 149
95 3300005546 Ga0070696_100063864 Ga0070696_1000638642 149
96 3300013296 Ga0157374_10282541 Ga0157374_102825412 149
97 3300048915 Ga0496112_0328732 Ga0496112_0328732_134_622 149
98 3300049660 Ga0501216_004724 Ga0501216_004724_101_571 149
99 3300049665 Ga0501227_000491 Ga0501227_000491_1766_2236 149
100 3300049668 Ga0501233_016307 Ga0501233_016307_387_857 149
101 3300049670 Ga0501236_022393 Ga0501236_022393_428_898 149
102 3300049705 Ga0501225_0003456 Ga0501225_0003456_3011_3481 149
103 3300049707 Ga0501234_069436 Ga0501234_069436_36_506 149
104 3300049851 Ga0501212_039587 Ga0501212_039587_275_745 149
105 iso_pu_bacteria 8048406513 8048411517 149
106 iso_pu_bacteria 8055301274 8055302047 149
107 3300003578 Ga0006562J51391_1201760 Ga0006562J51391_12017601 150
108 3300013100 Ga0157373_10000442 Ga0157373_1000044213 150
109 3300014326 Ga0157380_11978638 Ga0157380_119786382 150
110 3300035086 Ga0373934_0004505 Ga0373934_0004505_772_1251 150
111 3300035119 Ga0373956_0126931 Ga0373956_0126931_419_898 150
112 3300035120 Ga0373957_0170899 Ga0373957_0170899_282_761 150
113 3300035172 Ga0373955_0113664 Ga0373955_0113664_713_1192 150
114 3300035724 Ga0373933_0000439 Ga0373933_0000439_284_763 150
115 3300036401 Ga0373937_0017942 Ga0373937_0017942_4725_5204 150
116 3300046538 Ga0495609_0039811 Ga0495609_0039811_268_735 150
117 iso_pu_bacteria 2870622029 2870625384 150
118 iso_pu_bacteria 2939657138 2939660494 150
119 3300031249 Ga0265339_10239307 Ga0265339_102393072 151
120 3300031595 Ga0265313_10112209 Ga0265313_101122092 151
121 iso_pu_bacteria 2852643534 2852644026 151
122 iso_pu_bacteria 2857733635 2857735040 151
123 3300006178 Ga0075367_10174354 Ga0075367_101743542 152
124 3300021388 Ga0213875_10000855 Ga0213875_100008557 152
125 3300037312 Ga0395899_0423166 Ga0395899_0423166_361_852 152
126 3300037466 Ga0395898_0010354 Ga0395898_0010354_4487_4978 152
127 3300037471 Ga0395905_0356288 Ga0395905_0356288_756_1247 152
128 3300037853 Ga0436364_0047432 Ga0436364_0047432_7601_8140 152
129 3300038443 Ga0395901_0017972 Ga0395901_0017972_5361_5852 152
130 3300047447 Ga0495685_019637 Ga0495685_019637_799_1290 152
131 3300049570 Ga0501033_0002140 Ga0501033_0002140_6791_7282 152
132 3300049822 Ga0501035_0088478 Ga0501035_0088478_94_585 152
133 3300050494 nmdc:mga06z11_152643_c1 nmdc:mga06z11_152643_c1_756_1247 152
134 3300053140 Ga0500573_0063161 Ga0500573_0063161_802_1320 152
135 3300028577 Ga0265318_10037688 Ga0265318_100376882 153
136 3300028654 Ga0265322_10052082 Ga0265322_100520822 153
137 3300031235 Ga0265330_10004988 Ga0265330_100049883 153
138 3300031235 Ga0265330_10028439 Ga0265330_100284392 153
139 3300031242 Ga0265329_10005707 Ga0265329_100057074 153
140 3300031247 Ga0265340_10209898 Ga0265340_102098982 153
141 3300031250 Ga0265331_10050360 Ga0265331_100503602 153
142 3300031344 Ga0265316_10010804 Ga0265316_100108049 153
143 3300031344 Ga0265316_10036690 Ga0265316_100366904 153
144 3300031344 Ga0265316_10060968 Ga0265316_100609683 153
145 3300031711 Ga0265314_10003085 Ga0265314_100030858 153
146 3300031711 Ga0265314_10014207 Ga0265314_100142079 153
147 3300031712 Ga0265342_10000980 Ga0265342_100009804 153
148 3300031712 Ga0265342_10010034 Ga0265342_100100344 153
149 3300044693 Ga0466961_0591764 Ga0466961_0591764_139_621 153
150 3300048922 Ga0496119_0039902 Ga0496119_0039902_635_1162 153
151 3300048923 Ga0496120_0038638 Ga0496120_0038638_1837_2364 153
152 3300053140 Ga0500573_0010185 Ga0500573_0010185_2753_3307 153
153 3300053140 Ga0500573_0032544 Ga0500573_0032544_1093_1626 153
154 3300053140 Ga0500573_0176277 Ga0500573_0176277_295_816 153
155 3300053140 Ga0500573_0179024 Ga0500573_0179024_560_1096 153
156 3300053142 Ga0500577_0034408 Ga0500577_0034408_1067_1588 153
157 3300053142 Ga0500577_0067332 Ga0500577_0067332_192_713 153
158 3300005339 Ga0070660_100182846 Ga0070660_1001828462 154
159 3300005458 Ga0070681_10026754 Ga0070681_100267542 154
160 3300005563 Ga0068855_100353805 Ga0068855_1003538052 154
161 3300005578 Ga0068854_100558209 Ga0068854_1005582092 154
162 3300006051 Ga0075364_10345432 Ga0075364_103454322 154
163 3300009093 Ga0105240_10009785 Ga0105240_1000978510 154
164 3300009545 Ga0105237_10000205 Ga0105237_1000020510 154
165 3300009551 Ga0105238_10031291 Ga0105238_100312912 154
166 3300010375 Ga0105239_10251605 Ga0105239_102516052 154
167 3300025909 Ga0207705_10081775 Ga0207705_100817752 154
168 3300025912 Ga0207707_10054147 Ga0207707_100541474 154
169 3300025913 Ga0207695_10014915 Ga0207695_100149154 154
170 3300025921 Ga0207652_10036271 Ga0207652_100362713 154
171 3300025924 Ga0207694_10121880 Ga0207694_101218802 154
172 3300041406 Ga0439439_0142824 Ga0439439_0142824_80_604 154
173 3300041443 Ga0451789_0519630 Ga0451789_0519630_162_683 154
174 3300041460 Ga0451802_0760784 Ga0451802_0760784_12_536 154
175 3300041462 Ga0451806_186007 Ga0451806_186007_110_628 154
176 3300047321 Ga0495676_0126716 Ga0495676_0126716_896_1474 154
177 3300049571 Ga0501034_0026026 Ga0501034_0026026_2605_3129 154
178 3300049579 Ga0501043_0382750 Ga0501043_0382750_438_962 154
179 3300049585 Ga0501069_0126258 Ga0501069_0126258_532_1056 154
180 3300049587 Ga0501071_0480160 Ga0501071_0480160_395_919 154
181 3300050491 nmdc:mga00v17_290569_c1 nmdc:mga00v17_290569_c1_158_682 154
182 3300053136 Ga0500559_0001023 Ga0500559_0001023_10538_11062 154
183 3300053136 Ga0500559_0002050 Ga0500559_0002050_6165_6689 154
184 3300060353 Ga0501082_1148880 Ga0501082_1148880_130_654 154
185 3300031595 Ga0265313_10023296 Ga0265313_100232962 155
186 iso_pu_bacteria 2643221632 2644181859 155
187 3300025915 Ga0207693_10218860 Ga0207693_102188602 156
188 3300046517 Ga0495630_0238605 Ga0495630_0238605_449_1015 156
189 3300047319 Ga0495674_0040341 Ga0495674_0040341_3205_3771 156
190 3300053078 Ga0495612_0093851 Ga0495612_0093851_105_671 156
191 3300002067 JGI24735J21928_10010585 JGI24735J21928_100105853 157
192 3300003763 Ga0055529_1011871 Ga0055529_10118712 157
193 3300005327 Ga0070658_10003946 Ga0070658_1000394610 157
194 3300005339 Ga0070660_100028701 Ga0070660_1000287014 157
195 3300005563 Ga0068855_100156312 Ga0068855_1001563122 157
196 3300009551 Ga0105238_11606888 Ga0105238_116068881 157
197 3300025254 Ga0209148_1000579 Ga0209148_100057928 157
198 3300025272 Ga0209455_1000804 Ga0209455_10008048 157
199 3300025904 Ga0207647_10045315 Ga0207647_100453153 157
200 3300025909 Ga0207705_10011874 Ga0207705_100118744 157
201 3300048917 Ga0496114_1174580 Ga0496114_1174580_101_574 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

13

172

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lrq-assembly2.cif.gz_D crystal structure of a low molecular weight phosphotyrosine phosphatase from vibrio choleraeo395 0.9567 4 150
7cuy-assembly2.cif.gz_B crystal structure of primo-1 0.9474 3 150
6y2w-assembly1.cif.gz_A crystal structure of the single mutant i16k of low molecular weight protein tyrosine phosphatase (lmw-ptp) 0.9462 3 150
1c0e-assembly2.cif.gz_B active site s19a mutant of bovine heart phosphotyrosyl phosphatase 0.9459 2 152
5jnr-assembly1.cif.gz_A crystal structure of human low molecular weight protein tyrosine phosphatase (lmptp) type a 0.9441 2 150
ID Description Score Start End Superfamily
4lrqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9584 5 151 3.40.50.2300
af_P82890_1_152_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9545 2 150 3.40.50.2300
af_Q8ING6_1_159_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9435 5 155 3.40.50.2300
af_P82891_5_163_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9412 1 157 3.40.50.2300
af_P41893_1_155_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9409 1 150 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4Q3XQ65-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 1.005 4 93 GO:0004726
GO:0030946
GO:0140793
AF-A0A110B061-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9995 5 100 GO:0004726
GO:0030946
GO:0140793
AF-A0A3D4WBD3-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9993 4 94 GO:0004725
AF-A0A4Q3XU27-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9963 2 129 GO:0004726
GO:0030946
GO:0140793
AF-U2Y812-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9945 1 151 GO:0004726
GO:0030946
GO:0140793

Feature Viewer

pLDDT pTM Quality
94.92 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map