F308453

General Info

Members Datasets Scaffolds Average Seq Length
201 140 402 160

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10332380|Ga0105242_103323803
Length 178
Sequence MSCRLDDVLASRKLLGTIGDMLGRTYDAQVCSIARALEVVGERWSILIVRDALFAGSTRYGDFQRSLGIATNVLQDRLDGFVEAGIMRRHRFSERPELFEYVLTEKGRGRGPALIALTAWGDRWAAPDGPPIRYAHEDCGGSVTQEVVCDRCGRLDGDAPVVARPGPGMPADRAAAMG

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
67 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
72 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
73 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
74 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
75 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
124 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
131 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
132 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
133 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
134 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
135 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
136 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
137 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
138 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
139 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
140 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.52
Metatranscriptomes 0
Isolates 4.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.42
Nodule 0
Rhizoplane 6.47
Rhizosphere 69.15
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10332380 3300009176 Bacteria 1398
2 JGI24739J22299_10063883 3300001989 Bacteria 1158
3 rootH1_10066497 3300003316 Bacteria 4206
4 rootL2_10064119 3300003322 Bacteria 2915
5 Ga0070660_100622804 3300005339 Bacteria 903
6 Ga0070689_100759715 3300005340 Unclassified 850
7 Ga0070675_100423914 3300005354 Bacteria 1190
8 Ga0070671_100946503 3300005355 Bacteria 753
9 Ga0070674_100504837 3300005356 Bacteria 1008
10 Ga0070659_100491782 3300005366 Bacteria 1045
11 Ga0070703_10017465 3300005406 Bacteria 2066
12 Ga0070708_100034467 3300005445 Bacteria 4405
13 Ga0070708_100045028 3300005445 Bacteria 3885
14 Ga0070708_100232679 3300005445 Bacteria 1729
15 Ga0070708_100800914 3300005445 Bacteria 886
16 Ga0070706_100001320 3300005467 Bacteria 26379
17 Ga0070706_100272958 3300005467 Bacteria 1578
18 Ga0070706_101383084 3300005467 Bacteria 644
19 Ga0070707_100066917 3300005468 Bacteria 3454
20 Ga0070707_100503933 3300005468 Bacteria 1172
21 Ga0070707_101889189 3300005468 Bacteria 564
22 Ga0070698_100216702 3300005471 Bacteria 1848
23 Ga0070698_100255074 3300005471 Bacteria 1686
24 Ga0070699_100011511 3300005518 Bacteria 7637
25 Ga0070699_100060461 3300005518 Bacteria 3283
26 Ga0070699_100094800 3300005518 Bacteria 2613
27 Ga0070684_100191778 3300005535 Bacteria 1860
28 Ga0070697_100193594 3300005536 Bacteria 1726
29 Ga0070697_100476572 3300005536 Bacteria 1089
30 Ga0068857_100145404 3300005577 Bacteria 2145
31 Ga0068864_100387414 3300005618 Bacteria 1326
32 Ga0081455_10018934 3300005937 Bacteria 6529
33 Ga0081538_10018861 3300005981 Bacteria 5157
34 Ga0081539_10005998 3300005985 Bacteria 11943
35 Ga0075365_10017279 3300006038 Bacteria 4410
36 Ga0075365_10019088 3300006038 Bacteria 4225
37 Ga0075365_10297499 3300006038 Bacteria 1136
38 Ga0075368_10032046 3300006042 Bacteria 2040
39 Ga0075363_100050339 3300006048 Bacteria 2220
40 Ga0075363_100142243 3300006048 Bacteria 1351
41 Ga0075363_100304623 3300006048 Bacteria 925
42 Ga0075364_10030554 3300006051 Bacteria 3458
43 Ga0075364_10163822 3300006051 Bacteria 1502
44 Ga0075364_10168143 3300006051 Bacteria 1482
45 Ga0075364_10444526 3300006051 Bacteria 886
46 Ga0075364_10590578 3300006051 Bacteria 759
47 Ga0075367_10064622 3300006178 Bacteria 2189
48 Ga0075367_10179532 3300006178 Bacteria 1320
49 Ga0075431_100580195 3300006847 Bacteria 1107
50 Ga0075431_100628918 3300006847 Unclassified 1055
51 Ga0075436_100071595 3300006914 Bacteria 2397
52 Ga0075435_100500257 3300007076 Bacteria 1051
53 Ga0099794_10007373 3300007265 Bacteria 4515
54 Ga0099794_10058386 3300007265 Bacteria 1870
55 Ga0111539_10683227 3300009094 Bacteria 1195
56 Ga0105243_10748477 3300009148 Bacteria 958
57 Ga0105249_10153314 3300009553 Bacteria 2220
58 Ga0105246_10088285 3300011119 Bacteria 2227
59 Ga0105246_10340186 3300011119 Unclassified 1226
60 Ga0157370_10364390 3300013104 Bacteria 1332
61 Ga0157369_10383807 3300013105 Bacteria 1458
62 Ga0157369_10734836 3300013105 Bacteria 1016
63 Ga0157375_10084442 3300013308 Bacteria 3224
64 Ga0157375_10117127 3300013308 Bacteria 2769
65 Ga0157375_11115903 3300013308 Unclassified 924
66 Ga0157380_10013411 3300014326 Bacteria 5974
67 Ga0157376_11138082 3300014969 Bacteria 807
68 Ga0163161_10589666 3300017792 Bacteria 915
69 Ga0207688_10073955 3300025901 Bacteria 1937
70 Ga0207684_10000003 3300025910 Bacteria 766933
71 Ga0207684_10000196 3300025910 Bacteria 95378
72 Ga0207684_10000767 3300025910 Bacteria 37316
73 Ga0207684_10295419 3300025910 Bacteria 1397
74 Ga0207693_10409859 3300025915 Bacteria 1059
75 Ga0207646_10000260 3300025922 Bacteria 71868
76 Ga0207646_10002844 3300025922 Bacteria 20115
77 Ga0207646_10065930 3300025922 Bacteria 3232
78 Ga0207646_10154324 3300025922 Bacteria 2071
79 Ga0207646_10199505 3300025922 Bacteria 1807
80 Ga0207659_10393842 3300025926 Bacteria 1157
81 Ga0207664_10051715 3300025929 Bacteria 3245
82 Ga0207709_10158446 3300025935 Bacteria 1576
83 Ga0207669_10035470 3300025937 Bacteria 2839
84 Ga0207691_10765852 3300025940 Unclassified 812
85 Ga0207661_10986739 3300025944 Bacteria 776
86 Ga0207648_10173729 3300026089 Bacteria 1905
87 Ga0207676_10186156 3300026095 Bacteria 1823
88 Ga0207674_10120888 3300026116 Bacteria 2587
89 Ga0209588_1052807 3300027671 Bacteria 1315
90 Ga0209813_10026801 3300027866 Bacteria 1669
91 Ga0307509_10780123 3300031507 Bacteria 621
92 Ga0307408_100890733 3300031548 Bacteria 814
93 Ga0307405_11778418 3300031731 Bacteria 547
94 Ga0307406_10006295 3300031901 Bacteria 6543
95 Ga0307406_10249922 3300031901 Bacteria 1335
96 Ga0307409_100173239 3300031995 Bacteria 1902
97 Ga0307409_101030996 3300031995 Bacteria 842
98 Ga0307409_101247985 3300031995 Bacteria 767
99 Ga0307416_100225494 3300032002 Bacteria 1802
100 Ga0307416_100626264 3300032002 Bacteria 1158
101 Ga0307414_10639615 3300032004 Bacteria 958
102 Ga0307415_100029293 3300032126 Bacteria 3516
103 Ga0307507_10000140 3300033179 Bacteria 125574
104 Ga0307507_10094318 3300033179 Bacteria 2545
105 Ga0373936_0454857 3300035113 Bacteria 592
106 Ga0373927_0670332 3300035695 Bacteria 685
107 Ga0373937_1059337 3300036401 Bacteria 760
108 Ga0373925_0492410 3300037068 Bacteria 1006
109 Ga0451789_0016613 3300041443 Bacteria 1658
110 Ga0451798_0564509 3300041458 Bacteria 1630
111 Ga0451800_0566490 3300041459 Bacteria 809
112 Ga0451833_1462488 3300041491 Bacteria 893
113 Ga0451839_1415535 3300041496 Bacteria 1458
114 Ga0451853_1854232 3300041512 Bacteria 746
115 Ga0451853_2311274 3300041512 Unclassified 1048
116 Ga0451853_3339943 3300041512 Bacteria 2158
117 Ga0451853_3712977 3300041512 Bacteria 951
118 Ga0451577_0282135 3300042876 Bacteria 1505
119 Ga0466972_0376312 3300044658 Bacteria 665
120 Ga0466966_0051319 3300044684 Bacteria 2622
121 Ga0466966_0090223 3300044684 Bacteria 1903
122 Ga0466963_0293169 3300044694 Bacteria 1144
123 Ga0453684_0010592 3300044712 Bacteria 15729
124 Ga0466971_0146788 3300044719 Bacteria 1100
125 Ga0466971_0468498 3300044719 Bacteria 619
126 Ga0466968_0018630 3300044735 Bacteria 2787
127 Ga0466970_0121303 3300044765 Bacteria 1432
128 Ga0466960_0687136 3300044901 Bacteria 613
129 Ga0466959_0007497 3300045049 Bacteria 7661
130 Ga0466959_1034964 3300045049 Bacteria 546
131 Ga0466958_0902348 3300045836 Bacteria 576
132 Ga0495603_0392829 3300046455 Bacteria 795
133 Ga0495580_0352462 3300046472 Bacteria 997
134 Ga0495639_0264369 3300046475 Bacteria 853
135 Ga0495664_0096179 3300046477 Bacteria 1783
136 Ga0495620_0338825 3300046515 Bacteria 570
137 Ga0495586_0166285 3300046535 Bacteria 1245
138 Ga0495587_0014410 3300046536 Bacteria 4960
139 Ga0495645_0022545 3300046543 Bacteria 4557
140 Ga0495645_0151974 3300046543 Bacteria 1607
141 Ga0495656_0379300 3300046615 Bacteria 737
142 Ga0495635_0590065 3300046663 Bacteria 726
143 Ga0495657_0455510 3300046675 Bacteria 749
144 Ga0495623_0344553 3300046679 Bacteria 813
145 Ga0495600_0303628 3300046809 Bacteria 1006
146 Ga0495581_0159077 3300047315 Bacteria 1320
147 Ga0495581_0355157 3300047315 Bacteria 855
148 Ga0495604_0323976 3300047317 Bacteria 1029
149 Ga0495672_0269024 3300047320 Bacteria 819
150 Ga0495680_0322384 3300047322 Bacteria 1081
151 Ga0495680_1052849 3300047322 Bacteria 517
152 Ga0495675_0035120 3300047444 Bacteria 3202
153 Ga0495593_0481624 3300047673 Bacteria 622
154 Ga0496104_1471692 3300048907 Bacteria 584
155 Ga0496105_0128137 3300048908 Unclassified 2093
156 Ga0496106_0331083 3300048909 Bacteria 1223
157 Ga0496108_0122984 3300048911 Bacteria 2227
158 Ga0496109_0197392 3300048912 Bacteria 1892
159 Ga0496113_0046309 3300048916 Bacteria 3229
160 Ga0496114_0215123 3300048917 Bacteria 1686
161 Ga0496114_0772604 3300048917 Bacteria 839
162 Ga0496114_0990041 3300048917 Bacteria 724
163 Ga0496115_0657080 3300048918 Bacteria 828
164 Ga0501031_1078412 3300049568 Bacteria 513
165 Ga0501032_0247475 3300049569 Bacteria 1158
166 Ga0501037_0952615 3300049573 Bacteria 561
167 Ga0501047_0137499 3300049581 Bacteria 2323
168 Ga0501070_0474885 3300049586 Bacteria 1006
169 Ga0501070_0517210 3300049586 Bacteria 958
170 nmdc:mga03n38_21002_c1 3300050490 Bacteria 2621
171 nmdc:mga03n38_390258_c1 3300050490 Bacteria 764
172 nmdc:mga00v17_127737_c1 3300050491 Bacteria 1623
173 nmdc:mga00v17_136154_c1 3300050491 Bacteria 1572
174 nmdc:mga00v17_472269_c1 3300050491 Bacteria 814
175 nmdc:mga00v17_570512_c1 3300050491 Bacteria 731
176 nmdc:mga00v17_699821_c1 3300050491 Bacteria 650
177 nmdc:mga0yw44_21214_c2 3300050492 Bacteria 3047
178 nmdc:mga0yw44_23610_c1 3300050492 Bacteria 3468
179 nmdc:mga0yw44_329086_c1 3300050492 Bacteria 1027
180 nmdc:mga0yw44_52008_c1 3300050492 Bacteria 2482
181 nmdc:mga0yw44_770966_c1 3300050492 Bacteria 653
182 nmdc:mga06z11_24449_c1 3300050494 Bacteria 2850
183 nmdc:mga04h51_29830_c1 3300050495 Bacteria 1712
184 nmdc:mga06r32_616198_c1 3300050510 Unclassified 1055
185 nmdc:mga0rr50_485079_c1 3300050513 Bacteria 1050
186 nmdc:mga08x19_1165315_c1 3300050514 Bacteria 547
187 Ga0495595_0387864 3300053084 Bacteria 707
188 Ga0495619_0306369 3300053085 Bacteria 1100
189 Ga0500573_0075848 3300053140 Bacteria 1914
190 Ga0500573_0439910 3300053140 Unclassified 606
191 Ga0466962_0036038 3300061719 Bacteria 2367
192 Ga0466962_0211822 3300061719 Bacteria 948
193 2644181993 2643221632 Bacteria 3406696
194 2774395872 2773857762 Bacteria 5971770
195 2812347997 2811994878 Bacteria 5992952
196 2819727670 2818991469 Bacteria 4644110
197 2884699949 2884693830 Bacteria 11273186
198 2891968620 2891968417 Bacteria 5821697
199 2895446786 2895442618 Bacteria 11027144
200 8045834099 8045830549 Bacteria 4444727
201 8056212776 8056207758 Bacteria 8639239
202 Ga0105242_10332380
203 JGI24739J22299_10063883
204 rootH1_10066497
205 rootL2_10064119
206 Ga0070660_100622804
207 Ga0070689_100759715
208 Ga0070675_100423914
209 Ga0070671_100946503
210 Ga0070674_100504837
211 Ga0070659_100491782
212 Ga0070703_10017465
213 Ga0070708_100034467
214 Ga0070708_100045028
215 Ga0070708_100232679
216 Ga0070708_100800914
217 Ga0070706_100001320
218 Ga0070706_100272958
219 Ga0070706_101383084
220 Ga0070707_100066917
221 Ga0070707_100503933
222 Ga0070707_101889189
223 Ga0070698_100216702
224 Ga0070698_100255074
225 Ga0070699_100011511
226 Ga0070699_100060461
227 Ga0070699_100094800
228 Ga0070684_100191778
229 Ga0070697_100193594
230 Ga0070697_100476572
231 Ga0068857_100145404
232 Ga0068864_100387414
233 Ga0081455_10018934
234 Ga0081538_10018861
235 Ga0081539_10005998
236 Ga0075365_10017279
237 Ga0075365_10019088
238 Ga0075365_10297499
239 Ga0075368_10032046
240 Ga0075363_100050339
241 Ga0075363_100142243
242 Ga0075363_100304623
243 Ga0075364_10030554
244 Ga0075364_10163822
245 Ga0075364_10168143
246 Ga0075364_10444526
247 Ga0075364_10590578
248 Ga0075367_10064622
249 Ga0075367_10179532
250 Ga0075431_100580195
251 Ga0075431_100628918
252 Ga0075436_100071595
253 Ga0075435_100500257
254 Ga0099794_10007373
255 Ga0099794_10058386
256 Ga0111539_10683227
257 Ga0105243_10748477
258 Ga0105249_10153314
259 Ga0105246_10088285
260 Ga0105246_10340186
261 Ga0157370_10364390
262 Ga0157369_10383807
263 Ga0157369_10734836
264 Ga0157375_10084442
265 Ga0157375_10117127
266 Ga0157375_11115903
267 Ga0157380_10013411
268 Ga0157376_11138082
269 Ga0163161_10589666
270 Ga0207688_10073955
271 Ga0207684_10000003
272 Ga0207684_10000196
273 Ga0207684_10000767
274 Ga0207684_10295419
275 Ga0207693_10409859
276 Ga0207646_10000260
277 Ga0207646_10002844
278 Ga0207646_10065930
279 Ga0207646_10154324
280 Ga0207646_10199505
281 Ga0207659_10393842
282 Ga0207664_10051715
283 Ga0207709_10158446
284 Ga0207669_10035470
285 Ga0207691_10765852
286 Ga0207661_10986739
287 Ga0207648_10173729
288 Ga0207676_10186156
289 Ga0207674_10120888
290 Ga0209588_1052807
291 Ga0209813_10026801
292 Ga0307509_10780123
293 Ga0307408_100890733
294 Ga0307405_11778418
295 Ga0307406_10006295
296 Ga0307406_10249922
297 Ga0307409_100173239
298 Ga0307409_101030996
299 Ga0307409_101247985
300 Ga0307416_100225494
301 Ga0307416_100626264
302 Ga0307414_10639615
303 Ga0307415_100029293
304 Ga0307507_10000140
305 Ga0307507_10094318
306 Ga0373936_0454857
307 Ga0373927_0670332
308 Ga0373937_1059337
309 Ga0373925_0492410
310 Ga0451789_0016613
311 Ga0451798_0564509
312 Ga0451800_0566490
313 Ga0451833_1462488
314 Ga0451839_1415535
315 Ga0451853_1854232
316 Ga0451853_2311274
317 Ga0451853_3339943
318 Ga0451853_3712977
319 Ga0451577_0282135
320 Ga0466972_0376312
321 Ga0466966_0051319
322 Ga0466966_0090223
323 Ga0466963_0293169
324 Ga0453684_0010592
325 Ga0466971_0146788
326 Ga0466971_0468498
327 Ga0466968_0018630
328 Ga0466970_0121303
329 Ga0466960_0687136
330 Ga0466959_0007497
331 Ga0466959_1034964
332 Ga0466958_0902348
333 Ga0495603_0392829
334 Ga0495580_0352462
335 Ga0495639_0264369
336 Ga0495664_0096179
337 Ga0495620_0338825
338 Ga0495586_0166285
339 Ga0495587_0014410
340 Ga0495645_0022545
341 Ga0495645_0151974
342 Ga0495656_0379300
343 Ga0495635_0590065
344 Ga0495657_0455510
345 Ga0495623_0344553
346 Ga0495600_0303628
347 Ga0495581_0159077
348 Ga0495581_0355157
349 Ga0495604_0323976
350 Ga0495672_0269024
351 Ga0495680_0322384
352 Ga0495680_1052849
353 Ga0495675_0035120
354 Ga0495593_0481624
355 Ga0496104_1471692
356 Ga0496105_0128137
357 Ga0496106_0331083
358 Ga0496108_0122984
359 Ga0496109_0197392
360 Ga0496113_0046309
361 Ga0496114_0215123
362 Ga0496114_0772604
363 Ga0496114_0990041
364 Ga0496115_0657080
365 Ga0501031_1078412
366 Ga0501032_0247475
367 Ga0501037_0952615
368 Ga0501047_0137499
369 Ga0501070_0474885
370 Ga0501070_0517210
371 nmdc:mga03n38_21002_c1
372 nmdc:mga03n38_390258_c1
373 nmdc:mga00v17_127737_c1
374 nmdc:mga00v17_136154_c1
375 nmdc:mga00v17_472269_c1
376 nmdc:mga00v17_570512_c1
377 nmdc:mga00v17_699821_c1
378 nmdc:mga0yw44_21214_c2
379 nmdc:mga0yw44_23610_c1
380 nmdc:mga0yw44_329086_c1
381 nmdc:mga0yw44_52008_c1
382 nmdc:mga0yw44_770966_c1
383 nmdc:mga06z11_24449_c1
384 nmdc:mga04h51_29830_c1
385 nmdc:mga06r32_616198_c1
386 nmdc:mga0rr50_485079_c1
387 nmdc:mga08x19_1165315_c1
388 Ga0495595_0387864
389 Ga0495619_0306369
390 Ga0500573_0075848
391 Ga0500573_0439910
392 Ga0466962_0036038
393 Ga0466962_0211822
394 2644181993
395 2774395872
396 2812347997
397 2819727670
398 2884699949
399 2891968620
400 2895446786
401 8045834099
402 8056212776

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

39

129

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bzg-assembly3.cif.gz_J structure of bacillus subtilis hxlr, wild type in complex with formaldehyde and dna 0.9275 10 104
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.8983 11 103
5kk1-assembly1.cif.gz_E structure of pnob8 aspa-dna complex. 0.8859 26 93
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.8812 10 104
4yif-assembly3.cif.gz_E crystal structure of rv0880 0.8751 22 94
ID Description Score Start End Superfamily
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9155 14 104 1.10.10.10
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9077 10 148 1.10.10.10
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8861 14 104 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8783 13 104 1.10.10.10
2hztA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8749 11 103 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2T6L3Q8-F1-model_v4 HxlR family transcriptional regulator 0.9755 10 107 GO:0003677
GO:0016209
GO:0016491
AF-A0A6G9GT73-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9656 9 105 GO:0003677
AF-A0A4R4Q013-F1-model_v4 Transcriptional regulator 0.9591 9 107 GO:0003677
AF-A0A3D0TWA2-F1-model_v4 Transcriptional regulator 0.9551 11 146 GO:0003677
AF-A0A7V8X3V2-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9529 11 146 GO:0003677

Map