F308086

General Info

Members Datasets Scaffolds Average Seq Length
201 136 402 125

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100108084|Ga0070670_1001080843
Length 139
Sequence MSHPVATREMSMRSKQRGITFIGWIFLLTPMAICAYAGIRLAPVYLNYMKVARSMEQVKTEWKGGGVQGDSQAAVRTALEKHLNTESVDFPDVKDFKVTRNGKSWIVNAAYDDQAPLFSNVFILVSFDKTVTIGSESGD

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
106 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
134 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
135 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
136 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 3.98
Rhizosphere 84.08
Stem 0
Stem Tuber 0
Unclassified 6.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100108084 3300005331 Bacteria 2397
2 JGI24735J21928_10193207 3300002067 Bacteria 590
3 rootH2_10049006 3300003320 Bacteria 1408
4 rootL2_10198507 3300003322 Bacteria 2406
5 Ga0070690_100955223 3300005330 Bacteria 673
6 Ga0068869_100164366 3300005334 Bacteria 1730
7 Ga0070666_10163050 3300005335 Bacteria 1558
8 Ga0070666_10444216 3300005335 Bacteria 936
9 Ga0070680_100469495 3300005336 Bacteria 1075
10 Ga0070682_100007611 3300005337 Bacteria 6103
11 Ga0070682_100070438 3300005337 Bacteria 2235
12 Ga0070682_100137545 3300005337 Bacteria 1661
13 Ga0070689_101401291 3300005340 Unclassified 631
14 Ga0070687_100846079 3300005343 Bacteria 652
15 Ga0070661_100492183 3300005344 Bacteria 980
16 Ga0070671_100000281 3300005355 Bacteria 34546
17 Ga0070671_100118306 3300005355 Bacteria 2229
18 Ga0070688_100150579 3300005365 Bacteria 1590
19 Ga0070667_100152851 3300005367 Bacteria 2028
20 Ga0070667_100602376 3300005367 Bacteria 1012
21 Ga0070713_100753993 3300005436 Bacteria 931
22 Ga0070711_100630719 3300005439 Bacteria 897
23 Ga0070711_101930793 3300005439 Bacteria 519
24 Ga0070663_100197748 3300005455 Bacteria 1567
25 Ga0070663_102105675 3300005455 Unclassified 508
26 Ga0070678_101391397 3300005456 Bacteria 655
27 Ga0070681_10004635 3300005458 Bacteria 13126
28 Ga0068867_100083419 3300005459 Bacteria 2413
29 Ga0070679_100078080 3300005530 Bacteria 3300
30 Ga0070686_101711581 3300005544 Unclassified 534
31 Ga0070695_100644550 3300005545 Bacteria 836
32 Ga0070693_100252351 3300005547 Bacteria 1170
33 Ga0070665_100000697 3300005548 Bacteria 44802
34 Ga0070665_100002619 3300005548 Bacteria 19629
35 Ga0070665_100447546 3300005548 Bacteria 1301
36 Ga0070665_100460675 3300005548 Bacteria 1281
37 Ga0068855_100393577 3300005563 Bacteria 1519
38 Ga0070664_100458319 3300005564 Bacteria 1171
39 Ga0068857_101186742 3300005577 Bacteria 739
40 Ga0068854_101193453 3300005578 Bacteria 681
41 Ga0068856_100586097 3300005614 Bacteria 1136
42 Ga0068856_100992573 3300005614 Unclassified 858
43 Ga0068859_100000678 3300005617 Bacteria 34157
44 Ga0068859_100067363 3300005617 Bacteria 3615
45 Ga0068859_100089197 3300005617 Bacteria 3134
46 Ga0068864_102160668 3300005618 Unclassified 563
47 Ga0068866_10099606 3300005718 Bacteria 1601
48 Ga0068861_100074438 3300005719 Bacteria 2641
49 Ga0068861_100417579 3300005719 Bacteria 1194
50 Ga0068863_100014368 3300005841 Bacteria 7626
51 Ga0068863_100018061 3300005841 Bacteria 6754
52 Ga0068858_100000687 3300005842 Bacteria 35306
53 Ga0068858_100006232 3300005842 Bacteria 11624
54 Ga0068860_100000219 3300005843 Bacteria 89810
55 Ga0068860_100040612 3300005843 Bacteria 4446
56 Ga0068860_100514965 3300005843 Bacteria 1196
57 Ga0068862_100240770 3300005844 Bacteria 1645
58 Ga0068862_100360729 3300005844 Bacteria 1350
59 Ga0068862_101333212 3300005844 Bacteria 719
60 Ga0081455_10009657 3300005937 Bacteria 9899
61 Ga0070712_100108953 3300006175 Bacteria 2063
62 Ga0097621_100310818 3300006237 Bacteria 1394
63 Ga0068871_100117309 3300006358 Bacteria 2245
64 Ga0068871_102162394 3300006358 Bacteria 530
65 Ga0075436_100978729 3300006914 Bacteria 634
66 Ga0097620_100000678 3300006931 Bacteria 34157
67 Ga0097620_100067364 3300006931 Bacteria 3615
68 Ga0097620_100089197 3300006931 Bacteria 3134
69 Ga0105240_10641569 3300009093 Bacteria 1165
70 Ga0105240_10726662 3300009093 Bacteria 1082
71 Ga0105247_10000203 3300009101 Bacteria 58331
72 Ga0105241_10148096 3300009174 Bacteria 1918
73 Ga0105248_10667774 3300009177 Bacteria 1173
74 Ga0105237_10191341 3300009545 Bacteria 2046
75 Ga0105237_10528328 3300009545 Bacteria 1186
76 Ga0105237_10732994 3300009545 Bacteria 995
77 Ga0105238_10083798 3300009551 Bacteria 3177
78 Ga0105238_10160753 3300009551 Bacteria 2222
79 Ga0105238_10376009 3300009551 Bacteria 1412
80 Ga0105238_10427012 3300009551 Bacteria 1320
81 Ga0105238_10527116 3300009551 Bacteria 1184
82 Ga0105238_11684892 3300009551 Bacteria 665
83 Ga0099796_10188966 3300010159 Bacteria 830
84 Ga0105239_11196784 3300010375 Bacteria 876
85 Ga0105239_12449080 3300010375 Unclassified 608
86 Ga0157374_10276277 3300013296 Bacteria 1658
87 Ga0157374_10840856 3300013296 Bacteria 934
88 Ga0163163_10252114 3300014325 Bacteria 1815
89 Ga0163163_10726643 3300014325 Bacteria 1056
90 Ga0163163_11785302 3300014325 Bacteria 675
91 Ga0157379_10094055 3300014968 Bacteria 2689
92 Ga0157379_10355704 3300014968 Bacteria 1341
93 Ga0213871_10049297 3300021441 Bacteria 1150
94 Ga0207682_10042409 3300025893 Bacteria 1859
95 Ga0207710_10001289 3300025900 Bacteria 12672
96 Ga0207680_10169908 3300025903 Bacteria 1468
97 Ga0207647_10183431 3300025904 Bacteria 1214
98 Ga0207643_10819203 3300025908 Bacteria 603
99 Ga0207654_10168068 3300025911 Bacteria 1422
100 Ga0207707_10064936 3300025912 Bacteria 3178
101 Ga0207695_10174487 3300025913 Bacteria 2073
102 Ga0207695_10292597 3300025913 Bacteria 1521
103 Ga0207671_10089240 3300025914 Bacteria 2320
104 Ga0207671_10144794 3300025914 Bacteria 1833
105 Ga0207671_10972851 3300025914 Bacteria 669
106 Ga0207693_10033339 3300025915 Bacteria 4063
107 Ga0207663_10190391 3300025916 Bacteria 1472
108 Ga0207663_10359604 3300025916 Bacteria 1104
109 Ga0207662_10430177 3300025918 Bacteria 899
110 Ga0207652_10061541 3300025921 Bacteria 3242
111 Ga0207694_10070181 3300025924 Bacteria 2737
112 Ga0207694_10113694 3300025924 Bacteria 2156
113 Ga0207694_10323657 3300025924 Bacteria 1273
114 Ga0207694_10501143 3300025924 Bacteria 1017
115 Ga0207694_10573938 3300025924 Bacteria 948
116 Ga0207694_11501221 3300025924 Unclassified 569
117 Ga0207700_10602002 3300025928 Bacteria 978
118 Ga0207664_11529597 3300025929 Unclassified 589
119 Ga0207644_10010546 3300025931 Bacteria 6091
120 Ga0207644_10057647 3300025931 Bacteria 2805
121 Ga0207670_11254493 3300025936 Unclassified 628
122 Ga0207665_10006543 3300025939 Bacteria 7725
123 Ga0207689_10173560 3300025942 Bacteria 1778
124 Ga0207679_10501045 3300025945 Bacteria 1084
125 Ga0207667_10729506 3300025949 Bacteria 992
126 Ga0207712_10094352 3300025961 Bacteria 2210
127 Ga0207658_10011219 3300025986 Bacteria 6104
128 Ga0207703_10002390 3300026035 Bacteria 16318
129 Ga0207703_10120469 3300026035 Bacteria 2252
130 Ga0207678_10028984 3300026067 Bacteria 4831
131 Ga0207678_10171558 3300026067 Bacteria 1852
132 Ga0207678_11375581 3300026067 Bacteria 624
133 Ga0207702_10453078 3300026078 Bacteria 1245
134 Ga0207702_11484051 3300026078 Unclassified 672
135 Ga0207702_12199681 3300026078 Unclassified 540
136 Ga0207641_10001095 3300026088 Bacteria 27240
137 Ga0207641_10204585 3300026088 Bacteria 1822
138 Ga0207641_10805283 3300026088 Bacteria 929
139 Ga0207674_10212735 3300026116 Bacteria 1882
140 Ga0207675_100068850 3300026118 Bacteria 3307
141 Ga0207675_101750280 3300026118 Bacteria 641
142 Ga0207683_10354973 3300026121 Bacteria 1346
143 Ga0268266_10001369 3300028379 Bacteria 29399
144 Ga0268266_10002522 3300028379 Bacteria 19488
145 Ga0268266_10041404 3300028379 Bacteria 3930
146 Ga0268266_10490984 3300028379 Bacteria 1171
147 Ga0268265_10015257 3300028380 Bacteria 5253
148 Ga0268264_10000057 3300028381 Bacteria 309824
149 Ga0268264_10000165 3300028381 Bacteria 147648
150 Ga0268264_10000348 3300028381 Bacteria 70273
151 Ga0268264_10416014 3300028381 Bacteria 1295
152 Ga0307515_10098492 3300028794 Bacteria 3560
153 Ga0307511_10001972 3300030521 Bacteria 21547
154 Ga0265340_10039136 3300031247 Bacteria 2342
155 Ga0307513_10007954 3300031456 Bacteria 13642
156 Ga0307509_10000013 3300031507 Bacteria 283027
157 Ga0307509_10616712 3300031507 Bacteria 756
158 Ga0307405_10983100 3300031731 Bacteria 719
159 Ga0307409_100070786 3300031995 Bacteria 2770
160 Ga0307510_10000014 3300033180 Bacteria 271607
161 Ga0307510_10004929 3300033180 Bacteria 15800
162 Ga0373936_0032083 3300035113 Bacteria 2077
163 Ga0373927_0099508 3300035695 Bacteria 1891
164 Ga0436360_0349902 3300039438 Bacteria 4616
165 Ga0436361_0314639 3300039447 Unclassified 941
166 Ga0436363_0792226 3300039450 Bacteria 2993
167 Ga0451795_0203434 3300041456 Bacteria 736
168 Ga0451800_0889503 3300041459 Bacteria 854
169 Ga0451802_1578817 3300041460 Bacteria 676
170 Ga0451577_0411387 3300042876 Bacteria 1228
171 Ga0495617_212949 3300046452 Bacteria 602
172 Ga0495603_0192362 3300046455 Bacteria 1180
173 Ga0495616_0097381 3300046513 Bacteria 1384
174 Ga0495648_0345900 3300046524 Bacteria 681
175 Ga0495668_0111576 3300046616 Bacteria 1496
176 Ga0495625_0143890 3300046660 Bacteria 1607
177 Ga0495649_0004157 3300046694 Bacteria 9505
178 Ga0495649_0381633 3300046694 Bacteria 709
179 Ga0495687_103539 3300047443 Bacteria 1062
180 Ga0496100_0118854 3300048903 Bacteria 1847
181 Ga0496101_0117648 3300048904 Bacteria 2007
182 Ga0496102_0043069 3300048905 Bacteria 4092
183 Ga0496104_1602167 3300048907 Bacteria 554
184 Ga0496106_0708088 3300048909 Bacteria 802
185 Ga0496117_0279292 3300048920 Bacteria 895
186 Ga0496118_0096391 3300048921 Bacteria 2016
187 Ga0496119_0002727 3300048922 Bacteria 19044
188 Ga0496119_0012059 3300048922 Bacteria 7064
189 Ga0496120_0000400 3300048923 Bacteria 69985
190 Ga0496120_0155954 3300048923 Bacteria 1143
191 Ga0496121_0000522 3300048924 Bacteria 73298
192 Ga0496123_0305674 3300048926 Bacteria 757
193 Ga0496125_0127756 3300048928 Bacteria 1797
194 Ga0496126_1091739 3300048929 Unclassified 593
195 Ga0495682_0076626 3300049460 Bacteria 1203
196 Ga0501035_1349879 3300049822 Unclassified 548
197 nmdc:mga0rr50_49158_c1 3300050513 Bacteria 3121
198 Ga0500583_0134786 3300053092 Bacteria 1226
199 Ga0500658_0474525 3300053134 Bacteria 568
200 Ga0500559_0397867 3300053136 Bacteria 641
201 Ga0500637_0294944 3300053178 Bacteria 886
202 Ga0070670_100108084
203 JGI24735J21928_10193207
204 rootH2_10049006
205 rootL2_10198507
206 Ga0070690_100955223
207 Ga0068869_100164366
208 Ga0070666_10163050
209 Ga0070666_10444216
210 Ga0070680_100469495
211 Ga0070682_100007611
212 Ga0070682_100070438
213 Ga0070682_100137545
214 Ga0070689_101401291
215 Ga0070687_100846079
216 Ga0070661_100492183
217 Ga0070671_100000281
218 Ga0070671_100118306
219 Ga0070688_100150579
220 Ga0070667_100152851
221 Ga0070667_100602376
222 Ga0070713_100753993
223 Ga0070711_100630719
224 Ga0070711_101930793
225 Ga0070663_100197748
226 Ga0070663_102105675
227 Ga0070678_101391397
228 Ga0070681_10004635
229 Ga0068867_100083419
230 Ga0070679_100078080
231 Ga0070686_101711581
232 Ga0070695_100644550
233 Ga0070693_100252351
234 Ga0070665_100000697
235 Ga0070665_100002619
236 Ga0070665_100447546
237 Ga0070665_100460675
238 Ga0068855_100393577
239 Ga0070664_100458319
240 Ga0068857_101186742
241 Ga0068854_101193453
242 Ga0068856_100586097
243 Ga0068856_100992573
244 Ga0068859_100000678
245 Ga0068859_100067363
246 Ga0068859_100089197
247 Ga0068864_102160668
248 Ga0068866_10099606
249 Ga0068861_100074438
250 Ga0068861_100417579
251 Ga0068863_100014368
252 Ga0068863_100018061
253 Ga0068858_100000687
254 Ga0068858_100006232
255 Ga0068860_100000219
256 Ga0068860_100040612
257 Ga0068860_100514965
258 Ga0068862_100240770
259 Ga0068862_100360729
260 Ga0068862_101333212
261 Ga0081455_10009657
262 Ga0070712_100108953
263 Ga0097621_100310818
264 Ga0068871_100117309
265 Ga0068871_102162394
266 Ga0075436_100978729
267 Ga0097620_100000678
268 Ga0097620_100067364
269 Ga0097620_100089197
270 Ga0105240_10641569
271 Ga0105240_10726662
272 Ga0105247_10000203
273 Ga0105241_10148096
274 Ga0105248_10667774
275 Ga0105237_10191341
276 Ga0105237_10528328
277 Ga0105237_10732994
278 Ga0105238_10083798
279 Ga0105238_10160753
280 Ga0105238_10376009
281 Ga0105238_10427012
282 Ga0105238_10527116
283 Ga0105238_11684892
284 Ga0099796_10188966
285 Ga0105239_11196784
286 Ga0105239_12449080
287 Ga0157374_10276277
288 Ga0157374_10840856
289 Ga0163163_10252114
290 Ga0163163_10726643
291 Ga0163163_11785302
292 Ga0157379_10094055
293 Ga0157379_10355704
294 Ga0213871_10049297
295 Ga0207682_10042409
296 Ga0207710_10001289
297 Ga0207680_10169908
298 Ga0207647_10183431
299 Ga0207643_10819203
300 Ga0207654_10168068
301 Ga0207707_10064936
302 Ga0207695_10174487
303 Ga0207695_10292597
304 Ga0207671_10089240
305 Ga0207671_10144794
306 Ga0207671_10972851
307 Ga0207693_10033339
308 Ga0207663_10190391
309 Ga0207663_10359604
310 Ga0207662_10430177
311 Ga0207652_10061541
312 Ga0207694_10070181
313 Ga0207694_10113694
314 Ga0207694_10323657
315 Ga0207694_10501143
316 Ga0207694_10573938
317 Ga0207694_11501221
318 Ga0207700_10602002
319 Ga0207664_11529597
320 Ga0207644_10010546
321 Ga0207644_10057647
322 Ga0207670_11254493
323 Ga0207665_10006543
324 Ga0207689_10173560
325 Ga0207679_10501045
326 Ga0207667_10729506
327 Ga0207712_10094352
328 Ga0207658_10011219
329 Ga0207703_10002390
330 Ga0207703_10120469
331 Ga0207678_10028984
332 Ga0207678_10171558
333 Ga0207678_11375581
334 Ga0207702_10453078
335 Ga0207702_11484051
336 Ga0207702_12199681
337 Ga0207641_10001095
338 Ga0207641_10204585
339 Ga0207641_10805283
340 Ga0207674_10212735
341 Ga0207675_100068850
342 Ga0207675_101750280
343 Ga0207683_10354973
344 Ga0268266_10001369
345 Ga0268266_10002522
346 Ga0268266_10041404
347 Ga0268266_10490984
348 Ga0268265_10015257
349 Ga0268264_10000057
350 Ga0268264_10000165
351 Ga0268264_10000348
352 Ga0268264_10416014
353 Ga0307515_10098492
354 Ga0307511_10001972
355 Ga0265340_10039136
356 Ga0307513_10007954
357 Ga0307509_10000013
358 Ga0307509_10616712
359 Ga0307405_10983100
360 Ga0307409_100070786
361 Ga0307510_10000014
362 Ga0307510_10004929
363 Ga0373936_0032083
364 Ga0373927_0099508
365 Ga0436360_0349902
366 Ga0436361_0314639
367 Ga0436363_0792226
368 Ga0451795_0203434
369 Ga0451800_0889503
370 Ga0451802_1578817
371 Ga0451577_0411387
372 Ga0495617_212949
373 Ga0495603_0192362
374 Ga0495616_0097381
375 Ga0495648_0345900
376 Ga0495668_0111576
377 Ga0495625_0143890
378 Ga0495649_0004157
379 Ga0495649_0381633
380 Ga0495687_103539
381 Ga0496100_0118854
382 Ga0496101_0117648
383 Ga0496102_0043069
384 Ga0496104_1602167
385 Ga0496106_0708088
386 Ga0496117_0279292
387 Ga0496118_0096391
388 Ga0496119_0002727
389 Ga0496119_0012059
390 Ga0496120_0000400
391 Ga0496120_0155954
392 Ga0496121_0000522
393 Ga0496123_0305674
394 Ga0496125_0127756
395 Ga0496126_1091739
396 Ga0495682_0076626
397 Ga0501035_1349879
398 nmdc:mga0rr50_49158_c1
399 Ga0500583_0134786
400 Ga0500658_0474525
401 Ga0500559_0397867
402 Ga0500637_0294944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16137

DUF4845

Domain of unknown function (DUF4845)

40

127

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dv5-assembly1.cif.gz_X oligomeric complex of a hsp27 24-mer at 3.6 a resolution 0.7475 83 121
3w0l-assembly2.cif.gz_C the crystal structure of xenopus glucokinase and glucokinase regulatory protein complex 0.7408 83 121
6dv5-assembly1.cif.gz_J oligomeric complex of a hsp27 24-mer at 3.6 a resolution 0.686 83 125
5w8m-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6637 85 121
4akr-assembly1.cif.gz_A crystal structure of the cytoplasmic actin capping protein cap32_34 from dictyostelium discoideum 0.6582 83 122
ID Description Score Start End Superfamily
af_Q8IPS7_256_515_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.7626 39 97 3.90.230.10
af_Q54WT6_15_161_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7311 76 123 2.60.40.790
af_A0A1D6NVT7_39_111_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7177 36 81 1.10.10.60
af_A0A1D6DZ76_45_118_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7106 36 81 1.10.10.60
af_A0A0N7KD49_219_292_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.705 36 81 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7Y1XIN9-F1-model_v4 DUF4845 domain-containing protein 0.9418 2 122 GO:0016020
AF-A0A7Y1TV36-F1-model_v4 DUF4845 domain-containing protein 0.9336 1 122 GO:0016020
AF-A0A661GFY0-F1-model_v4 DUF4845 domain-containing protein 0.9325 1 122 GO:0016020
AF-A0A0S7Z2N7-F1-model_v4 DUF4845 domain-containing protein 0.9284 1 121
AF-A0A0S8FC21-F1-model_v4 DUF4845 domain-containing protein 0.9207 1 122 GO:0016020

Map