F308054

General Info

Members Datasets Scaffolds Average Seq Length
201 107 402 180

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10383914|Ga0070658_103839142
Length 186
Sequence VNPPPGLGQDDWRSDVLKFWFGLDPEQWWRGPPELDEQVRERFLDLWEEKRQLPPESFLTDPLTAIAAVILFDQFPRNMFRGHADQFSTDPLALAIAKGAVDRGFDEQLEPKERGFLYLPFEHSEDMDDQRRSMILFTALDDEHMLHFAKLHYDIIARFGRFPHRNAVLGRQPRADEIAAGDVVPW

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
106 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
107 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 1.49
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10383914 3300005327 Bacteria 1205
2 Ga0065712_10147762 3300005290 Bacteria 1394
3 Ga0065715_10148421 3300005293 Bacteria 1755
4 Ga0070658_10001393 3300005327 Bacteria 20623
5 Ga0070658_10005085 3300005327 Bacteria 10702
6 Ga0070658_10096231 3300005327 Bacteria 2444
7 Ga0070658_10353225 3300005327 Bacteria 1258
8 Ga0070658_10713929 3300005327 Bacteria 870
9 Ga0070683_100015820 3300005329 Bacteria 6634
10 Ga0070670_100039205 3300005331 Bacteria 4074
11 Ga0070677_10079031 3300005333 Bacteria 1403
12 Ga0068869_100359568 3300005334 Bacteria 1188
13 Ga0070680_100352464 3300005336 Bacteria 1251
14 Ga0070680_100382838 3300005336 Bacteria 1198
15 Ga0070680_100563314 3300005336 Bacteria 977
16 Ga0070680_100581842 3300005336 Bacteria 960
17 Ga0068868_100238687 3300005338 Bacteria 1526
18 Ga0070660_100000339 3300005339 Bacteria 31090
19 Ga0070660_100002558 3300005339 Bacteria 12467
20 Ga0070660_100127236 3300005339 Bacteria 2036
21 Ga0070661_100000003 3300005344 Bacteria 254653
22 Ga0070661_100078101 3300005344 Bacteria 2441
23 Ga0070661_100134513 3300005344 Bacteria 1859
24 Ga0070661_100381526 3300005344 Bacteria 1111
25 Ga0070692_10000595 3300005345 Bacteria 11347
26 Ga0070692_10050565 3300005345 Bacteria 2159
27 Ga0070692_10076361 3300005345 Bacteria 1796
28 Ga0070669_100489247 3300005353 Bacteria 1019
29 Ga0070675_100012326 3300005354 Bacteria 6700
30 Ga0070675_100062495 3300005354 Bacteria 3077
31 Ga0070673_100028932 3300005364 Bacteria 4127
32 Ga0070673_100738165 3300005364 Bacteria 906
33 Ga0070659_100000005 3300005366 Bacteria 259902
34 Ga0070659_100027965 3300005366 Bacteria 4350
35 Ga0070659_100077817 3300005366 Bacteria 2646
36 Ga0070659_100180206 3300005366 Bacteria 1734
37 Ga0070659_100245308 3300005366 Bacteria 1483
38 Ga0070659_100368737 3300005366 Bacteria 1207
39 Ga0070659_100578235 3300005366 Bacteria 964
40 Ga0070659_100916508 3300005366 Bacteria 766
41 Ga0070663_100001000 3300005455 Bacteria 15406
42 Ga0070663_100046359 3300005455 Bacteria 3075
43 Ga0070663_100250475 3300005455 Bacteria 1401
44 Ga0070662_100617785 3300005457 Bacteria 912
45 Ga0070685_10259962 3300005466 Bacteria 1154
46 Ga0070679_100017106 3300005530 Bacteria 7011
47 Ga0070679_100204837 3300005530 Bacteria 1937
48 Ga0070679_100205398 3300005530 Bacteria 1934
49 Ga0070679_100281372 3300005530 Bacteria 1616
50 Ga0070679_100860653 3300005530 Bacteria 850
51 Ga0070679_101205969 3300005530 Bacteria 702
52 Ga0070684_100089044 3300005535 Bacteria 2743
53 Ga0070684_100234036 3300005535 Bacteria 1678
54 Ga0068853_100600924 3300005539 Bacteria 1045
55 Ga0070672_100464360 3300005543 Bacteria 1092
56 Ga0070686_100004892 3300005544 Bacteria 7390
57 Ga0070693_100289486 3300005547 Bacteria 1100
58 Ga0070665_100000317 3300005548 Bacteria 74997
59 Ga0068855_100000247 3300005563 Bacteria 68071
60 Ga0070664_100052112 3300005564 Bacteria 3466
61 Ga0068864_100650045 3300005618 Bacteria 1027
62 Ga0068866_10404278 3300005718 Bacteria 881
63 Ga0068860_100066354 3300005843 Bacteria 3428
64 Ga0097621_101247286 3300006237 Bacteria 701
65 Ga0105241_10228431 3300009174 Bacteria 1568
66 Ga0105248_11289404 3300009177 Bacteria 826
67 Ga0105246_10353619 3300011119 Bacteria 1205
68 Ga0157373_10015874 3300013100 Bacteria 5498
69 Ga0157373_10084344 3300013100 Bacteria 2240
70 Ga0157373_10169656 3300013100 Bacteria 1535
71 Ga0157371_10000624 3300013102 Bacteria 42051
72 Ga0157371_10292741 3300013102 Bacteria 1177
73 Ga0157371_10416063 3300013102 Bacteria 985
74 Ga0157370_10225180 3300013104 Bacteria 1736
75 Ga0157370_10939969 3300013104 Bacteria 784
76 Ga0157370_10993897 3300013104 Bacteria 760
77 Ga0157369_10048695 3300013105 Bacteria 4598
78 Ga0157369_10785055 3300013105 Bacteria 979
79 Ga0157369_11141291 3300013105 Bacteria 796
80 Ga0157374_10754433 3300013296 Bacteria 988
81 Ga0157374_11057034 3300013296 Bacteria 832
82 Ga0157375_10320765 3300013308 Bacteria 1714
83 Ga0213873_10000016 3300021358 Bacteria 124829
84 Ga0213876_10000056 3300021384 Bacteria 135017
85 Ga0213876_10008856 3300021384 Bacteria 5431
86 Ga0207682_10016259 3300025893 Bacteria 2901
87 Ga0207647_10035397 3300025904 Bacteria 3182
88 Ga0207647_10180432 3300025904 Bacteria 1226
89 Ga0207645_10025976 3300025907 Bacteria 3788
90 Ga0207645_10114852 3300025907 Bacteria 1745
91 Ga0207705_10000005 3300025909 Bacteria 673478
92 Ga0207705_10000082 3300025909 Bacteria 118194
93 Ga0207705_10014881 3300025909 Bacteria 5595
94 Ga0207705_10181592 3300025909 Bacteria 1588
95 Ga0207705_10256358 3300025909 Bacteria 1335
96 Ga0207705_10332167 3300025909 Bacteria 1169
97 Ga0207705_10459822 3300025909 Bacteria 987
98 Ga0207705_11063254 3300025909 Bacteria 624
99 Ga0207660_10079864 3300025917 Bacteria 2400
100 Ga0207660_10290171 3300025917 Bacteria 1301
101 Ga0207660_10318755 3300025917 Bacteria 1241
102 Ga0207657_10000360 3300025919 Bacteria 48193
103 Ga0207657_10001108 3300025919 Bacteria 28597
104 Ga0207657_10001597 3300025919 Bacteria 24361
105 Ga0207657_10004093 3300025919 Bacteria 15482
106 Ga0207657_10802266 3300025919 Bacteria 728
107 Ga0207649_10000016 3300025920 Bacteria 243843
108 Ga0207649_10067186 3300025920 Bacteria 2275
109 Ga0207652_10265375 3300025921 Bacteria 1549
110 Ga0207681_10429801 3300025923 Bacteria 1071
111 Ga0207650_10086326 3300025925 Bacteria 2389
112 Ga0207659_10036060 3300025926 Bacteria 3423
113 Ga0207659_10196692 3300025926 Bacteria 1607
114 Ga0207690_10000020 3300025932 Bacteria 218439
115 Ga0207690_10007351 3300025932 Bacteria 6538
116 Ga0207690_10016160 3300025932 Bacteria 4538
117 Ga0207690_10021390 3300025932 Bacteria 4011
118 Ga0207690_10148063 3300025932 Bacteria 1738
119 Ga0207690_10201983 3300025932 Bacteria 1510
120 Ga0207690_10486104 3300025932 Bacteria 997
121 Ga0207690_10565233 3300025932 Bacteria 926
122 Ga0207706_10000916 3300025933 Bacteria 30270
123 Ga0207706_10475886 3300025933 Bacteria 1079
124 Ga0207709_10091099 3300025935 Bacteria 1993
125 Ga0207691_10420028 3300025940 Bacteria 1140
126 Ga0207689_10070124 3300025942 Bacteria 2880
127 Ga0207689_10260712 3300025942 Bacteria 1434
128 Ga0207661_10159970 3300025944 Bacteria 1953
129 Ga0207667_10003833 3300025949 Bacteria 18489
130 Ga0207651_10191398 3300025960 Bacteria 1632
131 Ga0207651_10216963 3300025960 Bacteria 1544
132 Ga0207677_10000858 3300026023 Bacteria 17378
133 Ga0207639_10221005 3300026041 Bacteria 1636
134 Ga0207678_10002500 3300026067 Bacteria 16720
135 Ga0207678_10018695 3300026067 Bacteria 6085
136 Ga0207678_10054690 3300026067 Bacteria 3438
137 Ga0207678_10144629 3300026067 Bacteria 2029
138 Ga0207698_10156083 3300026142 Bacteria 1988
139 Ga0207698_10186112 3300026142 Bacteria 1845
140 Ga0268266_10000388 3300028379 Bacteria 66871
141 Ga0268264_10050137 3300028381 Bacteria 3475
142 Ga0307405_10074431 3300031731 Bacteria 2196
143 Ga0307413_10074900 3300031824 Bacteria 2146
144 Ga0307410_10022870 3300031852 Bacteria 3873
145 Ga0307410_10087869 3300031852 Bacteria 2200
146 Ga0307410_10135871 3300031852 Bacteria 1812
147 Ga0307406_10047423 3300031901 Bacteria 2708
148 Ga0307406_10063183 3300031901 Bacteria 2397
149 Ga0307407_10006809 3300031903 Bacteria 5121
150 Ga0307407_10060707 3300031903 Bacteria 2207
151 Ga0307412_10053518 3300031911 Bacteria 2676
152 Ga0307412_10345078 3300031911 Bacteria 1193
153 Ga0307412_10596790 3300031911 Bacteria 934
154 Ga0307409_100070557 3300031995 Bacteria 2773
155 Ga0307409_100071865 3300031995 Bacteria 2753
156 Ga0307409_101487131 3300031995 Bacteria 704
157 Ga0307416_100072203 3300032002 Bacteria 2871
158 Ga0307414_10072219 3300032004 Bacteria 2492
159 Ga0307414_10588482 3300032004 Bacteria 996
160 Ga0307411_10002818 3300032005 Bacteria 7840
161 Ga0307415_100048278 3300032126 Bacteria 2871
162 Ga0395899_0000340 3300037312 Bacteria 58575
163 Ga0395899_0090418 3300037312 Bacteria 2219
164 Ga0395900_0000794 3300037418 Bacteria 41709
165 Ga0395900_0128977 3300037418 Bacteria 2592
166 Ga0395900_0437116 3300037418 Bacteria 1267
167 Ga0395898_0007116 3300037466 Bacteria 11879
168 Ga0395898_0450152 3300037466 Bacteria 1226
169 Ga0395905_0100990 3300037471 Bacteria 2708
170 Ga0395905_0121023 3300037471 Bacteria 2460
171 Ga0436364_1100721 3300037853 Bacteria 1177
172 Ga0395901_0000031 3300038443 Bacteria 241733
173 Ga0395901_0046926 3300038443 Bacteria 4487
174 Ga0395901_0136178 3300038443 Bacteria 2581
175 Ga0395901_0569707 3300038443 Bacteria 1145
176 Ga0436365_0869628 3300039437 Bacteria 66366
177 Ga0436365_1021285 3300039437 Bacteria 22337
178 Ga0436365_1574836 3300039437 Bacteria 5130
179 Ga0436363_0534528 3300039450 Bacteria 1235
180 Ga0436362_0580304 3300039453 Bacteria 124869
181 Ga0439432_057901 3300042006 Bacteria 1199
182 Ga0439432_067106 3300042006 Bacteria 1098
183 Ga0439449_0075692 3300042007 Bacteria 1240
184 Ga0450890_033503 3300042127 Bacteria 739
185 Ga0466966_0645545 3300044684 Bacteria 637
186 Ga0466961_0065739 3300044693 Bacteria 2304
187 Ga0466964_0009399 3300044706 Bacteria 3679
188 Ga0466968_0017208 3300044735 Bacteria 2886
189 Ga0466970_0016574 3300044765 Bacteria 3801
190 Ga0466959_0106155 3300045049 Bacteria 2008
191 Ga0466958_0010586 3300045836 Bacteria 5169
192 Ga0466967_0022531 3300045976 Bacteria 5142
193 Ga0466967_0696690 3300045976 Bacteria 1006
194 Ga0495625_0137145 3300046660 Bacteria 1653
195 Ga0496103_0043492 3300048906 Bacteria 2766
196 Ga0496106_0219871 3300048909 Bacteria 1515
197 Ga0496108_0001150 3300048911 Bacteria 20658
198 Ga0501069_0512730 3300049585 Bacteria 716
199 Ga0495655_0094672 3300053083 Bacteria 876
200 Ga0500611_153206 3300053727 Bacteria 634
201 Ga0500587_027363 3300053739 Bacteria 768
202 Ga0070658_10383914
203 Ga0065712_10147762
204 Ga0065715_10148421
205 Ga0070658_10001393
206 Ga0070658_10005085
207 Ga0070658_10096231
208 Ga0070658_10353225
209 Ga0070658_10713929
210 Ga0070683_100015820
211 Ga0070670_100039205
212 Ga0070677_10079031
213 Ga0068869_100359568
214 Ga0070680_100352464
215 Ga0070680_100382838
216 Ga0070680_100563314
217 Ga0070680_100581842
218 Ga0068868_100238687
219 Ga0070660_100000339
220 Ga0070660_100002558
221 Ga0070660_100127236
222 Ga0070661_100000003
223 Ga0070661_100078101
224 Ga0070661_100134513
225 Ga0070661_100381526
226 Ga0070692_10000595
227 Ga0070692_10050565
228 Ga0070692_10076361
229 Ga0070669_100489247
230 Ga0070675_100012326
231 Ga0070675_100062495
232 Ga0070673_100028932
233 Ga0070673_100738165
234 Ga0070659_100000005
235 Ga0070659_100027965
236 Ga0070659_100077817
237 Ga0070659_100180206
238 Ga0070659_100245308
239 Ga0070659_100368737
240 Ga0070659_100578235
241 Ga0070659_100916508
242 Ga0070663_100001000
243 Ga0070663_100046359
244 Ga0070663_100250475
245 Ga0070662_100617785
246 Ga0070685_10259962
247 Ga0070679_100017106
248 Ga0070679_100204837
249 Ga0070679_100205398
250 Ga0070679_100281372
251 Ga0070679_100860653
252 Ga0070679_101205969
253 Ga0070684_100089044
254 Ga0070684_100234036
255 Ga0068853_100600924
256 Ga0070672_100464360
257 Ga0070686_100004892
258 Ga0070693_100289486
259 Ga0070665_100000317
260 Ga0068855_100000247
261 Ga0070664_100052112
262 Ga0068864_100650045
263 Ga0068866_10404278
264 Ga0068860_100066354
265 Ga0097621_101247286
266 Ga0105241_10228431
267 Ga0105248_11289404
268 Ga0105246_10353619
269 Ga0157373_10015874
270 Ga0157373_10084344
271 Ga0157373_10169656
272 Ga0157371_10000624
273 Ga0157371_10292741
274 Ga0157371_10416063
275 Ga0157370_10225180
276 Ga0157370_10939969
277 Ga0157370_10993897
278 Ga0157369_10048695
279 Ga0157369_10785055
280 Ga0157369_11141291
281 Ga0157374_10754433
282 Ga0157374_11057034
283 Ga0157375_10320765
284 Ga0213873_10000016
285 Ga0213876_10000056
286 Ga0213876_10008856
287 Ga0207682_10016259
288 Ga0207647_10035397
289 Ga0207647_10180432
290 Ga0207645_10025976
291 Ga0207645_10114852
292 Ga0207705_10000005
293 Ga0207705_10000082
294 Ga0207705_10014881
295 Ga0207705_10181592
296 Ga0207705_10256358
297 Ga0207705_10332167
298 Ga0207705_10459822
299 Ga0207705_11063254
300 Ga0207660_10079864
301 Ga0207660_10290171
302 Ga0207660_10318755
303 Ga0207657_10000360
304 Ga0207657_10001108
305 Ga0207657_10001597
306 Ga0207657_10004093
307 Ga0207657_10802266
308 Ga0207649_10000016
309 Ga0207649_10067186
310 Ga0207652_10265375
311 Ga0207681_10429801
312 Ga0207650_10086326
313 Ga0207659_10036060
314 Ga0207659_10196692
315 Ga0207690_10000020
316 Ga0207690_10007351
317 Ga0207690_10016160
318 Ga0207690_10021390
319 Ga0207690_10148063
320 Ga0207690_10201983
321 Ga0207690_10486104
322 Ga0207690_10565233
323 Ga0207706_10000916
324 Ga0207706_10475886
325 Ga0207709_10091099
326 Ga0207691_10420028
327 Ga0207689_10070124
328 Ga0207689_10260712
329 Ga0207661_10159970
330 Ga0207667_10003833
331 Ga0207651_10191398
332 Ga0207651_10216963
333 Ga0207677_10000858
334 Ga0207639_10221005
335 Ga0207678_10002500
336 Ga0207678_10018695
337 Ga0207678_10054690
338 Ga0207678_10144629
339 Ga0207698_10156083
340 Ga0207698_10186112
341 Ga0268266_10000388
342 Ga0268264_10050137
343 Ga0307405_10074431
344 Ga0307413_10074900
345 Ga0307410_10022870
346 Ga0307410_10087869
347 Ga0307410_10135871
348 Ga0307406_10047423
349 Ga0307406_10063183
350 Ga0307407_10006809
351 Ga0307407_10060707
352 Ga0307412_10053518
353 Ga0307412_10345078
354 Ga0307412_10596790
355 Ga0307409_100070557
356 Ga0307409_100071865
357 Ga0307409_101487131
358 Ga0307416_100072203
359 Ga0307414_10072219
360 Ga0307414_10588482
361 Ga0307411_10002818
362 Ga0307415_100048278
363 Ga0395899_0000340
364 Ga0395899_0090418
365 Ga0395900_0000794
366 Ga0395900_0128977
367 Ga0395900_0437116
368 Ga0395898_0007116
369 Ga0395898_0450152
370 Ga0395905_0100990
371 Ga0395905_0121023
372 Ga0436364_1100721
373 Ga0395901_0000031
374 Ga0395901_0046926
375 Ga0395901_0136178
376 Ga0395901_0569707
377 Ga0436365_0869628
378 Ga0436365_1021285
379 Ga0436365_1574836
380 Ga0436363_0534528
381 Ga0436362_0580304
382 Ga0439432_057901
383 Ga0439432_067106
384 Ga0439449_0075692
385 Ga0450890_033503
386 Ga0466966_0645545
387 Ga0466961_0065739
388 Ga0466964_0009399
389 Ga0466968_0017208
390 Ga0466970_0016574
391 Ga0466959_0106155
392 Ga0466958_0010586
393 Ga0466967_0022531
394 Ga0466967_0696690
395 Ga0495625_0137145
396 Ga0496103_0043492
397 Ga0496106_0219871
398 Ga0496108_0001150
399 Ga0501069_0512730
400 Ga0495655_0094672
401 Ga0500611_153206
402 Ga0500587_027363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06041

DUF924

Bacterial protein of unknown function (DUF924)

16

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6h-assembly1.cif.gz_B structure of protein of unknown function atu0120 from agrobacterium tumefaciens 0.8929 6 177
2i6h-assembly1.cif.gz_B structure of protein of unknown function atu0120 from agrobacterium tumefaciens 0.8645 6 177
1pc2-assembly1.cif.gz_A solution structure of human mitochondria fission protein fis1 0.5197 40 151
4epz-assembly1.cif.gz_A crystal structure of a transcription anti-terminator antagonist upxz (bacuni_04315) from bacteroides uniformis atcc 8492 at 1.68 a resolution 0.4945 3 152
1nzn-assembly1.cif.gz_A cytosolic domain of the human mitchondrial fission protein fis1 adopts a tpr fold 0.4894 26 151
ID Description Score Start End Superfamily
2i6hB02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9023 81 177 1.25.40.10
2i6hB02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8936 81 177 1.25.40.10
af_A0A1D6IPQ0_408_508_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5651 54 151 1.25.40.10
af_A0A0P0X1M5_204_347_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5495 27 150 1.25.40.10
af_Q3E9N1_453_559_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5377 86 152 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A4Q6CYM2-F1-model_v4 deleted 0.9869 89 172
AF-A0A4Q6D462-F1-model_v4 deleted 0.9793 100 172
AF-A0A3B1AB89-F1-model_v4 FIG027190: Putative transmembrane protein 0.9716 99 172
AF-A0A3R9WQS9-F1-model_v4 DUF924 domain-containing protein 0.9703 11 179
AF-A0A7H0G792-F1-model_v4 deleted 0.9696 3 179

Map