F308039

General Info

Members Datasets Scaffolds Average Seq Length
201 81 199 247

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10100963|Ga0065707_101009632
Length 263
Sequence MPTSILFRDLLLPKTVMNNLGIPPELIQVLQYSSRLVTLTGAGVSQESGLRTFRDAQTGLWSQYKPEELASPQAFARDPKLIWDWYAWRREAVKSVRPNAGHYALVEFEKRIPQFVLITQNVDGLHRMAGNQNVLELHGNIQRVRCSECYIFAETWGDDTESVPRCVVCGGLLRPDVVWFGEALPHAQLEAAVEAARTCDIFFSIGTSGVVRPAASLAHAARNRGAVVVEINAEPTPLTPKADYFLQGKSGEILPDLVHAVWG

Samples

Sample ID Description Type Environment
1 2643221611 Acidovorax sp. Root219 Isolate Unclassified
2 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
27 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
28 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
39 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
42 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
43 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
44 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
45 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
46 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
49 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
50 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
51 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
52 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
53 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
54 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
55 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
56 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
57 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
58 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
66 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
67 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
68 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
69 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
70 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
71 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
72 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
73 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
75 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
76 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
77 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
78 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
79 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
80 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
81 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 1
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10215171 3300005293 Unclassified 1296
2 Ga0065707_10000492 3300005295 Bacteria 70979
3 Ga0065707_10083464 3300005295 Bacteria 9079
4 Ga0065707_10100963 3300005295 Unclassified 2893
5 Ga0065707_10111377 3300005295 Bacteria 2397
6 Ga0070680_100239027 3300005336 Bacteria 1535
7 Ga0070689_100089516 3300005340 Bacteria 2424
8 Ga0070689_100465646 3300005340 Unclassified 1078
9 Ga0070694_100111333 3300005444 Bacteria 1951
10 Ga0070698_100037584 3300005471 Bacteria 4991
11 Ga0070698_100129695 3300005471 Unclassified 2478
12 Ga0070698_100557039 3300005471 Bacteria 1086
13 Ga0070699_100002718 3300005518 Bacteria 15769
14 Ga0070699_100138827 3300005518 Unclassified 2145
15 Ga0070699_100313014 3300005518 Bacteria 1410
16 Ga0068859_100101595 3300005617 Unclassified 2933
17 Ga0068864_100128792 3300005618 Unclassified 2271
18 Ga0068861_100141546 3300005719 Bacteria 1964
19 Ga0068862_100045936 3300005844 Unclassified 3727
20 Ga0068862_100213108 3300005844 Bacteria 1746
21 Ga0081539_10013165 3300005985 Bacteria 6267
22 Ga0075428_100019534 3300006844 Bacteria 7498
23 Ga0075430_100067114 3300006846 Unclassified 3012
24 Ga0075430_100306346 3300006846 Unclassified 1314
25 Ga0075431_100095949 3300006847 Bacteria 3061
26 Ga0075434_100217413 3300006871 Bacteria 1931
27 Ga0075429_100008238 3300006880 Bacteria 9063
28 Ga0075429_100012637 3300006880 Bacteria 7322
29 Ga0075429_100016211 3300006880 Bacteria 6457
30 Ga0075429_100380572 3300006880 Bacteria 1236
31 Ga0097620_100101589 3300006931 Unclassified 2933
32 Ga0111539_10852374 3300009094 Bacteria 1060
33 Ga0114129_10001958 3300009147 Bacteria 28176
34 Ga0114129_10018959 3300009147 Bacteria 9801
35 Ga0114129_10088802 3300009147 Bacteria 4285
36 Ga0114129_10232060 3300009147 Bacteria 2485
37 Ga0105243_10081169 3300009148 Bacteria 2647
38 Ga0105243_10288110 3300009148 Bacteria 1482
39 Ga0105242_10939549 3300009176 Bacteria 868
40 Ga0105249_10064936 3300009553 Unclassified 3356
41 Ga0105249_10204071 3300009553 Bacteria 1936
42 Ga0157380_10022663 3300014326 Bacteria 4734
43 Ga0157380_10448326 3300014326 Bacteria 1238
44 Ga0157379_10663477 3300014968 Unclassified 977
45 Ga0207643_10217267 3300025908 Unclassified 1169
46 Ga0207660_10201197 3300025917 Bacteria 1556
47 Ga0207646_10123055 3300025922 Bacteria 2332
48 Ga0207709_10015491 3300025935 Unclassified 4228
49 Ga0207709_10146851 3300025935 Bacteria 1628
50 Ga0207670_10627418 3300025936 Unclassified 884
51 Ga0207708_10083567 3300026075 Bacteria 2455
52 Ga0207676_10162799 3300026095 Unclassified 1935
53 Ga0207674_10197343 3300026116 Bacteria 1962
54 Ga0207675_100023321 3300026118 Bacteria 5755
55 Ga0268265_10033391 3300028380 Unclassified 3741
56 Ga0316575_10001425 3300031665 Bacteria 7687
57 Ga0316575_10002166 3300031665 Bacteria 6551
58 Ga0316579_10000747 3300031691 Bacteria 11131
59 Ga0316579_10001336 3300031691 Bacteria 8911
60 Ga0316579_10002147 3300031691 Bacteria 7401
61 Ga0316579_10021959 3300031691 Unclassified 2850
62 Ga0316579_10175582 3300031691 Bacteria 1035
63 Ga0316576_10003773 3300031727 Bacteria 8952
64 Ga0316576_10005065 3300031727 Bacteria 7984
65 Ga0316576_10042338 3300031727 Bacteria 3281
66 Ga0316576_10088102 3300031727 Bacteria 2310
67 Ga0316576_10383822 3300031727 Bacteria 1043
68 Ga0316578_10001010 3300031728 Bacteria 10773
69 Ga0316578_10003243 3300031728 Bacteria 7385
70 Ga0316578_10016639 3300031728 Bacteria 3984
71 Ga0316578_10030436 3300031728 Unclassified 3069
72 Ga0316578_10060365 3300031728 Bacteria 2232
73 Ga0316578_10065777 3300031728 Bacteria 2141
74 Ga0316578_10144131 3300031728 Unclassified 1434
75 Ga0316578_10150082 3300031728 Unclassified 1404
76 Ga0316577_10012580 3300031733 Bacteria 4611
77 Ga0316577_10013230 3300031733 Bacteria 4506
78 Ga0316577_10014338 3300031733 Bacteria 4350
79 Ga0316577_10020983 3300031733 Bacteria 3621
80 Ga0316577_10037272 3300031733 Bacteria 2719
81 Ga0316583_10000119 3300032133 Bacteria 18393
82 Ga0316583_10002280 3300032133 Bacteria 6607
83 Ga0316583_10007395 3300032133 Bacteria 3954
84 Ga0316583_10008320 3300032133 Unclassified 3741
85 Ga0316583_10028489 3300032133 Bacteria 1991
86 Ga0316585_10001676 3300032137 Bacteria 5879
87 Ga0316585_10003860 3300032137 Bacteria 4148
88 Ga0316585_10043291 3300032137 Bacteria 1437
89 Ga0316580_10000701 3300032139 Bacteria 8047
90 Ga0316580_10000916 3300032139 Bacteria 7290
91 Ga0316580_10000963 3300032139 Bacteria 7166
92 Ga0316580_10004911 3300032139 Bacteria 3887
93 Ga0316588_1018320 3300033528 Bacteria 1567
94 Ga0316596_1010622 3300033541 Bacteria 2234
95 Ga0316574_0000407 3300035398 Bacteria 16967
96 Ga0316574_0002570 3300035398 Bacteria 9139
97 Ga0316582_0000737 3300036647 Bacteria 13068
98 Ga0316582_0002255 3300036647 Bacteria 8980
99 Ga0316582_0002893 3300036647 Bacteria 8244
100 Ga0316582_0016662 3300036647 Bacteria 4232
101 Ga0316582_0044654 3300036647 Unclassified 2787
102 Ga0316582_0139664 3300036647 Bacteria 1633
103 Ga0316582_0377529 3300036647 Bacteria 976
104 Ga0316582_0544748 3300036647 Bacteria 799
105 Ga0316584_0002863 3300036712 Bacteria 11060
106 Ga0316584_0005681 3300036712 Bacteria 8394
107 Ga0316584_0009325 3300036712 Bacteria 6806
108 Ga0316584_0013897 3300036712 Bacteria 5712
109 Ga0316584_0024340 3300036712 Bacteria 4431
110 Ga0316584_0054593 3300036712 Bacteria 2990
111 Ga0316584_0088283 3300036712 Bacteria 2321
112 Ga0316584_0089600 3300036712 Bacteria 2303
113 Ga0316584_0104110 3300036712 Bacteria 2124
114 Ga0316584_0246775 3300036712 Bacteria 1305
115 Ga0316581_0003871 3300037588 Bacteria 3770
116 Ga0451577_0005877 3300042876 Bacteria 12406
117 Ga0451577_0009887 3300042876 Bacteria 9142
118 Ga0451577_0043919 3300042876 Bacteria 4002
119 Ga0451577_0059092 3300042876 Bacteria 3419
120 Ga0451577_0260564 3300042876 Bacteria 1570
121 Ga0453683_0000599 3300044673 Bacteria 39641
122 Ga0453683_0006987 3300044673 Bacteria 7695
123 Ga0453683_0026938 3300044673 Bacteria 3649
124 Ga0453683_0205386 3300044673 Unclassified 1251
125 Ga0453683_0297405 3300044673 Bacteria 1032
126 Ga0453683_0350430 3300044673 Unclassified 948
127 Ga0453684_0000430 3300044712 Bacteria 171415
128 Ga0453684_0000458 3300044712 Bacteria 163146
129 Ga0453684_0004211 3300044712 Bacteria 30898
130 Ga0453684_0011609 3300044712 Bacteria 14716
131 Ga0453684_0019293 3300044712 Bacteria 10392
132 Ga0453684_0081291 3300044712 Unclassified 4042
133 Ga0453684_0098170 3300044712 Bacteria 3592
134 Ga0453684_0109919 3300044712 Bacteria 3351
135 Ga0453684_0129044 3300044712 Bacteria 3036
136 Ga0453684_0149003 3300044712 Bacteria 2783
137 Ga0453684_0179900 3300044712 Bacteria 2483
138 Ga0453684_0244683 3300044712 Unclassified 2063
139 Ga0453684_0263365 3300044712 Bacteria 1973
140 Ga0453684_0273950 3300044712 Bacteria 1927
141 Ga0453684_0288751 3300044712 Bacteria 1868
142 Ga0453684_0289082 3300044712 Unclassified 1867
143 Ga0453684_0339720 3300044712 Unclassified 1696
144 Ga0453684_0412628 3300044712 Bacteria 1510
145 Ga0453684_0868003 3300044712 Unclassified 968
146 Ga0451576_0004215 3300045051 Bacteria 18895
147 Ga0451576_0161577 3300045051 Bacteria 2338
148 Ga0451576_0165610 3300045051 Unclassified 2307
149 Ga0451576_0384260 3300045051 Unclassified 1472
150 Ga0451576_0793507 3300045051 Unclassified 994
151 Ga0495633_0000704 3300046558 Bacteria 30526
152 Ga0496125_0059814 3300048928 Bacteria 3067
153 Ga0501037_0461021 3300049573 Bacteria 866
154 Ga0501038_0059251 3300049574 Bacteria 3280
155 Ga0501040_0061908 3300049576 Bacteria 2574
156 Ga0501041_0002359 3300049577 Bacteria 10688
157 Ga0501041_0077661 3300049577 Archaea 2043
158 Ga0501043_0163611 3300049579 Bacteria 1738
159 Ga0501046_0066031 3300049580 Bacteria 2821
160 Ga0501048_0021263 3300049582 Bacteria 4751
161 Ga0501071_0011619 3300049587 Bacteria 5944
162 Ga0501072_0025772 3300049588 Bacteria 4581
163 Ga0501072_0039377 3300049588 Unclassified 3712
164 Ga0501072_0046942 3300049588 Unclassified 3401
165 Ga0501075_0009297 3300049591 Bacteria 6879
166 Ga0501075_0025091 3300049591 Bacteria 4377
167 Ga0501076_0004151 3300049592 Bacteria 10247
168 Ga0501076_0018979 3300049592 Bacteria 5247
169 Ga0501077_0013499 3300049593 Bacteria 5123
170 Ga0501077_0187562 3300049593 Unclassified 1314
171 Ga0501079_0020184 3300049741 Bacteria 5093
172 Ga0501079_0269814 3300049741 Bacteria 1330
173 Ga0501079_0613750 3300049741 Bacteria 856
174 Ga0501080_0012814 3300049742 Bacteria 7691
175 Ga0501080_0079135 3300049742 Bacteria 3056
176 Ga0501081_0140759 3300049743 Bacteria 1729
177 Ga0501035_0242632 3300049822 Bacteria 1532
178 Ga0501045_0017036 3300049824 Bacteria 5160
179 Ga0501045_0175400 3300049824 Bacteria 1597
180 nmdc:mga05p37_160149_c1 3300050507 Unclassified 2749
181 nmdc:mga05p37_193767_c1 3300050507 Bacteria 2466
182 nmdc:mga05p37_552976_c1 3300050507 Unclassified 1310
183 nmdc:mga05p37_69025_c1 3300050507 Bacteria 4347
184 nmdc:mga09592_12231_c1 3300050508 Bacteria 6988
185 nmdc:mga09592_258891_c1 3300050508 Unclassified 1509
186 nmdc:mga09592_318616_c1 3300050508 Bacteria 1347
187 nmdc:mga09592_381174_c1 3300050508 Bacteria 1219
188 nmdc:mga09592_74830_c1 3300050508 Unclassified 2878
189 nmdc:mga06r32_288329_c1 3300050510 Bacteria 1628
190 nmdc:mga06r32_943370_c1 3300050510 Unclassified 818
191 nmdc:mga0a205_253599_c1 3300050515 Bacteria 1638
192 Ga0501084_0058260 3300054114 Bacteria 3232
193 Ga0501084_0091228 3300054114 Bacteria 2558
194 Ga0501084_0136864 3300054114 Unclassified 2062
195 Ga0501082_0036361 3300060353 Bacteria 4242
196 Ga0501082_0185680 3300060353 Bacteria 1809
197 Ga0501082_0233432 3300060353 Bacteria 1601
198 Ga0501082_0260779 3300060353 Bacteria 1508
199 Ga0530510_0012557 3300061734 Bacteria 5953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0544748 Ga0316582_0544748_40_639 196
2 3300005340 Ga0070689_100465646 Ga0070689_1004656461 214
3 3300025936 Ga0207670_10627418 Ga0207670_106274181 214
4 3300049741 Ga0501079_0613750 Ga0501079_0613750_44_808 222
5 3300060353 Ga0501082_0260779 Ga0501082_0260779_353_1117 222
6 3300009147 Ga0114129_10001958 Ga0114129_100019586 226
7 3300050507 nmdc:mga05p37_552976_c1 nmdc:mga05p37_552976_c1_610_1290 226
8 3300050510 nmdc:mga06r32_288329_c1 nmdc:mga06r32_288329_c1_893_1573 226
9 3300031665 Ga0316575_10002166 Ga0316575_100021663 230
10 3300031691 Ga0316579_10001336 Ga0316579_100013362 230
11 3300031727 Ga0316576_10005065 Ga0316576_100050652 230
12 3300031727 Ga0316576_10042338 Ga0316576_100423383 230
13 3300031728 Ga0316578_10001010 Ga0316578_100010108 230
14 3300031728 Ga0316578_10065777 Ga0316578_100657772 230
15 3300031728 Ga0316578_10144131 Ga0316578_101441312 230
16 3300031733 Ga0316577_10014338 Ga0316577_100143384 230
17 3300031733 Ga0316577_10020983 Ga0316577_100209833 230
18 3300032133 Ga0316583_10002280 Ga0316583_100022803 230
19 3300032133 Ga0316583_10008320 Ga0316583_100083202 230
20 3300032133 Ga0316583_10028489 Ga0316583_100284892 230
21 3300032137 Ga0316585_10001676 Ga0316585_100016765 230
22 3300032139 Ga0316580_10000701 Ga0316580_100007015 230
23 3300032139 Ga0316580_10000916 Ga0316580_100009163 230
24 3300033528 Ga0316588_1018320 Ga0316588_10183202 230
25 iso_pu_bacteria 2643221611 2644076645 232
26 3300046558 Ga0495633_0000704 Ga0495633_0000704_7660_8400 235
27 3300009176 Ga0105242_10939549 Ga0105242_109395491 237
28 3300031691 Ga0316579_10000747 Ga0316579_100007476 237
29 3300031691 Ga0316579_10002147 Ga0316579_100021473 237
30 3300031727 Ga0316576_10088102 Ga0316576_100881022 237
31 3300031728 Ga0316578_10150082 Ga0316578_101500822 237
32 3300031733 Ga0316577_10013230 Ga0316577_100132303 237
33 3300032133 Ga0316583_10000119 Ga0316583_1000011912 237
34 3300032137 Ga0316585_10003860 Ga0316585_100038603 237
35 3300032139 Ga0316580_10000963 Ga0316580_100009635 237
36 3300032139 Ga0316580_10004911 Ga0316580_100049113 237
37 3300033541 Ga0316596_1010622 Ga0316596_10106222 237
38 3300035398 Ga0316574_0000407 Ga0316574_0000407_10251_10997 237
39 3300036647 Ga0316582_0002893 Ga0316582_0002893_5895_6641 237
40 3300036712 Ga0316584_0009325 Ga0316584_0009325_959_1705 237
41 3300036712 Ga0316584_0089600 Ga0316584_0089600_191_937 237
42 3300036712 Ga0316584_0246775 Ga0316584_0246775_36_776 238
43 3300014326 Ga0157380_10022663 Ga0157380_100226632 239
44 3300048928 Ga0496125_0059814 Ga0496125_0059814_1868_2641 239
45 3300031665 Ga0316575_10001425 Ga0316575_100014252 240
46 3300031691 Ga0316579_10175582 Ga0316579_101755822 240
47 3300031728 Ga0316578_10016639 Ga0316578_100166394 240
48 3300031733 Ga0316577_10012580 Ga0316577_100125803 240
49 3300032133 Ga0316583_10007395 Ga0316583_100073953 240
50 3300032137 Ga0316585_10043291 Ga0316585_100432912 240
51 3300036647 Ga0316582_0002255 Ga0316582_0002255_2833_3588 240
52 3300036712 Ga0316584_0005681 Ga0316584_0005681_5652_6407 240
53 3300036712 Ga0316584_0013897 Ga0316584_0013897_3647_4402 240
54 3300036712 Ga0316584_0104110 Ga0316584_0104110_524_1279 240
55 3300044712 Ga0453684_0263365 Ga0453684_0263365_1235_1957 240
56 iso_pu_bacteria 2932422444 2932423485 240
57 3300031728 Ga0316578_10060365 Ga0316578_100603652 241
58 3300035398 Ga0316574_0002570 Ga0316574_0002570_6326_7075 241
59 3300036647 Ga0316582_0000737 Ga0316582_0000737_10419_11168 241
60 3300036712 Ga0316584_0054593 Ga0316584_0054593_322_1071 241
61 3300031727 Ga0316576_10383822 Ga0316576_103838221 242
62 3300031733 Ga0316577_10037272 Ga0316577_100372723 242
63 3300036647 Ga0316582_0016662 Ga0316582_0016662_1726_2478 242
64 3300036712 Ga0316584_0088283 Ga0316584_0088283_204_956 242
65 3300042876 Ga0451577_0009887 Ga0451577_0009887_5971_6702 243
66 3300042876 Ga0451577_0043919 Ga0451577_0043919_1280_2011 243
67 3300044712 Ga0453684_0098170 Ga0453684_0098170_1685_2416 243
68 3300044712 Ga0453684_0868003 Ga0453684_0868003_78_809 243
69 3300045051 Ga0451576_0793507 Ga0451576_0793507_223_975 243
70 3300049743 Ga0501081_0140759 Ga0501081_0140759_241_972 243
71 3300050507 nmdc:mga05p37_160149_c1 nmdc:mga05p37_160149_c1_977_1729 243
72 3300005336 Ga0070680_100239027 Ga0070680_1002390272 244
73 3300005471 Ga0070698_100557039 Ga0070698_1005570391 244
74 3300005518 Ga0070699_100002718 Ga0070699_1000027186 244
75 3300005518 Ga0070699_100138827 Ga0070699_1001388272 244
76 3300005719 Ga0068861_100141546 Ga0068861_1001415462 244
77 3300005844 Ga0068862_100213108 Ga0068862_1002131082 244
78 3300006844 Ga0075428_100019534 Ga0075428_1000195344 244
79 3300006846 Ga0075430_100067114 Ga0075430_1000671144 244
80 3300006846 Ga0075430_100306346 Ga0075430_1003063462 244
81 3300006847 Ga0075431_100095949 Ga0075431_1000959492 244
82 3300006880 Ga0075429_100016211 Ga0075429_1000162112 244
83 3300006880 Ga0075429_100380572 Ga0075429_1003805722 244
84 3300009094 Ga0111539_10852374 Ga0111539_108523742 244
85 3300009147 Ga0114129_10018959 Ga0114129_100189597 244
86 3300009147 Ga0114129_10088802 Ga0114129_100888026 244
87 3300009148 Ga0105243_10288110 Ga0105243_102881102 244
88 3300009553 Ga0105249_10064936 Ga0105249_100649363 244
89 3300009553 Ga0105249_10204071 Ga0105249_102040712 244
90 3300025917 Ga0207660_10201197 Ga0207660_102011972 244
91 3300025935 Ga0207709_10015491 Ga0207709_100154915 244
92 3300026116 Ga0207674_10197343 Ga0207674_101973433 244
93 3300026118 Ga0207675_100023321 Ga0207675_1000233217 244
94 3300031691 Ga0316579_10021959 Ga0316579_100219592 244
95 3300031728 Ga0316578_10030436 Ga0316578_100304362 244
96 3300036647 Ga0316582_0044654 Ga0316582_0044654_128_862 244
97 3300036647 Ga0316582_0139664 Ga0316582_0139664_680_1450 244
98 3300037588 Ga0316581_0003871 Ga0316581_0003871_626_1360 244
99 3300042876 Ga0451577_0059092 Ga0451577_0059092_40_774 244
100 3300044673 Ga0453683_0350430 Ga0453683_0350430_101_835 244
101 3300044712 Ga0453684_0000458 Ga0453684_0000458_128415_129149 244
102 3300044712 Ga0453684_0129044 Ga0453684_0129044_458_1192 244
103 3300044712 Ga0453684_0149003 Ga0453684_0149003_1597_2331 244
104 3300044712 Ga0453684_0244683 Ga0453684_0244683_344_1078 244
105 3300044712 Ga0453684_0288751 Ga0453684_0288751_1001_1735 244
106 3300044712 Ga0453684_0339720 Ga0453684_0339720_734_1468 244
107 3300045051 Ga0451576_0384260 Ga0451576_0384260_32_766 244
108 3300050507 nmdc:mga05p37_193767_c1 nmdc:mga05p37_193767_c1_230_964 244
109 3300050507 nmdc:mga05p37_69025_c1 nmdc:mga05p37_69025_c1_1700_2440 244
110 3300050508 nmdc:mga09592_258891_c1 nmdc:mga09592_258891_c1_499_1233 244
111 3300050508 nmdc:mga09592_318616_c1 nmdc:mga09592_318616_c1_538_1278 244
112 3300050508 nmdc:mga09592_381174_c1 nmdc:mga09592_381174_c1_153_893 244
113 3300050510 nmdc:mga06r32_943370_c1 nmdc:mga06r32_943370_c1_22_756 244
114 3300042876 Ga0451577_0005877 Ga0451577_0005877_10937_11674 245
115 3300044673 Ga0453683_0006987 Ga0453683_0006987_3023_3760 245
116 3300044712 Ga0453684_0011609 Ga0453684_0011609_4429_5166 245
117 3300044712 Ga0453684_0019293 Ga0453684_0019293_1606_2343 245
118 3300044712 Ga0453684_0081291 Ga0453684_0081291_1943_2680 245
119 3300044712 Ga0453684_0109919 Ga0453684_0109919_581_1318 245
120 3300044712 Ga0453684_0179900 Ga0453684_0179900_1679_2416 245
121 3300044712 Ga0453684_0273950 Ga0453684_0273950_37_774 245
122 3300044712 Ga0453684_0289082 Ga0453684_0289082_505_1242 245
123 3300045051 Ga0451576_0165610 Ga0451576_0165610_857_1594 245
124 3300049573 Ga0501037_0461021 Ga0501037_0461021_108_845 245
125 3300049577 Ga0501041_0077661 Ga0501041_0077661_1220_1957 245
126 3300049588 Ga0501072_0046942 Ga0501072_0046942_349_1086 245
127 3300049591 Ga0501075_0025091 Ga0501075_0025091_2217_2954 245
128 3300049592 Ga0501076_0004151 Ga0501076_0004151_1977_2714 245
129 3300049741 Ga0501079_0269814 Ga0501079_0269814_508_1245 245
130 3300049742 Ga0501080_0079135 Ga0501080_0079135_791_1528 245
131 3300049824 Ga0501045_0175400 Ga0501045_0175400_511_1248 245
132 3300054114 Ga0501084_0058260 Ga0501084_0058260_1910_2647 245
133 3300060353 Ga0501082_0185680 Ga0501082_0185680_779_1516 245
134 3300036712 Ga0316584_0024340 Ga0316584_0024340_1674_2414 246
135 3300042876 Ga0451577_0260564 Ga0451577_0260564_666_1418 246
136 3300044712 Ga0453684_0004211 Ga0453684_0004211_25687_26430 246
137 3300044673 Ga0453683_0000599 Ga0453683_0000599_23135_23878 247
138 3300044673 Ga0453683_0026938 Ga0453683_0026938_1658_2401 247
139 3300045051 Ga0451576_0004215 Ga0451576_0004215_12006_12749 247
140 3300005985 Ga0081539_10013165 Ga0081539_100131656 248
141 3300031727 Ga0316576_10003773 Ga0316576_100037732 248
142 3300031728 Ga0316578_10003243 Ga0316578_100032437 248
143 3300036647 Ga0316582_0377529 Ga0316582_0377529_172_948 248
144 3300036712 Ga0316584_0002863 Ga0316584_0002863_6247_7032 248
145 3300044673 Ga0453683_0297405 Ga0453683_0297405_90_836 248
146 3300044712 Ga0453684_0000430 Ga0453684_0000430_82373_83125 248
147 3300049574 Ga0501038_0059251 Ga0501038_0059251_1062_1808 248
148 3300049576 Ga0501040_0061908 Ga0501040_0061908_1083_1829 248
149 3300049577 Ga0501041_0002359 Ga0501041_0002359_1038_1784 248
150 3300049579 Ga0501043_0163611 Ga0501043_0163611_10_756 248
151 3300049580 Ga0501046_0066031 Ga0501046_0066031_999_1745 248
152 3300049582 Ga0501048_0021263 Ga0501048_0021263_3188_3934 248
153 3300049587 Ga0501071_0011619 Ga0501071_0011619_1280_2026 248
154 3300049588 Ga0501072_0025772 Ga0501072_0025772_507_1253 248
155 3300049591 Ga0501075_0009297 Ga0501075_0009297_4668_5414 248
156 3300049592 Ga0501076_0018979 Ga0501076_0018979_3896_4642 248
157 3300049593 Ga0501077_0013499 Ga0501077_0013499_1197_1943 248
158 3300049741 Ga0501079_0020184 Ga0501079_0020184_235_981 248
159 3300049742 Ga0501080_0012814 Ga0501080_0012814_1266_2012 248
160 3300049822 Ga0501035_0242632 Ga0501035_0242632_621_1367 248
161 3300049824 Ga0501045_0017036 Ga0501045_0017036_818_1564 248
162 3300054114 Ga0501084_0091228 Ga0501084_0091228_1177_1923 248
163 3300060353 Ga0501082_0036361 Ga0501082_0036361_247_993 248
164 3300061734 Ga0530510_0012557 Ga0530510_0012557_1094_1840 248
165 3300005295 Ga0065707_10000492 Ga0065707_1000049217 249
166 3300005295 Ga0065707_10083464 Ga0065707_100834642 249
167 3300005295 Ga0065707_10100963 Ga0065707_101009632 249
168 3300005295 Ga0065707_10111377 Ga0065707_101113772 249
169 3300005340 Ga0070689_100089516 Ga0070689_1000895162 249
170 3300005444 Ga0070694_100111333 Ga0070694_1001113332 249
171 3300005471 Ga0070698_100037584 Ga0070698_1000375844 249
172 3300005471 Ga0070698_100129695 Ga0070698_1001296952 249
173 3300005518 Ga0070699_100313014 Ga0070699_1003130142 249
174 3300005617 Ga0068859_100101595 Ga0068859_1001015952 249
175 3300005618 Ga0068864_100128792 Ga0068864_1001287923 249
176 3300005844 Ga0068862_100045936 Ga0068862_1000459362 249
177 3300006871 Ga0075434_100217413 Ga0075434_1002174132 249
178 3300006880 Ga0075429_100008238 Ga0075429_1000082383 249
179 3300006931 Ga0097620_100101589 Ga0097620_1001015892 249
180 3300009147 Ga0114129_10232060 Ga0114129_102320602 249
181 3300009148 Ga0105243_10081169 Ga0105243_100811692 249
182 3300014326 Ga0157380_10448326 Ga0157380_104483262 249
183 3300014968 Ga0157379_10663477 Ga0157379_106634772 249
184 3300025908 Ga0207643_10217267 Ga0207643_102172672 249
185 3300025922 Ga0207646_10123055 Ga0207646_101230552 249
186 3300025935 Ga0207709_10146851 Ga0207709_101468512 249
187 3300026075 Ga0207708_10083567 Ga0207708_100835673 249
188 3300026095 Ga0207676_10162799 Ga0207676_101627992 249
189 3300028380 Ga0268265_10033391 Ga0268265_100333912 249
190 3300044712 Ga0453684_0412628 Ga0453684_0412628_184_933 249
191 3300045051 Ga0451576_0161577 Ga0451576_0161577_871_1635 249
192 3300049588 Ga0501072_0039377 Ga0501072_0039377_1724_2473 249
193 3300049593 Ga0501077_0187562 Ga0501077_0187562_376_1125 249
194 3300050508 nmdc:mga09592_12231_c1 nmdc:mga09592_12231_c1_5639_6388 249
195 3300050515 nmdc:mga0a205_253599_c1 nmdc:mga0a205_253599_c1_451_1200 249
196 3300054114 Ga0501084_0136864 Ga0501084_0136864_1172_1921 249
197 3300060353 Ga0501082_0233432 Ga0501082_0233432_245_994 249
198 3300044673 Ga0453683_0205386 Ga0453683_0205386_126_917 251
199 3300005293 Ga0065715_10215171 Ga0065715_102151711 253
200 3300006880 Ga0075429_100012637 Ga0075429_1000126376 253
201 3300050508 nmdc:mga09592_74830_c1 nmdc:mga09592_74830_c1_228_992 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

41

213

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m2j-assembly1.cif.gz_A sir2 homologue h80n mutant-adp ribose complex 0.9515 8 247
1m2h-assembly1.cif.gz_A sir2 homologue s24a mutant-adp ribose complex 0.942 8 247
1m2k-assembly1.cif.gz_A sir2 homologue f159a mutant-adp ribose complex 0.9395 8 247
1ici-assembly1.cif.gz_A crystal structure of a sir2 homolog-nad complex 0.934 7 247
1m2n-assembly1.cif.gz_B sir2 homologues (d102g/f159a/r170a) mutant-2'-o-acetyl adp ribose complex 0.9282 8 247
ID Description Score Start End Superfamily
1ma3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9615 11 247 3.40.50.1220
1iciA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9559 7 247 3.40.50.1220
4buzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9517 11 249 3.40.50.1220
3jwpA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9229 10 247 3.40.50.1220
af_Q68FX9_35_302_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9144 10 244 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A350WVR6-F1-model_v4 NAD-dependent protein deacylase 0.9787 101 250 GO:0017136
GO:0046872
GO:0070403
AF-A0A0N8PQV2-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9745 5 127 GO:0017136
GO:0070403
AF-A0A7C3H0X2-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9712 82 247 GO:0017136
GO:0046872
GO:0070403
AF-A0A367Z9B3-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9675 7 250 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A7C4K3U9-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9675 7 249 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222

Feature Viewer

pLDDT pTM Quality
90.56 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map