F307925
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 200 | 160 | 150 | 220 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8003856774|8003862598 |
| Length | 264 |
| Sequence | YQPLSDIAARTTPSRPHRVRPPPRPAGPRPSGGRIGLLTVLVLVVDSSTPAVTAALVEVSAEGVALRAGRCTVDARAHGELLAPQVDAVLAEAGARPADLAAIVAGLGPGPFTGLRVGLVTAAAMGQVLDIPTYGVCSLDAIGYPAAAGEPVLAASDARRRELYWAVYDGAGERIAGPNVDLPAEAAVRARDLGVTVAVGDGAHRYADTLGLPVRVEPRYPDPYALARLAAGRIRSGAPSEQLTPLYLRRPDAVAATGHKSVLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 4 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 5 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 6 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 7 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 8 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 9 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 10 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 11 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 12 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 13 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 14 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 15 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 16 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 17 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 18 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 19 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 20 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 21 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 22 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 23 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 24 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 25 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 26 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 27 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 28 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 29 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 30 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 31 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 32 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 33 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 34 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 35 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 36 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 37 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 38 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 39 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 40 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 41 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 42 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 70 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 71 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 72 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 85 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 86 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 87 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 88 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 89 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 90 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 91 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 92 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 93 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 94 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 95 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 96 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 97 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 98 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 99 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 102 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 103 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 104 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 105 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 106 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 107 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 108 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 109 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 110 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 111 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 112 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 113 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 114 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 115 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 116 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 117 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 118 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 119 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 122 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 123 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 124 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 125 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 126 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 127 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 130 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 131 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 132 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 133 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 134 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 135 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 136 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 137 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 146 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 147 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 148 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 149 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 150 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 151 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 152 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 153 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 154 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 155 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 156 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 157 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 158 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 159 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 160 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.5 |
| Metatranscriptomes | 0.5 |
| Isolates | 25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3 |
| Nodule | 2 |
| Rhizoplane | 13 |
| Rhizosphere | 58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000743 | 3300003203 | Bacteria | 15242 |
| 2 | Ga0068868_100118360 | 3300005338 | Bacteria | 2159 |
| 3 | Ga0070674_100081029 | 3300005356 | Bacteria | 2319 |
| 4 | Ga0070714_100000013 | 3300005435 | Bacteria | 211756 |
| 5 | Ga0070710_10000138 | 3300005437 | Bacteria | 33893 |
| 6 | Ga0070663_100158835 | 3300005455 | Bacteria | 1739 |
| 7 | Ga0070698_100219093 | 3300005471 | Bacteria | 1837 |
| 8 | Ga0068853_100049033 | 3300005539 | Bacteria | 3628 |
| 9 | Ga0068855_100984577 | 3300005563 | Bacteria | 887 |
| 10 | Ga0068857_100179669 | 3300005577 | Bacteria | 1926 |
| 11 | Ga0068857_100350680 | 3300005577 | Bacteria | 1367 |
| 12 | Ga0068852_100718771 | 3300005616 | Bacteria | 1010 |
| 13 | Ga0068859_100533932 | 3300005617 | Bacteria | 1268 |
| 14 | Ga0068861_100825212 | 3300005719 | Bacteria | 872 |
| 15 | Ga0068858_100661842 | 3300005842 | Bacteria | 1015 |
| 16 | Ga0081539_10000109 | 3300005985 | Bacteria | 193696 |
| 17 | Ga0081539_10000124 | 3300005985 | Bacteria | 180973 |
| 18 | Ga0075428_100009370 | 3300006844 | Bacteria | 10862 |
| 19 | Ga0075428_100111555 | 3300006844 | Bacteria | 2979 |
| 20 | Ga0075428_100340690 | 3300006844 | Bacteria | 1610 |
| 21 | Ga0075428_100454026 | 3300006844 | Bacteria | 1373 |
| 22 | Ga0075431_100082588 | 3300006847 | Bacteria | 3317 |
| 23 | Ga0075431_100133884 | 3300006847 | Bacteria | 2555 |
| 24 | Ga0075431_100145736 | 3300006847 | Bacteria | 2440 |
| 25 | Ga0075429_100020237 | 3300006880 | Bacteria | 5770 |
| 26 | Ga0105245_10021387 | 3300009098 | Bacteria | 5674 |
| 27 | Ga0114129_10000689 | 3300009147 | Bacteria | 42730 |
| 28 | Ga0114129_10003730 | 3300009147 | Bacteria | 21471 |
| 29 | Ga0114129_10084792 | 3300009147 | Bacteria | 4398 |
| 30 | Ga0105243_10001636 | 3300009148 | Bacteria | 19467 |
| 31 | Ga0105238_10044624 | 3300009551 | Bacteria | 4481 |
| 32 | Ga0105246_11007111 | 3300011119 | Bacteria | 755 |
| 33 | Ga0157369_10000734 | 3300013105 | Bacteria | 42304 |
| 34 | Ga0157374_10741468 | 3300013296 | Bacteria | 997 |
| 35 | Ga0157375_10081567 | 3300013308 | Bacteria | 3275 |
| 36 | Ga0157375_11065191 | 3300013308 | Bacteria | 945 |
| 37 | Ga0157376_10983203 | 3300014969 | Bacteria | 866 |
| 38 | Ga0213873_10023083 | 3300021358 | Bacteria | 1479 |
| 39 | Ga0213876_10029051 | 3300021384 | Bacteria | 2916 |
| 40 | Ga0213875_10000565 | 3300021388 | Bacteria | 30172 |
| 41 | Ga0213875_10033999 | 3300021388 | Bacteria | 2408 |
| 42 | Ga0224712_10002661 | 3300022467 | Bacteria | 4467 |
| 43 | Ga0207692_10000781 | 3300025898 | Bacteria | 11305 |
| 44 | Ga0207694_10505183 | 3300025924 | Bacteria | 1012 |
| 45 | Ga0207687_10028370 | 3300025927 | Bacteria | 3760 |
| 46 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 47 | Ga0207644_10495170 | 3300025931 | Bacteria | 1008 |
| 48 | Ga0207686_10833044 | 3300025934 | Bacteria | 741 |
| 49 | Ga0207709_10000994 | 3300025935 | Bacteria | 21122 |
| 50 | Ga0207669_10060321 | 3300025937 | Bacteria | 2325 |
| 51 | Ga0207677_10169149 | 3300026023 | Bacteria | 1707 |
| 52 | Ga0207678_10073874 | 3300026067 | Bacteria | 2922 |
| 53 | Ga0207674_10430189 | 3300026116 | Bacteria | 1276 |
| 54 | Ga0307515_10016487 | 3300028794 | Bacteria | 13517 |
| 55 | Ga0307511_10000759 | 3300030521 | Bacteria | 34421 |
| 56 | Ga0307511_10144108 | 3300030521 | Bacteria | 1389 |
| 57 | Ga0307512_10013047 | 3300030522 | Bacteria | 7807 |
| 58 | Ga0316177_1112617 | 3300030731 | Bacteria | 3330 |
| 59 | Ga0316176_1210957 | 3300030732 | Bacteria | 3205 |
| 60 | Ga0314311_1060393 | 3300030733 | Bacteria | 2919 |
| 61 | Ga0316180_1041349 | 3300030736 | Bacteria | 1654 |
| 62 | Ga0307513_10000002 | 3300031456 | Bacteria | 842612 |
| 63 | Ga0307513_10030990 | 3300031456 | Bacteria | 6063 |
| 64 | Ga0307513_10038880 | 3300031456 | Bacteria | 5280 |
| 65 | Ga0307405_10484067 | 3300031731 | Bacteria | 988 |
| 66 | Ga0307413_10278779 | 3300031824 | Bacteria | 1256 |
| 67 | Ga0307413_10315164 | 3300031824 | Bacteria | 1192 |
| 68 | Ga0307518_10020518 | 3300031838 | Bacteria | 4749 |
| 69 | Ga0307411_10004867 | 3300032005 | Bacteria | 6521 |
| 70 | Ga0307415_100103377 | 3300032126 | Bacteria | 2096 |
| 71 | Ga0373951_0000028 | 3300035091 | Bacteria | 58335 |
| 72 | Ga0373931_0134648 | 3300035691 | Bacteria | 1426 |
| 73 | Ga0373925_0058574 | 3300037068 | Bacteria | 2888 |
| 74 | Ga0395898_0025727 | 3300037466 | Bacteria | 5927 |
| 75 | Ga0395898_0174568 | 3300037466 | Bacteria | 2054 |
| 76 | Ga0395905_0004781 | 3300037471 | Bacteria | 13990 |
| 77 | Ga0436364_0182774 | 3300037853 | Bacteria | 34393 |
| 78 | Ga0436364_0768331 | 3300037853 | Bacteria | 2631 |
| 79 | Ga0436365_1074484 | 3300039437 | Bacteria | 2929 |
| 80 | Ga0436362_1099910 | 3300039453 | Bacteria | 2044 |
| 81 | Ga0439438_009202 | 3300041405 | Bacteria | 3213 |
| 82 | Ga0439439_0001365 | 3300041406 | Bacteria | 4824 |
| 83 | Ga0439449_0002833 | 3300042007 | Bacteria | 6745 |
| 84 | Ga0439449_0005382 | 3300042007 | Bacteria | 4904 |
| 85 | Ga0439449_0007797 | 3300042007 | Bacteria | 4065 |
| 86 | Ga0439457_004250 | 3300042014 | Bacteria | 3771 |
| 87 | Ga0466969_0008948 | 3300044656 | Bacteria | 5309 |
| 88 | Ga0466969_0071549 | 3300044656 | Bacteria | 1667 |
| 89 | Ga0466972_0001171 | 3300044658 | Bacteria | 12574 |
| 90 | Ga0466965_0004634 | 3300044683 | Bacteria | 6124 |
| 91 | Ga0466965_0029683 | 3300044683 | Bacteria | 2661 |
| 92 | Ga0466965_0052801 | 3300044683 | Bacteria | 2019 |
| 93 | Ga0466966_0006292 | 3300044684 | Bacteria | 7854 |
| 94 | Ga0466966_0078853 | 3300044684 | Bacteria | 2053 |
| 95 | Ga0466966_0203561 | 3300044684 | Bacteria | 1197 |
| 96 | Ga0466961_0021682 | 3300044693 | Bacteria | 4133 |
| 97 | Ga0466971_0017045 | 3300044719 | Bacteria | 3212 |
| 98 | Ga0466971_0051294 | 3300044719 | Bacteria | 1857 |
| 99 | Ga0466968_0009626 | 3300044735 | Bacteria | 3721 |
| 100 | Ga0466970_0007089 | 3300044765 | Bacteria | 5607 |
| 101 | Ga0466960_0020266 | 3300044901 | Bacteria | 2942 |
| 102 | Ga0466959_0025126 | 3300045049 | Bacteria | 4412 |
| 103 | Ga0466959_0039300 | 3300045049 | Bacteria | 3496 |
| 104 | Ga0496100_0003730 | 3300048903 | Bacteria | 7977 |
| 105 | Ga0496101_0041718 | 3300048904 | Bacteria | 3273 |
| 106 | Ga0496101_0046456 | 3300048904 | Bacteria | 3114 |
| 107 | Ga0496101_0771772 | 3300048904 | Unclassified | 758 |
| 108 | Ga0496102_0018328 | 3300048905 | Bacteria | 6150 |
| 109 | Ga0496102_0044825 | 3300048905 | Bacteria | 4014 |
| 110 | Ga0496102_0049231 | 3300048905 | Bacteria | 3833 |
| 111 | Ga0496103_0002402 | 3300048906 | Bacteria | 11787 |
| 112 | Ga0496103_0040026 | 3300048906 | Bacteria | 2881 |
| 113 | Ga0496104_0025756 | 3300048907 | Bacteria | 5424 |
| 114 | Ga0496105_0004900 | 3300048908 | Bacteria | 10120 |
| 115 | Ga0496106_0112505 | 3300048909 | Bacteria | 2121 |
| 116 | Ga0496107_0035568 | 3300048910 | Bacteria | 3570 |
| 117 | Ga0496108_0000043 | 3300048911 | Bacteria | 146005 |
| 118 | Ga0496108_0095978 | 3300048911 | Bacteria | 2525 |
| 119 | Ga0496108_0202263 | 3300048911 | Bacteria | 1724 |
| 120 | Ga0496109_0025021 | 3300048912 | Bacteria | 5315 |
| 121 | Ga0496109_0103343 | 3300048912 | Bacteria | 2644 |
| 122 | Ga0496110_0116651 | 3300048913 | Bacteria | 2404 |
| 123 | Ga0496111_0112072 | 3300048914 | Bacteria | 2010 |
| 124 | Ga0496112_0333863 | 3300048915 | Bacteria | 1460 |
| 125 | Ga0496113_0077348 | 3300048916 | Bacteria | 2544 |
| 126 | Ga0496114_0018777 | 3300048917 | Bacteria | 5595 |
| 127 | Ga0496114_0029198 | 3300048917 | Bacteria | 4530 |
| 128 | Ga0496115_0001472 | 3300048918 | Bacteria | 16914 |
| 129 | Ga0496115_0301078 | 3300048918 | Bacteria | 1314 |
| 130 | Ga0496121_0074739 | 3300048924 | Bacteria | 2709 |
| 131 | Ga0496126_0075522 | 3300048929 | Bacteria | 2991 |
| 132 | Ga0501033_0085391 | 3300049570 | Bacteria | 2312 |
| 133 | Ga0501038_0037662 | 3300049574 | Bacteria | 4240 |
| 134 | Ga0501068_0079083 | 3300049584 | Bacteria | 2016 |
| 135 | Ga0501070_0455171 | 3300049586 | Bacteria | 1032 |
| 136 | nmdc:mga05p37_422872_c1 | 3300050507 | Bacteria | 1550 |
| 137 | nmdc:mga09592_39055_c1 | 3300050508 | Bacteria | 3987 |
| 138 | nmdc:mga09592_42_c1 | 3300050508 | Bacteria | 71005 |
| 139 | nmdc:mga0qj67_2_c1 | 3300050509 | Bacteria | 181700 |
| 140 | nmdc:mga06r32_16627_c1 | 3300050510 | Bacteria | 6705 |
| 141 | nmdc:mga06r32_1_c1 | 3300050510 | Bacteria | 147976 |
| 142 | nmdc:mga06r32_37228_c1 | 3300050510 | Bacteria | 4603 |
| 143 | nmdc:mga06r32_457130_c1 | 3300050510 | Bacteria | 1256 |
| 144 | Ga0500644_0012664 | 3300053088 | Bacteria | 2338 |
| 145 | Ga0500646_0000265 | 3300053090 | Bacteria | 15988 |
| 146 | Ga0500577_0008918 | 3300053142 | Bacteria | 2885 |
| 147 | Ga0500588_0006522 | 3300053146 | Bacteria | 2650 |
| 148 | Ga0500589_078790 | 3300053147 | Bacteria | 1475 |
| 149 | Ga0500604_0118829 | 3300053151 | Bacteria | 883 |
| 150 | Ga0466962_0105625 | 3300061719 | Bacteria | 1354 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013308 | Ga0157375_11065191 | Ga0157375_110651912 | 172 |
| 2 | 3300048904 | Ga0496101_0771772 | Ga0496101_0771772_175_741 | 178 |
| 3 | 3300044684 | Ga0466966_0203561 | Ga0466966_0203561_20_652 | 187 |
| 4 | 3300053146 | Ga0500588_0006522 | Ga0500588_0006522_2043_2621 | 188 |
| 5 | 3300050507 | nmdc:mga05p37_422872_c1 | nmdc:mga05p37_422872_c1_913_1518 | 194 |
| 6 | 3300022467 | Ga0224712_10002661 | Ga0224712_100026615 | 197 |
| 7 | 3300025934 | Ga0207686_10833044 | Ga0207686_108330441 | 198 |
| 8 | iso_pu_bacteria | 2738543011 | 2739236372 | 199 |
| 9 | iso_pu_bacteria | 2889300758 | 2889305852 | 199 |
| 10 | iso_pu_bacteria | 2939743619 | 2939743989 | 199 |
| 11 | 3300014969 | Ga0157376_10983203 | Ga0157376_109832032 | 202 |
| 12 | 3300048903 | Ga0496100_0003730 | Ga0496100_0003730_3626_4258 | 202 |
| 13 | 3300048904 | Ga0496101_0041718 | Ga0496101_0041718_488_1120 | 202 |
| 14 | 3300048904 | Ga0496101_0046456 | Ga0496101_0046456_1396_2028 | 202 |
| 15 | 3300048905 | Ga0496102_0044825 | Ga0496102_0044825_1307_1939 | 202 |
| 16 | 3300048905 | Ga0496102_0049231 | Ga0496102_0049231_2189_2821 | 202 |
| 17 | 3300048906 | Ga0496103_0040026 | Ga0496103_0040026_117_749 | 202 |
| 18 | 3300048907 | Ga0496104_0025756 | Ga0496104_0025756_1279_1911 | 202 |
| 19 | 3300048908 | Ga0496105_0004900 | Ga0496105_0004900_4187_4819 | 202 |
| 20 | 3300048909 | Ga0496106_0112505 | Ga0496106_0112505_851_1483 | 202 |
| 21 | 3300048910 | Ga0496107_0035568 | Ga0496107_0035568_2625_3257 | 202 |
| 22 | 3300048911 | Ga0496108_0095978 | Ga0496108_0095978_1571_2203 | 202 |
| 23 | 3300048912 | Ga0496109_0025021 | Ga0496109_0025021_1074_1706 | 202 |
| 24 | 3300048913 | Ga0496110_0116651 | Ga0496110_0116651_862_1494 | 202 |
| 25 | 3300048917 | Ga0496114_0018777 | Ga0496114_0018777_164_796 | 202 |
| 26 | 3300048917 | Ga0496114_0029198 | Ga0496114_0029198_356_988 | 202 |
| 27 | 3300048918 | Ga0496115_0001472 | Ga0496115_0001472_5443_6075 | 202 |
| 28 | 3300048918 | Ga0496115_0301078 | Ga0496115_0301078_262_894 | 202 |
| 29 | 3300009148 | Ga0105243_10001636 | Ga0105243_1000163619 | 203 |
| 30 | 3300025935 | Ga0207709_10000994 | Ga0207709_100009946 | 203 |
| 31 | 3300030521 | Ga0307511_10144108 | Ga0307511_101441082 | 203 |
| 32 | 3300031456 | Ga0307513_10000002 | Ga0307513_1000000216 | 203 |
| 33 | 3300032126 | Ga0307415_100103377 | Ga0307415_1001033772 | 203 |
| 34 | 3300042007 | Ga0439449_0002833 | Ga0439449_0002833_4063_4701 | 203 |
| 35 | iso_pu_bacteria | 2791354901 | 2791915708 | 203 |
| 36 | 3300048911 | Ga0496108_0202263 | Ga0496108_0202263_1017_1655 | 204 |
| 37 | 3300048912 | Ga0496109_0103343 | Ga0496109_0103343_1683_2321 | 204 |
| 38 | 3300048916 | Ga0496113_0077348 | Ga0496113_0077348_280_918 | 204 |
| 39 | iso_pu_bacteria | 8057568493 | 8057569870 | 204 |
| 40 | 3300006847 | Ga0075431_100145736 | Ga0075431_1001457363 | 205 |
| 41 | 3300006880 | Ga0075429_100020237 | Ga0075429_1000202376 | 205 |
| 42 | 3300009147 | Ga0114129_10003730 | Ga0114129_1000373024 | 205 |
| 43 | 3300025931 | Ga0207644_10495170 | Ga0207644_104951702 | 205 |
| 44 | 3300050508 | nmdc:mga09592_39055_c1 | nmdc:mga09592_39055_c1_506_1159 | 205 |
| 45 | 3300050510 | nmdc:mga06r32_37228_c1 | nmdc:mga06r32_37228_c1_1323_1976 | 205 |
| 46 | iso_pu_bacteria | 2675903059 | 2676480186 | 205 |
| 47 | iso_pu_bacteria | 8056054917 | 8056057752 | 205 |
| 48 | 3300005455 | Ga0070663_100158835 | Ga0070663_1001588352 | 206 |
| 49 | 3300005563 | Ga0068855_100984577 | Ga0068855_1009845771 | 206 |
| 50 | 3300026067 | Ga0207678_10073874 | Ga0207678_100738742 | 206 |
| 51 | 3300031824 | Ga0307413_10278779 | Ga0307413_102787792 | 206 |
| 52 | iso_pu_bacteria | 2866612099 | 2866617001 | 206 |
| 53 | 3300005435 | Ga0070714_100000013 | Ga0070714_10000001364 | 207 |
| 54 | 3300025929 | Ga0207664_10000001 | Ga0207664_10000001571 | 207 |
| 55 | 3300041405 | Ga0439438_009202 | Ga0439438_009202_581_1231 | 207 |
| 56 | 3300041406 | Ga0439439_0001365 | Ga0439439_0001365_3331_3981 | 207 |
| 57 | 3300042007 | Ga0439449_0007797 | Ga0439449_0007797_3287_3937 | 207 |
| 58 | 3300042014 | Ga0439457_004250 | Ga0439457_004250_1855_2505 | 207 |
| 59 | 3300044684 | Ga0466966_0078853 | Ga0466966_0078853_892_1545 | 207 |
| 60 | 3300045049 | Ga0466959_0039300 | Ga0466959_0039300_853_1506 | 207 |
| 61 | 3300049570 | Ga0501033_0085391 | Ga0501033_0085391_1406_2104 | 207 |
| 62 | 3300049574 | Ga0501038_0037662 | Ga0501038_0037662_3061_3759 | 207 |
| 63 | iso_pu_bacteria | 2891326441 | 2891331451 | 207 |
| 64 | 3300005471 | Ga0070698_100219093 | Ga0070698_1002190932 | 208 |
| 65 | 3300005617 | Ga0068859_100533932 | Ga0068859_1005339322 | 208 |
| 66 | 3300028794 | Ga0307515_10016487 | Ga0307515_100164875 | 208 |
| 67 | 3300031456 | Ga0307513_10030990 | Ga0307513_100309903 | 208 |
| 68 | 3300035091 | Ga0373951_0000028 | Ga0373951_0000028_14359_15015 | 208 |
| 69 | 3300048911 | Ga0496108_0000043 | Ga0496108_0000043_137832_138488 | 208 |
| 70 | 3300053151 | Ga0500604_0118829 | Ga0500604_0118829_201_854 | 208 |
| 71 | 3300005577 | Ga0068857_100179669 | Ga0068857_1001796691 | 209 |
| 72 | 3300005719 | Ga0068861_100825212 | Ga0068861_1008252122 | 209 |
| 73 | 3300005842 | Ga0068858_100661842 | Ga0068858_1006618421 | 209 |
| 74 | 3300013296 | Ga0157374_10741468 | Ga0157374_107414682 | 209 |
| 75 | 3300037466 | Ga0395898_0174568 | Ga0395898_0174568_866_1522 | 209 |
| 76 | 3300044719 | Ga0466971_0051294 | Ga0466971_0051294_34_696 | 209 |
| 77 | 3300048905 | Ga0496102_0018328 | Ga0496102_0018328_5134_5796 | 209 |
| 78 | 3300048906 | Ga0496103_0002402 | Ga0496103_0002402_9492_10154 | 209 |
| 79 | 3300048924 | Ga0496121_0074739 | Ga0496121_0074739_872_1534 | 209 |
| 80 | 3300053090 | Ga0500646_0000265 | Ga0500646_0000265_14063_14719 | 209 |
| 81 | 3300005985 | Ga0081539_10000109 | Ga0081539_1000010933 | 210 |
| 82 | 3300031838 | Ga0307518_10020518 | Ga0307518_100205185 | 210 |
| 83 | 3300042007 | Ga0439449_0005382 | Ga0439449_0005382_2689_3348 | 210 |
| 84 | iso_pu_bacteria | 2501939600 | 2501943309 | 210 |
| 85 | iso_pu_bacteria | 2515154088 | 2515496628 | 210 |
| 86 | iso_pu_bacteria | 2515154137 | 2515756867 | 210 |
| 87 | iso_pu_bacteria | 2515154203 | 2516089405 | 210 |
| 88 | iso_pu_bacteria | 2622736626 | 2623584962 | 210 |
| 89 | iso_pu_bacteria | 2772190715 | 2772644967 | 210 |
| 90 | iso_pu_bacteria | 2831935698 | 2831941039 | 210 |
| 91 | iso_pu_bacteria | 2832004796 | 2832006135 | 210 |
| 92 | iso_pu_bacteria | 2855670206 | 2855672890 | 210 |
| 93 | iso_pu_bacteria | 2855676851 | 2855680228 | 210 |
| 94 | iso_pu_bacteria | 2856858025 | 2856858791 | 210 |
| 95 | iso_pu_bacteria | 2857288857 | 2857291249 | 210 |
| 96 | iso_pu_bacteria | 2858848962 | 2858849743 | 210 |
| 97 | iso_pu_bacteria | 2858868258 | 2858868968 | 210 |
| 98 | iso_pu_bacteria | 2858888857 | 2858890053 | 210 |
| 99 | iso_pu_bacteria | 2858895516 | 2858897705 | 210 |
| 100 | iso_pu_bacteria | 2858902515 | 2858903001 | 210 |
| 101 | iso_pu_bacteria | 2866065130 | 2866067379 | 210 |
| 102 | iso_pu_bacteria | 2867302475 | 2867307095 | 210 |
| 103 | iso_pu_bacteria | 2867312974 | 2867316518 | 210 |
| 104 | iso_pu_bacteria | 2867319477 | 2867321712 | 210 |
| 105 | iso_pu_bacteria | 2867507094 | 2867511996 | 210 |
| 106 | iso_pu_bacteria | 2869048445 | 2869048728 | 210 |
| 107 | iso_pu_bacteria | 2869061728 | 2869064454 | 210 |
| 108 | iso_pu_bacteria | 2869068681 | 2869074431 | 210 |
| 109 | iso_pu_bacteria | 2880489317 | 2880495304 | 210 |
| 110 | iso_pu_bacteria | 2880495981 | 2880497047 | 210 |
| 111 | iso_pu_bacteria | 2902582711 | 2902583682 | 210 |
| 112 | iso_pu_bacteria | 2929219909 | 2929225645 | 210 |
| 113 | iso_pu_bacteria | 2929226422 | 2929231379 | 210 |
| 114 | iso_pu_bacteria | 2996221748 | 2996223782 | 210 |
| 115 | iso_pu_bacteria | 649633069 | 649810701 | 210 |
| 116 | iso_pu_bacteria | 8054704163 | 8054706631 | 210 |
| 117 | iso_pu_bacteria | 8054727385 | 8054733763 | 210 |
| 118 | iso_pu_bacteria | 8054734606 | 8054740677 | 210 |
| 119 | 3300009098 | Ga0105245_10021387 | Ga0105245_100213876 | 211 |
| 120 | 3300021358 | Ga0213873_10023083 | Ga0213873_100230832 | 211 |
| 121 | 3300021384 | Ga0213876_10029051 | Ga0213876_100290513 | 211 |
| 122 | 3300021388 | Ga0213875_10000565 | Ga0213875_1000056511 | 211 |
| 123 | 3300021388 | Ga0213875_10033999 | Ga0213875_100339992 | 211 |
| 124 | 3300025927 | Ga0207687_10028370 | Ga0207687_100283703 | 211 |
| 125 | 3300037853 | Ga0436364_0182774 | Ga0436364_0182774_11984_12637 | 211 |
| 126 | 3300037853 | Ga0436364_0768331 | Ga0436364_0768331_1646_2299 | 211 |
| 127 | 3300039437 | Ga0436365_1074484 | Ga0436365_1074484_742_1395 | 211 |
| 128 | 3300039453 | Ga0436362_1099910 | Ga0436362_1099910_685_1338 | 211 |
| 129 | 3300048915 | Ga0496112_0333863 | Ga0496112_0333863_529_1200 | 211 |
| 130 | iso_pu_bacteria | 2855683550 | 2855685903 | 211 |
| 131 | iso_pu_bacteria | 2870721527 | 2870727504 | 211 |
| 132 | iso_pu_bacteria | 8047710418 | 8047717714 | 211 |
| 133 | 3300030522 | Ga0307512_10013047 | Ga0307512_100130476 | 212 |
| 134 | 3300006844 | Ga0075428_100009370 | Ga0075428_1000093706 | 213 |
| 135 | 3300006844 | Ga0075428_100340690 | Ga0075428_1003406902 | 213 |
| 136 | 3300006847 | Ga0075431_100133884 | Ga0075431_1001338843 | 213 |
| 137 | 3300009147 | Ga0114129_10000689 | Ga0114129_1000068935 | 213 |
| 138 | 3300013105 | Ga0157369_10000734 | Ga0157369_100007344 | 213 |
| 139 | 3300031456 | Ga0307513_10038880 | Ga0307513_100388806 | 213 |
| 140 | 3300050508 | nmdc:mga09592_42_c1 | nmdc:mga09592_42_c1_68220_68897 | 213 |
| 141 | 3300050509 | nmdc:mga0qj67_2_c1 | nmdc:mga0qj67_2_c1_30640_31317 | 213 |
| 142 | 3300050510 | nmdc:mga06r32_1_c1 | nmdc:mga06r32_1_c1_102092_102769 | 213 |
| 143 | 3300050510 | nmdc:mga06r32_457130_c1 | nmdc:mga06r32_457130_c1_95_763 | 213 |
| 144 | 3300006844 | Ga0075428_100111555 | Ga0075428_1001115552 | 214 |
| 145 | 3300006847 | Ga0075431_100082588 | Ga0075431_1000825884 | 214 |
| 146 | 3300009147 | Ga0114129_10084792 | Ga0114129_100847924 | 214 |
| 147 | 3300037466 | Ga0395898_0025727 | Ga0395898_0025727_3570_4253 | 214 |
| 148 | 3300037471 | Ga0395905_0004781 | Ga0395905_0004781_12652_13335 | 214 |
| 149 | 3300048929 | Ga0496126_0075522 | Ga0496126_0075522_884_1561 | 214 |
| 150 | 3300049584 | Ga0501068_0079083 | Ga0501068_0079083_1117_1794 | 214 |
| 151 | 3300050510 | nmdc:mga06r32_16627_c1 | nmdc:mga06r32_16627_c1_50_727 | 214 |
| 152 | 3300005577 | Ga0068857_100350680 | Ga0068857_1003506802 | 215 |
| 153 | 3300006844 | Ga0075428_100454026 | Ga0075428_1004540261 | 215 |
| 154 | 3300026116 | Ga0207674_10430189 | Ga0207674_104301892 | 215 |
| 155 | 3300044658 | Ga0466972_0001171 | Ga0466972_0001171_7027_7701 | 215 |
| 156 | 3300044683 | Ga0466965_0004634 | Ga0466965_0004634_3505_4179 | 215 |
| 157 | 3300044683 | Ga0466965_0029683 | Ga0466965_0029683_543_1217 | 215 |
| 158 | 3300044683 | Ga0466965_0052801 | Ga0466965_0052801_571_1245 | 215 |
| 159 | 3300044735 | Ga0466968_0009626 | Ga0466968_0009626_2206_2880 | 215 |
| 160 | 3300044901 | Ga0466960_0020266 | Ga0466960_0020266_2045_2719 | 215 |
| 161 | 3300049586 | Ga0501070_0455171 | Ga0501070_0455171_185_859 | 215 |
| 162 | 3300005338 | Ga0068868_100118360 | Ga0068868_1001183601 | 216 |
| 163 | 3300005356 | Ga0070674_100081029 | Ga0070674_1000810292 | 216 |
| 164 | 3300005616 | Ga0068852_100718771 | Ga0068852_1007187711 | 216 |
| 165 | 3300011119 | Ga0105246_11007111 | Ga0105246_110071111 | 216 |
| 166 | 3300013308 | Ga0157375_10081567 | Ga0157375_100815673 | 216 |
| 167 | 3300025937 | Ga0207669_10060321 | Ga0207669_100603212 | 216 |
| 168 | 3300026023 | Ga0207677_10169149 | Ga0207677_101691491 | 216 |
| 169 | 3300035691 | Ga0373931_0134648 | Ga0373931_0134648_225_899 | 216 |
| 170 | 3300048914 | Ga0496111_0112072 | Ga0496111_0112072_1239_1913 | 216 |
| 171 | 3300005437 | Ga0070710_10000138 | Ga0070710_100001386 | 217 |
| 172 | 3300025898 | Ga0207692_10000781 | Ga0207692_1000078110 | 217 |
| 173 | 3300030731 | Ga0316177_1112617 | Ga0316177_11126173 | 217 |
| 174 | 3300030732 | Ga0316176_1210957 | Ga0316176_12109572 | 217 |
| 175 | 3300030733 | Ga0314311_1060393 | Ga0314311_10603932 | 217 |
| 176 | 3300030736 | Ga0316180_1041349 | Ga0316180_10413492 | 217 |
| 177 | 3300032005 | Ga0307411_10004867 | Ga0307411_100048677 | 217 |
| 178 | iso_pu_bacteria | 2515154129 | 2515718370 | 217 |
| 179 | iso_pu_bacteria | 8003830390 | 8003832623 | 217 |
| 180 | iso_pu_bacteria | 8003856774 | 8003862598 | 217 |
| 181 | 3300005985 | Ga0081539_10000124 | Ga0081539_10000124149 | 219 |
| 182 | 3300031824 | Ga0307413_10315164 | Ga0307413_103151642 | 219 |
| 183 | 3300005539 | Ga0068853_100049033 | Ga0068853_1000490333 | 220 |
| 184 | 3300009551 | Ga0105238_10044624 | Ga0105238_100446244 | 220 |
| 185 | 3300025924 | Ga0207694_10505183 | Ga0207694_105051832 | 220 |
| 186 | 3300030521 | Ga0307511_10000759 | Ga0307511_100007594 | 220 |
| 187 | 3300037068 | Ga0373925_0058574 | Ga0373925_0058574_1877_2581 | 220 |
| 188 | 3300044656 | Ga0466969_0008948 | Ga0466969_0008948_2934_3638 | 220 |
| 189 | 3300044656 | Ga0466969_0071549 | Ga0466969_0071549_442_1146 | 220 |
| 190 | 3300044684 | Ga0466966_0006292 | Ga0466966_0006292_4364_5068 | 220 |
| 191 | 3300044693 | Ga0466961_0021682 | Ga0466961_0021682_3332_4036 | 220 |
| 192 | 3300044719 | Ga0466971_0017045 | Ga0466971_0017045_1451_2155 | 220 |
| 193 | 3300044765 | Ga0466970_0007089 | Ga0466970_0007089_853_1569 | 220 |
| 194 | 3300045049 | Ga0466959_0025126 | Ga0466959_0025126_3204_3908 | 220 |
| 195 | 3300053088 | Ga0500644_0012664 | Ga0500644_0012664_74_742 | 220 |
| 196 | 3300053142 | Ga0500577_0008918 | Ga0500577_0008918_1813_2481 | 220 |
| 197 | 3300061719 | Ga0466962_0105625 | Ga0466962_0105625_128_832 | 220 |
| 198 | 3300003203 | JGI25406J46586_10000743 | JGI25406J46586_1000074315 | 222 |
| 199 | 3300031731 | Ga0307405_10484067 | Ga0307405_104840671 | 222 |
| 200 | 3300053147 | Ga0500589_078790 | Ga0500589_078790_604_1272 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gel-assembly1.cif.gz_A | 2.05a crystal structure of salmonella typhimurium yeaz, form b | 0.8682 | 5 | 205 |
| 2gem-assembly1.cif.gz_A | 2.1a crystal structure of salmonella tyhpimurium yeaz, a putative gram-negative rpf, form-a | 0.851 | 5 | 205 |
| 4wq5-assembly2.cif.gz_C | ygjd(v85e)-yeaz heterodimer in complex with atp | 0.8414 | 5 | 213 |
| 3r6m-assembly2.cif.gz_C | crystal structure of vibrio parahaemolyticus yeaz | 0.8409 | 5 | 200 |
| 4y0w-assembly1.cif.gz_C-2 | yeaz from pseudomonas aeruginosa | 0.8378 | 4 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKY7_2_136_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9574 | 1 | 134 | 3.30.420.40 |
| 5br9C01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9524 | 4 | 98 | 3.30.420.40 |
| af_P76256_2_102_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9503 | 6 | 101 | 3.30.420.40 |
| af_Q2FWL0_1_92_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9407 | 5 | 96 | 3.30.420.40 |
| af_P9WKY7_2_136_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9368 | 1 | 134 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A440AU03-F1-model_v4 | N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) | 0.9694 | 5 | 94 |
GO:0002949
GO:0005829 GO:0046872 GO:0061711 |
| AF-C6J548-F1-model_v4 | Peptidase, M22 family | 0.9676 | 3 | 95 |
GO:0002949
GO:0005829 |
| AF-A0A7Y3ELP6-F1-model_v4 | tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | 0.9673 | 5 | 104 |
GO:0002949
GO:0005829 GO:0016740 |
| AF-A0A6L6EFQ1-F1-model_v4 | tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | 0.9631 | 6 | 105 |
GO:0002949
GO:0005829 GO:0016740 |
| AF-A0A3C1BE43-F1-model_v4 | tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | 0.9629 | 6 | 105 |
GO:0002949
GO:0005829 GO:0016740 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar