F307925

General Info

Members Datasets Scaffolds Average Seq Length
200 160 150 220

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8003856774|8003862598
Length 264
Sequence YQPLSDIAARTTPSRPHRVRPPPRPAGPRPSGGRIGLLTVLVLVVDSSTPAVTAALVEVSAEGVALRAGRCTVDARAHGELLAPQVDAVLAEAGARPADLAAIVAGLGPGPFTGLRVGLVTAAAMGQVLDIPTYGVCSLDAIGYPAAAGEPVLAASDARRRELYWAVYDGAGERIAGPNVDLPAEAAVRARDLGVTVAVGDGAHRYADTLGLPVRVEPRYPDPYALARLAAGRIRSGAPSEQLTPLYLRRPDAVAATGHKSVLP

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
6 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
7 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
8 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
9 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
10 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
11 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
12 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
13 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
14 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
15 2855683550 Micromonospora sp. RP3T Isolate Unclassified
16 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
17 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
18 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
19 2858868258 Micromonospora sp. MH33 Isolate Unclassified
20 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
21 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
22 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
23 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
24 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
25 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
26 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
27 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
28 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
29 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
30 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
31 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
32 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
33 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
34 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
35 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
36 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
37 2902582711 Micromonospora sp. AP08 Isolate Unclassified
38 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
39 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
40 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
41 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
42 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
86 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
87 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
88 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
89 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
90 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
106 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
107 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
108 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
148 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
149 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
150 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 649633069 Micromonospora sp. L5 Isolate Unclassified
153 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
154 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
155 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
156 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
157 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
158 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
159 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
160 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.5
Metatranscriptomes 0.5
Isolates 25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3
Nodule 2
Rhizoplane 13
Rhizosphere 58
Stem 0
Stem Tuber 0
Unclassified 24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000743 3300003203 Bacteria 15242
2 Ga0068868_100118360 3300005338 Bacteria 2159
3 Ga0070674_100081029 3300005356 Bacteria 2319
4 Ga0070714_100000013 3300005435 Bacteria 211756
5 Ga0070710_10000138 3300005437 Bacteria 33893
6 Ga0070663_100158835 3300005455 Bacteria 1739
7 Ga0070698_100219093 3300005471 Bacteria 1837
8 Ga0068853_100049033 3300005539 Bacteria 3628
9 Ga0068855_100984577 3300005563 Bacteria 887
10 Ga0068857_100179669 3300005577 Bacteria 1926
11 Ga0068857_100350680 3300005577 Bacteria 1367
12 Ga0068852_100718771 3300005616 Bacteria 1010
13 Ga0068859_100533932 3300005617 Bacteria 1268
14 Ga0068861_100825212 3300005719 Bacteria 872
15 Ga0068858_100661842 3300005842 Bacteria 1015
16 Ga0081539_10000109 3300005985 Bacteria 193696
17 Ga0081539_10000124 3300005985 Bacteria 180973
18 Ga0075428_100009370 3300006844 Bacteria 10862
19 Ga0075428_100111555 3300006844 Bacteria 2979
20 Ga0075428_100340690 3300006844 Bacteria 1610
21 Ga0075428_100454026 3300006844 Bacteria 1373
22 Ga0075431_100082588 3300006847 Bacteria 3317
23 Ga0075431_100133884 3300006847 Bacteria 2555
24 Ga0075431_100145736 3300006847 Bacteria 2440
25 Ga0075429_100020237 3300006880 Bacteria 5770
26 Ga0105245_10021387 3300009098 Bacteria 5674
27 Ga0114129_10000689 3300009147 Bacteria 42730
28 Ga0114129_10003730 3300009147 Bacteria 21471
29 Ga0114129_10084792 3300009147 Bacteria 4398
30 Ga0105243_10001636 3300009148 Bacteria 19467
31 Ga0105238_10044624 3300009551 Bacteria 4481
32 Ga0105246_11007111 3300011119 Bacteria 755
33 Ga0157369_10000734 3300013105 Bacteria 42304
34 Ga0157374_10741468 3300013296 Bacteria 997
35 Ga0157375_10081567 3300013308 Bacteria 3275
36 Ga0157375_11065191 3300013308 Bacteria 945
37 Ga0157376_10983203 3300014969 Bacteria 866
38 Ga0213873_10023083 3300021358 Bacteria 1479
39 Ga0213876_10029051 3300021384 Bacteria 2916
40 Ga0213875_10000565 3300021388 Bacteria 30172
41 Ga0213875_10033999 3300021388 Bacteria 2408
42 Ga0224712_10002661 3300022467 Bacteria 4467
43 Ga0207692_10000781 3300025898 Bacteria 11305
44 Ga0207694_10505183 3300025924 Bacteria 1012
45 Ga0207687_10028370 3300025927 Bacteria 3760
46 Ga0207664_10000001 3300025929 Bacteria 724213
47 Ga0207644_10495170 3300025931 Bacteria 1008
48 Ga0207686_10833044 3300025934 Bacteria 741
49 Ga0207709_10000994 3300025935 Bacteria 21122
50 Ga0207669_10060321 3300025937 Bacteria 2325
51 Ga0207677_10169149 3300026023 Bacteria 1707
52 Ga0207678_10073874 3300026067 Bacteria 2922
53 Ga0207674_10430189 3300026116 Bacteria 1276
54 Ga0307515_10016487 3300028794 Bacteria 13517
55 Ga0307511_10000759 3300030521 Bacteria 34421
56 Ga0307511_10144108 3300030521 Bacteria 1389
57 Ga0307512_10013047 3300030522 Bacteria 7807
58 Ga0316177_1112617 3300030731 Bacteria 3330
59 Ga0316176_1210957 3300030732 Bacteria 3205
60 Ga0314311_1060393 3300030733 Bacteria 2919
61 Ga0316180_1041349 3300030736 Bacteria 1654
62 Ga0307513_10000002 3300031456 Bacteria 842612
63 Ga0307513_10030990 3300031456 Bacteria 6063
64 Ga0307513_10038880 3300031456 Bacteria 5280
65 Ga0307405_10484067 3300031731 Bacteria 988
66 Ga0307413_10278779 3300031824 Bacteria 1256
67 Ga0307413_10315164 3300031824 Bacteria 1192
68 Ga0307518_10020518 3300031838 Bacteria 4749
69 Ga0307411_10004867 3300032005 Bacteria 6521
70 Ga0307415_100103377 3300032126 Bacteria 2096
71 Ga0373951_0000028 3300035091 Bacteria 58335
72 Ga0373931_0134648 3300035691 Bacteria 1426
73 Ga0373925_0058574 3300037068 Bacteria 2888
74 Ga0395898_0025727 3300037466 Bacteria 5927
75 Ga0395898_0174568 3300037466 Bacteria 2054
76 Ga0395905_0004781 3300037471 Bacteria 13990
77 Ga0436364_0182774 3300037853 Bacteria 34393
78 Ga0436364_0768331 3300037853 Bacteria 2631
79 Ga0436365_1074484 3300039437 Bacteria 2929
80 Ga0436362_1099910 3300039453 Bacteria 2044
81 Ga0439438_009202 3300041405 Bacteria 3213
82 Ga0439439_0001365 3300041406 Bacteria 4824
83 Ga0439449_0002833 3300042007 Bacteria 6745
84 Ga0439449_0005382 3300042007 Bacteria 4904
85 Ga0439449_0007797 3300042007 Bacteria 4065
86 Ga0439457_004250 3300042014 Bacteria 3771
87 Ga0466969_0008948 3300044656 Bacteria 5309
88 Ga0466969_0071549 3300044656 Bacteria 1667
89 Ga0466972_0001171 3300044658 Bacteria 12574
90 Ga0466965_0004634 3300044683 Bacteria 6124
91 Ga0466965_0029683 3300044683 Bacteria 2661
92 Ga0466965_0052801 3300044683 Bacteria 2019
93 Ga0466966_0006292 3300044684 Bacteria 7854
94 Ga0466966_0078853 3300044684 Bacteria 2053
95 Ga0466966_0203561 3300044684 Bacteria 1197
96 Ga0466961_0021682 3300044693 Bacteria 4133
97 Ga0466971_0017045 3300044719 Bacteria 3212
98 Ga0466971_0051294 3300044719 Bacteria 1857
99 Ga0466968_0009626 3300044735 Bacteria 3721
100 Ga0466970_0007089 3300044765 Bacteria 5607
101 Ga0466960_0020266 3300044901 Bacteria 2942
102 Ga0466959_0025126 3300045049 Bacteria 4412
103 Ga0466959_0039300 3300045049 Bacteria 3496
104 Ga0496100_0003730 3300048903 Bacteria 7977
105 Ga0496101_0041718 3300048904 Bacteria 3273
106 Ga0496101_0046456 3300048904 Bacteria 3114
107 Ga0496101_0771772 3300048904 Unclassified 758
108 Ga0496102_0018328 3300048905 Bacteria 6150
109 Ga0496102_0044825 3300048905 Bacteria 4014
110 Ga0496102_0049231 3300048905 Bacteria 3833
111 Ga0496103_0002402 3300048906 Bacteria 11787
112 Ga0496103_0040026 3300048906 Bacteria 2881
113 Ga0496104_0025756 3300048907 Bacteria 5424
114 Ga0496105_0004900 3300048908 Bacteria 10120
115 Ga0496106_0112505 3300048909 Bacteria 2121
116 Ga0496107_0035568 3300048910 Bacteria 3570
117 Ga0496108_0000043 3300048911 Bacteria 146005
118 Ga0496108_0095978 3300048911 Bacteria 2525
119 Ga0496108_0202263 3300048911 Bacteria 1724
120 Ga0496109_0025021 3300048912 Bacteria 5315
121 Ga0496109_0103343 3300048912 Bacteria 2644
122 Ga0496110_0116651 3300048913 Bacteria 2404
123 Ga0496111_0112072 3300048914 Bacteria 2010
124 Ga0496112_0333863 3300048915 Bacteria 1460
125 Ga0496113_0077348 3300048916 Bacteria 2544
126 Ga0496114_0018777 3300048917 Bacteria 5595
127 Ga0496114_0029198 3300048917 Bacteria 4530
128 Ga0496115_0001472 3300048918 Bacteria 16914
129 Ga0496115_0301078 3300048918 Bacteria 1314
130 Ga0496121_0074739 3300048924 Bacteria 2709
131 Ga0496126_0075522 3300048929 Bacteria 2991
132 Ga0501033_0085391 3300049570 Bacteria 2312
133 Ga0501038_0037662 3300049574 Bacteria 4240
134 Ga0501068_0079083 3300049584 Bacteria 2016
135 Ga0501070_0455171 3300049586 Bacteria 1032
136 nmdc:mga05p37_422872_c1 3300050507 Bacteria 1550
137 nmdc:mga09592_39055_c1 3300050508 Bacteria 3987
138 nmdc:mga09592_42_c1 3300050508 Bacteria 71005
139 nmdc:mga0qj67_2_c1 3300050509 Bacteria 181700
140 nmdc:mga06r32_16627_c1 3300050510 Bacteria 6705
141 nmdc:mga06r32_1_c1 3300050510 Bacteria 147976
142 nmdc:mga06r32_37228_c1 3300050510 Bacteria 4603
143 nmdc:mga06r32_457130_c1 3300050510 Bacteria 1256
144 Ga0500644_0012664 3300053088 Bacteria 2338
145 Ga0500646_0000265 3300053090 Bacteria 15988
146 Ga0500577_0008918 3300053142 Bacteria 2885
147 Ga0500588_0006522 3300053146 Bacteria 2650
148 Ga0500589_078790 3300053147 Bacteria 1475
149 Ga0500604_0118829 3300053151 Bacteria 883
150 Ga0466962_0105625 3300061719 Bacteria 1354

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_11065191 Ga0157375_110651912 172
2 3300048904 Ga0496101_0771772 Ga0496101_0771772_175_741 178
3 3300044684 Ga0466966_0203561 Ga0466966_0203561_20_652 187
4 3300053146 Ga0500588_0006522 Ga0500588_0006522_2043_2621 188
5 3300050507 nmdc:mga05p37_422872_c1 nmdc:mga05p37_422872_c1_913_1518 194
6 3300022467 Ga0224712_10002661 Ga0224712_100026615 197
7 3300025934 Ga0207686_10833044 Ga0207686_108330441 198
8 iso_pu_bacteria 2738543011 2739236372 199
9 iso_pu_bacteria 2889300758 2889305852 199
10 iso_pu_bacteria 2939743619 2939743989 199
11 3300014969 Ga0157376_10983203 Ga0157376_109832032 202
12 3300048903 Ga0496100_0003730 Ga0496100_0003730_3626_4258 202
13 3300048904 Ga0496101_0041718 Ga0496101_0041718_488_1120 202
14 3300048904 Ga0496101_0046456 Ga0496101_0046456_1396_2028 202
15 3300048905 Ga0496102_0044825 Ga0496102_0044825_1307_1939 202
16 3300048905 Ga0496102_0049231 Ga0496102_0049231_2189_2821 202
17 3300048906 Ga0496103_0040026 Ga0496103_0040026_117_749 202
18 3300048907 Ga0496104_0025756 Ga0496104_0025756_1279_1911 202
19 3300048908 Ga0496105_0004900 Ga0496105_0004900_4187_4819 202
20 3300048909 Ga0496106_0112505 Ga0496106_0112505_851_1483 202
21 3300048910 Ga0496107_0035568 Ga0496107_0035568_2625_3257 202
22 3300048911 Ga0496108_0095978 Ga0496108_0095978_1571_2203 202
23 3300048912 Ga0496109_0025021 Ga0496109_0025021_1074_1706 202
24 3300048913 Ga0496110_0116651 Ga0496110_0116651_862_1494 202
25 3300048917 Ga0496114_0018777 Ga0496114_0018777_164_796 202
26 3300048917 Ga0496114_0029198 Ga0496114_0029198_356_988 202
27 3300048918 Ga0496115_0001472 Ga0496115_0001472_5443_6075 202
28 3300048918 Ga0496115_0301078 Ga0496115_0301078_262_894 202
29 3300009148 Ga0105243_10001636 Ga0105243_1000163619 203
30 3300025935 Ga0207709_10000994 Ga0207709_100009946 203
31 3300030521 Ga0307511_10144108 Ga0307511_101441082 203
32 3300031456 Ga0307513_10000002 Ga0307513_1000000216 203
33 3300032126 Ga0307415_100103377 Ga0307415_1001033772 203
34 3300042007 Ga0439449_0002833 Ga0439449_0002833_4063_4701 203
35 iso_pu_bacteria 2791354901 2791915708 203
36 3300048911 Ga0496108_0202263 Ga0496108_0202263_1017_1655 204
37 3300048912 Ga0496109_0103343 Ga0496109_0103343_1683_2321 204
38 3300048916 Ga0496113_0077348 Ga0496113_0077348_280_918 204
39 iso_pu_bacteria 8057568493 8057569870 204
40 3300006847 Ga0075431_100145736 Ga0075431_1001457363 205
41 3300006880 Ga0075429_100020237 Ga0075429_1000202376 205
42 3300009147 Ga0114129_10003730 Ga0114129_1000373024 205
43 3300025931 Ga0207644_10495170 Ga0207644_104951702 205
44 3300050508 nmdc:mga09592_39055_c1 nmdc:mga09592_39055_c1_506_1159 205
45 3300050510 nmdc:mga06r32_37228_c1 nmdc:mga06r32_37228_c1_1323_1976 205
46 iso_pu_bacteria 2675903059 2676480186 205
47 iso_pu_bacteria 8056054917 8056057752 205
48 3300005455 Ga0070663_100158835 Ga0070663_1001588352 206
49 3300005563 Ga0068855_100984577 Ga0068855_1009845771 206
50 3300026067 Ga0207678_10073874 Ga0207678_100738742 206
51 3300031824 Ga0307413_10278779 Ga0307413_102787792 206
52 iso_pu_bacteria 2866612099 2866617001 206
53 3300005435 Ga0070714_100000013 Ga0070714_10000001364 207
54 3300025929 Ga0207664_10000001 Ga0207664_10000001571 207
55 3300041405 Ga0439438_009202 Ga0439438_009202_581_1231 207
56 3300041406 Ga0439439_0001365 Ga0439439_0001365_3331_3981 207
57 3300042007 Ga0439449_0007797 Ga0439449_0007797_3287_3937 207
58 3300042014 Ga0439457_004250 Ga0439457_004250_1855_2505 207
59 3300044684 Ga0466966_0078853 Ga0466966_0078853_892_1545 207
60 3300045049 Ga0466959_0039300 Ga0466959_0039300_853_1506 207
61 3300049570 Ga0501033_0085391 Ga0501033_0085391_1406_2104 207
62 3300049574 Ga0501038_0037662 Ga0501038_0037662_3061_3759 207
63 iso_pu_bacteria 2891326441 2891331451 207
64 3300005471 Ga0070698_100219093 Ga0070698_1002190932 208
65 3300005617 Ga0068859_100533932 Ga0068859_1005339322 208
66 3300028794 Ga0307515_10016487 Ga0307515_100164875 208
67 3300031456 Ga0307513_10030990 Ga0307513_100309903 208
68 3300035091 Ga0373951_0000028 Ga0373951_0000028_14359_15015 208
69 3300048911 Ga0496108_0000043 Ga0496108_0000043_137832_138488 208
70 3300053151 Ga0500604_0118829 Ga0500604_0118829_201_854 208
71 3300005577 Ga0068857_100179669 Ga0068857_1001796691 209
72 3300005719 Ga0068861_100825212 Ga0068861_1008252122 209
73 3300005842 Ga0068858_100661842 Ga0068858_1006618421 209
74 3300013296 Ga0157374_10741468 Ga0157374_107414682 209
75 3300037466 Ga0395898_0174568 Ga0395898_0174568_866_1522 209
76 3300044719 Ga0466971_0051294 Ga0466971_0051294_34_696 209
77 3300048905 Ga0496102_0018328 Ga0496102_0018328_5134_5796 209
78 3300048906 Ga0496103_0002402 Ga0496103_0002402_9492_10154 209
79 3300048924 Ga0496121_0074739 Ga0496121_0074739_872_1534 209
80 3300053090 Ga0500646_0000265 Ga0500646_0000265_14063_14719 209
81 3300005985 Ga0081539_10000109 Ga0081539_1000010933 210
82 3300031838 Ga0307518_10020518 Ga0307518_100205185 210
83 3300042007 Ga0439449_0005382 Ga0439449_0005382_2689_3348 210
84 iso_pu_bacteria 2501939600 2501943309 210
85 iso_pu_bacteria 2515154088 2515496628 210
86 iso_pu_bacteria 2515154137 2515756867 210
87 iso_pu_bacteria 2515154203 2516089405 210
88 iso_pu_bacteria 2622736626 2623584962 210
89 iso_pu_bacteria 2772190715 2772644967 210
90 iso_pu_bacteria 2831935698 2831941039 210
91 iso_pu_bacteria 2832004796 2832006135 210
92 iso_pu_bacteria 2855670206 2855672890 210
93 iso_pu_bacteria 2855676851 2855680228 210
94 iso_pu_bacteria 2856858025 2856858791 210
95 iso_pu_bacteria 2857288857 2857291249 210
96 iso_pu_bacteria 2858848962 2858849743 210
97 iso_pu_bacteria 2858868258 2858868968 210
98 iso_pu_bacteria 2858888857 2858890053 210
99 iso_pu_bacteria 2858895516 2858897705 210
100 iso_pu_bacteria 2858902515 2858903001 210
101 iso_pu_bacteria 2866065130 2866067379 210
102 iso_pu_bacteria 2867302475 2867307095 210
103 iso_pu_bacteria 2867312974 2867316518 210
104 iso_pu_bacteria 2867319477 2867321712 210
105 iso_pu_bacteria 2867507094 2867511996 210
106 iso_pu_bacteria 2869048445 2869048728 210
107 iso_pu_bacteria 2869061728 2869064454 210
108 iso_pu_bacteria 2869068681 2869074431 210
109 iso_pu_bacteria 2880489317 2880495304 210
110 iso_pu_bacteria 2880495981 2880497047 210
111 iso_pu_bacteria 2902582711 2902583682 210
112 iso_pu_bacteria 2929219909 2929225645 210
113 iso_pu_bacteria 2929226422 2929231379 210
114 iso_pu_bacteria 2996221748 2996223782 210
115 iso_pu_bacteria 649633069 649810701 210
116 iso_pu_bacteria 8054704163 8054706631 210
117 iso_pu_bacteria 8054727385 8054733763 210
118 iso_pu_bacteria 8054734606 8054740677 210
119 3300009098 Ga0105245_10021387 Ga0105245_100213876 211
120 3300021358 Ga0213873_10023083 Ga0213873_100230832 211
121 3300021384 Ga0213876_10029051 Ga0213876_100290513 211
122 3300021388 Ga0213875_10000565 Ga0213875_1000056511 211
123 3300021388 Ga0213875_10033999 Ga0213875_100339992 211
124 3300025927 Ga0207687_10028370 Ga0207687_100283703 211
125 3300037853 Ga0436364_0182774 Ga0436364_0182774_11984_12637 211
126 3300037853 Ga0436364_0768331 Ga0436364_0768331_1646_2299 211
127 3300039437 Ga0436365_1074484 Ga0436365_1074484_742_1395 211
128 3300039453 Ga0436362_1099910 Ga0436362_1099910_685_1338 211
129 3300048915 Ga0496112_0333863 Ga0496112_0333863_529_1200 211
130 iso_pu_bacteria 2855683550 2855685903 211
131 iso_pu_bacteria 2870721527 2870727504 211
132 iso_pu_bacteria 8047710418 8047717714 211
133 3300030522 Ga0307512_10013047 Ga0307512_100130476 212
134 3300006844 Ga0075428_100009370 Ga0075428_1000093706 213
135 3300006844 Ga0075428_100340690 Ga0075428_1003406902 213
136 3300006847 Ga0075431_100133884 Ga0075431_1001338843 213
137 3300009147 Ga0114129_10000689 Ga0114129_1000068935 213
138 3300013105 Ga0157369_10000734 Ga0157369_100007344 213
139 3300031456 Ga0307513_10038880 Ga0307513_100388806 213
140 3300050508 nmdc:mga09592_42_c1 nmdc:mga09592_42_c1_68220_68897 213
141 3300050509 nmdc:mga0qj67_2_c1 nmdc:mga0qj67_2_c1_30640_31317 213
142 3300050510 nmdc:mga06r32_1_c1 nmdc:mga06r32_1_c1_102092_102769 213
143 3300050510 nmdc:mga06r32_457130_c1 nmdc:mga06r32_457130_c1_95_763 213
144 3300006844 Ga0075428_100111555 Ga0075428_1001115552 214
145 3300006847 Ga0075431_100082588 Ga0075431_1000825884 214
146 3300009147 Ga0114129_10084792 Ga0114129_100847924 214
147 3300037466 Ga0395898_0025727 Ga0395898_0025727_3570_4253 214
148 3300037471 Ga0395905_0004781 Ga0395905_0004781_12652_13335 214
149 3300048929 Ga0496126_0075522 Ga0496126_0075522_884_1561 214
150 3300049584 Ga0501068_0079083 Ga0501068_0079083_1117_1794 214
151 3300050510 nmdc:mga06r32_16627_c1 nmdc:mga06r32_16627_c1_50_727 214
152 3300005577 Ga0068857_100350680 Ga0068857_1003506802 215
153 3300006844 Ga0075428_100454026 Ga0075428_1004540261 215
154 3300026116 Ga0207674_10430189 Ga0207674_104301892 215
155 3300044658 Ga0466972_0001171 Ga0466972_0001171_7027_7701 215
156 3300044683 Ga0466965_0004634 Ga0466965_0004634_3505_4179 215
157 3300044683 Ga0466965_0029683 Ga0466965_0029683_543_1217 215
158 3300044683 Ga0466965_0052801 Ga0466965_0052801_571_1245 215
159 3300044735 Ga0466968_0009626 Ga0466968_0009626_2206_2880 215
160 3300044901 Ga0466960_0020266 Ga0466960_0020266_2045_2719 215
161 3300049586 Ga0501070_0455171 Ga0501070_0455171_185_859 215
162 3300005338 Ga0068868_100118360 Ga0068868_1001183601 216
163 3300005356 Ga0070674_100081029 Ga0070674_1000810292 216
164 3300005616 Ga0068852_100718771 Ga0068852_1007187711 216
165 3300011119 Ga0105246_11007111 Ga0105246_110071111 216
166 3300013308 Ga0157375_10081567 Ga0157375_100815673 216
167 3300025937 Ga0207669_10060321 Ga0207669_100603212 216
168 3300026023 Ga0207677_10169149 Ga0207677_101691491 216
169 3300035691 Ga0373931_0134648 Ga0373931_0134648_225_899 216
170 3300048914 Ga0496111_0112072 Ga0496111_0112072_1239_1913 216
171 3300005437 Ga0070710_10000138 Ga0070710_100001386 217
172 3300025898 Ga0207692_10000781 Ga0207692_1000078110 217
173 3300030731 Ga0316177_1112617 Ga0316177_11126173 217
174 3300030732 Ga0316176_1210957 Ga0316176_12109572 217
175 3300030733 Ga0314311_1060393 Ga0314311_10603932 217
176 3300030736 Ga0316180_1041349 Ga0316180_10413492 217
177 3300032005 Ga0307411_10004867 Ga0307411_100048677 217
178 iso_pu_bacteria 2515154129 2515718370 217
179 iso_pu_bacteria 8003830390 8003832623 217
180 iso_pu_bacteria 8003856774 8003862598 217
181 3300005985 Ga0081539_10000124 Ga0081539_10000124149 219
182 3300031824 Ga0307413_10315164 Ga0307413_103151642 219
183 3300005539 Ga0068853_100049033 Ga0068853_1000490333 220
184 3300009551 Ga0105238_10044624 Ga0105238_100446244 220
185 3300025924 Ga0207694_10505183 Ga0207694_105051832 220
186 3300030521 Ga0307511_10000759 Ga0307511_100007594 220
187 3300037068 Ga0373925_0058574 Ga0373925_0058574_1877_2581 220
188 3300044656 Ga0466969_0008948 Ga0466969_0008948_2934_3638 220
189 3300044656 Ga0466969_0071549 Ga0466969_0071549_442_1146 220
190 3300044684 Ga0466966_0006292 Ga0466966_0006292_4364_5068 220
191 3300044693 Ga0466961_0021682 Ga0466961_0021682_3332_4036 220
192 3300044719 Ga0466971_0017045 Ga0466971_0017045_1451_2155 220
193 3300044765 Ga0466970_0007089 Ga0466970_0007089_853_1569 220
194 3300045049 Ga0466959_0025126 Ga0466959_0025126_3204_3908 220
195 3300053088 Ga0500644_0012664 Ga0500644_0012664_74_742 220
196 3300053142 Ga0500577_0008918 Ga0500577_0008918_1813_2481 220
197 3300061719 Ga0466962_0105625 Ga0466962_0105625_128_832 220
198 3300003203 JGI25406J46586_10000743 JGI25406J46586_1000074315 222
199 3300031731 Ga0307405_10484067 Ga0307405_104840671 222
200 3300053147 Ga0500589_078790 Ga0500589_078790_604_1272 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

72

196

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gel-assembly1.cif.gz_A 2.05a crystal structure of salmonella typhimurium yeaz, form b 0.8682 5 205
2gem-assembly1.cif.gz_A 2.1a crystal structure of salmonella tyhpimurium yeaz, a putative gram-negative rpf, form-a 0.851 5 205
4wq5-assembly2.cif.gz_C ygjd(v85e)-yeaz heterodimer in complex with atp 0.8414 5 213
3r6m-assembly2.cif.gz_C crystal structure of vibrio parahaemolyticus yeaz 0.8409 5 200
4y0w-assembly1.cif.gz_C-2 yeaz from pseudomonas aeruginosa 0.8378 4 199
ID Description Score Start End Superfamily
af_P9WKY7_2_136_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9574 1 134 3.30.420.40
5br9C01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9524 4 98 3.30.420.40
af_P76256_2_102_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9503 6 101 3.30.420.40
af_Q2FWL0_1_92_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9407 5 96 3.30.420.40
af_P9WKY7_2_136_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9368 1 134 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A440AU03-F1-model_v4 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 0.9694 5 94 GO:0002949
GO:0005829
GO:0046872
GO:0061711
AF-C6J548-F1-model_v4 Peptidase, M22 family 0.9676 3 95 GO:0002949
GO:0005829
AF-A0A7Y3ELP6-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9673 5 104 GO:0002949
GO:0005829
GO:0016740
AF-A0A6L6EFQ1-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9631 6 105 GO:0002949
GO:0005829
GO:0016740
AF-A0A3C1BE43-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9629 6 105 GO:0002949
GO:0005829
GO:0016740

Feature Viewer

pLDDT pTM Quality
93.88 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map