F307463

General Info

Members Datasets Scaffolds Average Seq Length
200 133 400 339

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000284|Ga0395899_0000284_41952_43118
Length 375
Sequence MCAHSIPCEYGDHLLCSRSLLEELSMTAAGKQIQAFCERFGLRVPILLAPMAGACPPSLSIAVANAGGLGACGALLMKPDEIAAWVAEVRKETTGPFQLNLWIPDPPPRRDAANEAAVRAFLSHWGPPVAPEAGDATPPDFEAQCEMLLAARPTAVSSIMGLYPRGFVDRLKAQGIAWFANVTTVAEAKAAEEAGADVVVAQGMEAGGHRGSFDAQLAERQQIGLFSLLPAVVDAVRLPVVATGGIADARGVAAALALGASAVQIGTGFLRSPEAKLHPAWAKALAETLPERTMLTRAFSGRAGRSVATDYALAVQRGLTAAMRKAAQERGDIGAMQAWAGQSAVLARALPAAEIVKSLWDGVALDHPVGKTETA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
133 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0.5
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 13
Rhizosphere 78
Stem 0
Stem Tuber 0
Unclassified 9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0000284 3300037312 Bacteria 65363
2 Ga0070658_10015516 3300005327 Bacteria 6092
3 Ga0070683_100223664 3300005329 Bacteria 1789
4 Ga0070670_100059011 3300005331 Bacteria 3294
5 Ga0070689_100167069 3300005340 Bacteria 1781
6 Ga0070689_100229250 3300005340 Unclassified 1526
7 Ga0070661_100009022 3300005344 Bacteria 6899
8 Ga0070661_100153057 3300005344 Bacteria 1744
9 Ga0070671_100124983 3300005355 Bacteria 2166
10 Ga0070659_100009356 3300005366 Bacteria 7196
11 Ga0070714_100095143 3300005435 Unclassified 2615
12 Ga0070714_100103307 3300005435 Bacteria 2514
13 Ga0070713_100194594 3300005436 Unclassified 1829
14 Ga0070678_100003195 3300005456 Bacteria 9094
15 Ga0070678_100042366 3300005456 Bacteria 3235
16 Ga0070681_10061918 3300005458 Unclassified 3716
17 Ga0070679_100396805 3300005530 Bacteria 1326
18 Ga0070684_100016006 3300005535 Bacteria 6125
19 Ga0070684_100143438 3300005535 Bacteria 2161
20 Ga0068853_100173629 3300005539 Bacteria 1951
21 Ga0070665_100096802 3300005548 Bacteria 2956
22 Ga0068855_100002300 3300005563 Bacteria 23617
23 Ga0070664_100196840 3300005564 Bacteria 1797
24 Ga0068857_100024714 3300005577 Bacteria 5292
25 Ga0068857_100025522 3300005577 Bacteria 5203
26 Ga0068854_100027669 3300005578 Bacteria 3910
27 Ga0068856_100008342 3300005614 Bacteria 10093
28 Ga0068856_100036091 3300005614 Bacteria 4847
29 Ga0068856_100051045 3300005614 Bacteria 4079
30 Ga0068856_100056391 3300005614 Bacteria 3877
31 Ga0068856_100090653 3300005614 Bacteria 3041
32 Ga0068852_100000191 3300005616 Bacteria 41609
33 Ga0068852_100068533 3300005616 Bacteria 3106
34 Ga0068852_100351070 3300005616 Bacteria 1440
35 Ga0068851_10067384 3300005834 Unclassified 1846
36 Ga0068860_100001118 3300005843 Bacteria 29537
37 Ga0070717_10042241 3300006028 Bacteria 3718
38 Ga0070717_10085738 3300006028 Unclassified 2651
39 Ga0075365_10146651 3300006038 Bacteria 1640
40 Ga0075363_100124353 3300006048 Unclassified 1443
41 Ga0075363_100149510 3300006048 Bacteria 1318
42 Ga0068871_100213217 3300006358 Bacteria 1671
43 Ga0075434_100171084 3300006871 Bacteria 2192
44 Ga0075436_100009497 3300006914 Bacteria 6653
45 Ga0105240_10000796 3300009093 Bacteria 57123
46 Ga0105240_10001270 3300009093 Bacteria 43667
47 Ga0105240_10005354 3300009093 Bacteria 19142
48 Ga0105240_10027480 3300009093 Bacteria 7447
49 Ga0111539_10045707 3300009094 Bacteria 5241
50 Ga0105248_10001505 3300009177 Bacteria 25928
51 Ga0105237_10006162 3300009545 Bacteria 13405
52 Ga0105238_10005396 3300009551 Bacteria 12635
53 Ga0105239_10000839 3300010375 Bacteria 43658
54 Ga0105239_10003276 3300010375 Bacteria 19965
55 Ga0105239_10316744 3300010375 Bacteria 1759
56 Ga0105246_10004687 3300011119 Bacteria 8325
57 Ga0157370_10000003 3300013104 Bacteria 367417
58 Ga0157370_10117111 3300013104 Bacteria 2489
59 Ga0157369_10000767 3300013105 Bacteria 41495
60 Ga0157369_10044897 3300013105 Bacteria 4808
61 Ga0157369_10048502 3300013105 Bacteria 4608
62 Ga0157369_10137870 3300013105 Bacteria 2582
63 Ga0157374_10001833 3300013296 Bacteria 17893
64 Ga0157374_10014296 3300013296 Bacteria 6945
65 Ga0157374_10027731 3300013296 Bacteria 5113
66 Ga0157378_10113952 3300013297 Bacteria 2483
67 Ga0157372_10000489 3300013307 Bacteria 43671
68 Ga0157372_10269246 3300013307 Bacteria 1979
69 Ga0157372_10432118 3300013307 Bacteria 1535
70 Ga0157375_10044504 3300013308 Unclassified 4314
71 Ga0163163_10405331 3300014325 Unclassified 1422
72 Ga0182008_10075169 3300014497 Bacteria 1662
73 Ga0157376_10052616 3300014969 Bacteria 3386
74 Ga0157376_10298294 3300014969 Bacteria 1524
75 Ga0213872_10063705 3300021361 Bacteria 1666
76 Ga0213874_10024246 3300021377 Bacteria 1699
77 Ga0213876_10002736 3300021384 Bacteria 10273
78 Ga0213875_10000091 3300021388 Bacteria 104903
79 Ga0213875_10007990 3300021388 Bacteria 5436
80 Ga0213875_10069875 3300021388 Bacteria 1639
81 Ga0213871_10008227 3300021441 Bacteria 2291
82 Ga0224712_10082210 3300022467 Bacteria 1332
83 Ga0207645_10153050 3300025907 Bacteria 1506
84 Ga0207707_10049631 3300025912 Bacteria 3656
85 Ga0207695_10000119 3300025913 Bacteria 235221
86 Ga0207695_10001003 3300025913 Bacteria 49974
87 Ga0207695_10003978 3300025913 Bacteria 20397
88 Ga0207657_10165250 3300025919 Bacteria 1796
89 Ga0207652_10105613 3300025921 Bacteria 2492
90 Ga0207694_10001686 3300025924 Bacteria 18506
91 Ga0207694_10076493 3300025924 Bacteria 2621
92 Ga0207650_10220728 3300025925 Bacteria 1525
93 Ga0207664_10049059 3300025929 Bacteria 3322
94 Ga0207664_10054852 3300025929 Unclassified 3160
95 Ga0207690_10137412 3300025932 Bacteria 1796
96 Ga0207670_10142278 3300025936 Bacteria 1770
97 Ga0207711_10022903 3300025941 Bacteria 5228
98 Ga0207661_10035809 3300025944 Bacteria 3871
99 Ga0207661_10067979 3300025944 Bacteria 2900
100 Ga0207679_10336522 3300025945 Bacteria 1311
101 Ga0207667_10001777 3300025949 Bacteria 27129
102 Ga0207640_10050024 3300025981 Bacteria 2709
103 Ga0207639_10027166 3300026041 Bacteria 4166
104 Ga0207702_10070671 3300026078 Bacteria 3003
105 Ga0207702_10104934 3300026078 Bacteria 2502
106 Ga0207674_10010198 3300026116 Bacteria 10671
107 Ga0207674_10032519 3300026116 Bacteria 5471
108 Ga0207683_10024964 3300026121 Bacteria 5152
109 Ga0207698_10001437 3300026142 Bacteria 13838
110 Ga0207698_10132241 3300026142 Bacteria 2134
111 Ga0268266_10070993 3300028379 Bacteria 3018
112 Ga0268264_10000030 3300028381 Bacteria 418542
113 Ga0265314_10058956 3300031711 Bacteria 2629
114 Ga0373924_0022442 3300035410 Bacteria 2468
115 Ga0373937_0105457 3300036401 Bacteria 2619
116 Ga0373925_0068888 3300037068 Bacteria 2672
117 Ga0395899_0046693 3300037312 Bacteria 3225
118 Ga0395899_0055089 3300037312 Bacteria 2942
119 Ga0395900_0000355 3300037418 Bacteria 66598
120 Ga0395900_0126187 3300037418 Bacteria 2625
121 Ga0395898_0000758 3300037466 Bacteria 56394
122 Ga0395898_0032200 3300037466 Bacteria 5232
123 Ga0395905_0176841 3300037471 Bacteria 2003
124 Ga0436364_0169470 3300037853 Bacteria 28082
125 Ga0436364_0519106 3300037853 Bacteria 8345
126 Ga0436364_0621060 3300037853 Bacteria 18950
127 Ga0436364_0939293 3300037853 Bacteria 1535
128 Ga0395901_0145051 3300038443 Bacteria 2495
129 Ga0436365_0152543 3300039437 Unclassified 3827
130 Ga0436365_1851543 3300039437 Bacteria 8883
131 Ga0436365_1856850 3300039437 Bacteria 10144
132 Ga0436360_0681282 3300039438 Bacteria 6154
133 Ga0436361_0165490 3300039447 Bacteria 5293
134 Ga0436361_0513780 3300039447 Bacteria 2748
135 Ga0436361_0519929 3300039447 Bacteria 1627
136 Ga0436363_0311574 3300039450 Bacteria 2341
137 Ga0436363_1233765 3300039450 Bacteria 2205
138 Ga0436362_0557337 3300039453 Bacteria 1951
139 Ga0466969_0018799 3300044656 Bacteria 3596
140 Ga0466966_0006866 3300044684 Bacteria 7540
141 Ga0466966_0038200 3300044684 Bacteria 3094
142 Ga0466959_0002244 3300045049 Bacteria 12311
143 Ga0466959_0191903 3300045049 Bacteria 1425
144 Ga0466967_0024269 3300045976 Bacteria 4983
145 Ga0495592_0085891 3300046454 Bacteria 2267
146 Ga0495629_0029703 3300046459 Bacteria 3876
147 Ga0495652_0061665 3300046529 Bacteria 3164
148 Ga0495640_0081940 3300046533 Bacteria 2144
149 Ga0495586_0140730 3300046535 Unclassified 1354
150 Ga0495634_0204672 3300046642 Bacteria 1224
151 Ga0495635_0060806 3300046663 Bacteria 2595
152 Ga0495657_0051571 3300046675 Bacteria 2762
153 Ga0495613_0083938 3300046689 Bacteria 2313
154 Ga0495600_0091142 3300046809 Bacteria 1988
155 Ga0495604_0040452 3300047317 Bacteria 3660
156 Ga0495674_0142482 3300047319 Bacteria 2014
157 Ga0495602_0031852 3300048088 Bacteria 4976
158 Ga0495602_0191384 3300048088 Bacteria 1568
159 Ga0496100_0031494 3300048903 Bacteria 3298
160 Ga0496100_0036165 3300048903 Bacteria 3112
161 Ga0496101_0028995 3300048904 Bacteria 3869
162 Ga0496104_0000329 3300048907 Bacteria 42355
163 Ga0496104_0027472 3300048907 Bacteria 5266
164 Ga0496104_0035981 3300048907 Bacteria 4626
165 Ga0496105_0000128 3300048908 Bacteria 51033
166 Ga0496105_0027252 3300048908 Bacteria 4665
167 Ga0496107_0020293 3300048910 Bacteria 4692
168 Ga0496108_0001069 3300048911 Bacteria 21358
169 Ga0496108_0180555 3300048911 Bacteria 1827
170 Ga0496108_0431044 3300048911 Bacteria 1152
171 Ga0496109_0012387 3300048912 Bacteria 7364
172 Ga0496109_0021992 3300048912 Bacteria 5646
173 Ga0496110_0004130 3300048913 Bacteria 11222
174 Ga0496110_0005532 3300048913 Bacteria 9919
175 Ga0496111_0006668 3300048914 Bacteria 7511
176 Ga0496111_0010248 3300048914 Bacteria 6279
177 Ga0496112_0087354 3300048915 Unclassified 3085
178 Ga0496113_0028459 3300048916 Unclassified 4020
179 Ga0496114_0010251 3300048917 Bacteria 7457
180 Ga0496114_0037963 3300048917 Bacteria 3984
181 Ga0496114_0110287 3300048917 Bacteria 2357
182 Ga0496115_0051696 3300048918 Bacteria 3294
183 Ga0496115_0063161 3300048918 Bacteria 2987
184 Ga0496115_0142980 3300048918 Bacteria 1973
185 Ga0501032_0181060 3300049569 Bacteria 1380
186 Ga0501033_0273283 3300049570 Bacteria 1194
187 Ga0501037_0079893 3300049573 Unclassified 2374
188 Ga0501043_0096086 3300049579 Unclassified 2329
189 Ga0501047_0010962 3300049581 Bacteria 8576
190 Ga0501047_0330898 3300049581 Bacteria 1362
191 Ga0501048_0166536 3300049582 Bacteria 1561
192 Ga0501070_0070724 3300049586 Bacteria 2889
193 Ga0501035_0039185 3300049822 Bacteria 4289
194 Ga0501044_0005977 3300049823 Bacteria 13463
195 nmdc:mga08y16_196294_c1 3300050511 Bacteria 2092
196 nmdc:mga0n895_445687_c1 3300050512 Unclassified 1307
197 Ga0495601_0209843 3300053077 Unclassified 1272
198 Ga0500641_0000707 3300053096 Bacteria 12072
199 Ga0466962_0047758 3300061719 Bacteria 2045
200 2894776476 2894772417 Bacteria 5305674
201 Ga0395899_0000284
202 Ga0070658_10015516
203 Ga0070683_100223664
204 Ga0070670_100059011
205 Ga0070689_100167069
206 Ga0070689_100229250
207 Ga0070661_100009022
208 Ga0070661_100153057
209 Ga0070671_100124983
210 Ga0070659_100009356
211 Ga0070714_100095143
212 Ga0070714_100103307
213 Ga0070713_100194594
214 Ga0070678_100003195
215 Ga0070678_100042366
216 Ga0070681_10061918
217 Ga0070679_100396805
218 Ga0070684_100016006
219 Ga0070684_100143438
220 Ga0068853_100173629
221 Ga0070665_100096802
222 Ga0068855_100002300
223 Ga0070664_100196840
224 Ga0068857_100024714
225 Ga0068857_100025522
226 Ga0068854_100027669
227 Ga0068856_100008342
228 Ga0068856_100036091
229 Ga0068856_100051045
230 Ga0068856_100056391
231 Ga0068856_100090653
232 Ga0068852_100000191
233 Ga0068852_100068533
234 Ga0068852_100351070
235 Ga0068851_10067384
236 Ga0068860_100001118
237 Ga0070717_10042241
238 Ga0070717_10085738
239 Ga0075365_10146651
240 Ga0075363_100124353
241 Ga0075363_100149510
242 Ga0068871_100213217
243 Ga0075434_100171084
244 Ga0075436_100009497
245 Ga0105240_10000796
246 Ga0105240_10001270
247 Ga0105240_10005354
248 Ga0105240_10027480
249 Ga0111539_10045707
250 Ga0105248_10001505
251 Ga0105237_10006162
252 Ga0105238_10005396
253 Ga0105239_10000839
254 Ga0105239_10003276
255 Ga0105239_10316744
256 Ga0105246_10004687
257 Ga0157370_10000003
258 Ga0157370_10117111
259 Ga0157369_10000767
260 Ga0157369_10044897
261 Ga0157369_10048502
262 Ga0157369_10137870
263 Ga0157374_10001833
264 Ga0157374_10014296
265 Ga0157374_10027731
266 Ga0157378_10113952
267 Ga0157372_10000489
268 Ga0157372_10269246
269 Ga0157372_10432118
270 Ga0157375_10044504
271 Ga0163163_10405331
272 Ga0182008_10075169
273 Ga0157376_10052616
274 Ga0157376_10298294
275 Ga0213872_10063705
276 Ga0213874_10024246
277 Ga0213876_10002736
278 Ga0213875_10000091
279 Ga0213875_10007990
280 Ga0213875_10069875
281 Ga0213871_10008227
282 Ga0224712_10082210
283 Ga0207645_10153050
284 Ga0207707_10049631
285 Ga0207695_10000119
286 Ga0207695_10001003
287 Ga0207695_10003978
288 Ga0207657_10165250
289 Ga0207652_10105613
290 Ga0207694_10001686
291 Ga0207694_10076493
292 Ga0207650_10220728
293 Ga0207664_10049059
294 Ga0207664_10054852
295 Ga0207690_10137412
296 Ga0207670_10142278
297 Ga0207711_10022903
298 Ga0207661_10035809
299 Ga0207661_10067979
300 Ga0207679_10336522
301 Ga0207667_10001777
302 Ga0207640_10050024
303 Ga0207639_10027166
304 Ga0207702_10070671
305 Ga0207702_10104934
306 Ga0207674_10010198
307 Ga0207674_10032519
308 Ga0207683_10024964
309 Ga0207698_10001437
310 Ga0207698_10132241
311 Ga0268266_10070993
312 Ga0268264_10000030
313 Ga0265314_10058956
314 Ga0373924_0022442
315 Ga0373937_0105457
316 Ga0373925_0068888
317 Ga0395899_0046693
318 Ga0395899_0055089
319 Ga0395900_0000355
320 Ga0395900_0126187
321 Ga0395898_0000758
322 Ga0395898_0032200
323 Ga0395905_0176841
324 Ga0436364_0169470
325 Ga0436364_0519106
326 Ga0436364_0621060
327 Ga0436364_0939293
328 Ga0395901_0145051
329 Ga0436365_0152543
330 Ga0436365_1851543
331 Ga0436365_1856850
332 Ga0436360_0681282
333 Ga0436361_0165490
334 Ga0436361_0513780
335 Ga0436361_0519929
336 Ga0436363_0311574
337 Ga0436363_1233765
338 Ga0436362_0557337
339 Ga0466969_0018799
340 Ga0466966_0006866
341 Ga0466966_0038200
342 Ga0466959_0002244
343 Ga0466959_0191903
344 Ga0466967_0024269
345 Ga0495592_0085891
346 Ga0495629_0029703
347 Ga0495652_0061665
348 Ga0495640_0081940
349 Ga0495586_0140730
350 Ga0495634_0204672
351 Ga0495635_0060806
352 Ga0495657_0051571
353 Ga0495613_0083938
354 Ga0495600_0091142
355 Ga0495604_0040452
356 Ga0495674_0142482
357 Ga0495602_0031852
358 Ga0495602_0191384
359 Ga0496100_0031494
360 Ga0496100_0036165
361 Ga0496101_0028995
362 Ga0496104_0000329
363 Ga0496104_0027472
364 Ga0496104_0035981
365 Ga0496105_0000128
366 Ga0496105_0027252
367 Ga0496107_0020293
368 Ga0496108_0001069
369 Ga0496108_0180555
370 Ga0496108_0431044
371 Ga0496109_0012387
372 Ga0496109_0021992
373 Ga0496110_0004130
374 Ga0496110_0005532
375 Ga0496111_0006668
376 Ga0496111_0010248
377 Ga0496112_0087354
378 Ga0496113_0028459
379 Ga0496114_0010251
380 Ga0496114_0037963
381 Ga0496114_0110287
382 Ga0496115_0051696
383 Ga0496115_0063161
384 Ga0496115_0142980
385 Ga0501032_0181060
386 Ga0501033_0273283
387 Ga0501037_0079893
388 Ga0501043_0096086
389 Ga0501047_0010962
390 Ga0501047_0330898
391 Ga0501048_0166536
392 Ga0501070_0070724
393 Ga0501035_0039185
394 Ga0501044_0005977
395 nmdc:mga08y16_196294_c1
396 nmdc:mga0n895_445687_c1
397 Ga0495601_0209843
398 Ga0500641_0000707
399 Ga0466962_0047758
400 2894776476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03060

NMO

Nitronate monooxygenase

35

362

0.91

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

10

283

0.81

PF01070

FMN_dh

FMN-dependent dehydrogenase

177

289

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lsm-assembly6.cif.gz_G-5 crystal structure of nitronate monooxygenase (so_0471) from shewanella oneidensis mr-1 0.9256 11 348
5lsm-assembly3.cif.gz_H-4 crystal structure of nitronate monooxygenase (so_0471) from shewanella oneidensis mr-1 0.9215 12 347
5lsm-assembly5.cif.gz_F crystal structure of nitronate monooxygenase (so_0471) from shewanella oneidensis mr-1 0.9213 11 348
5gvj-assembly2.cif.gz_B-3 structure of fabk (m276a) mutant from thermotoga maritima 0.917 11 356
3bw4-assembly1.cif.gz_A-2 crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes 0.9146 18 357
ID Description Score Start End Superfamily
3bw4A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9146 18 357 3.20.20.70
af_Q2FZX9_3_354_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9142 12 358 3.20.20.70
4qisA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9126 12 351 3.20.20.70
5gvjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9115 11 356 3.20.20.70
5lsmB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9059 12 348 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6G4BI16-F1-model_v4 deleted 0.9935 130 285
AF-A0A0U5BQ59-F1-model_v4 deleted 0.9929 27 355
AF-A0A2H1PTC4-F1-model_v4 deleted 0.9915 136 358
AF-A0A2H1PTC4-F1-model_v4 deleted 0.9871 136 358
AF-A0A534FQD1-F1-model_v4 Propionate 3-nitronate monooxygenase 0.9869 210 357 GO:0009636
GO:0018580

Map