F307461

General Info

Members Datasets Scaffolds Average Seq Length
200 120 191 300

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000001|Ga0395899_0000001_776892_777857
Length 321
Sequence MKHKQSSIKTLKNLKNHYINIMRIFALITLFSGLLVSSYAQTTIPLYPNGVPNSKPTPTAYTEKRNEWGGITDVSIPTLTSYILNDGTTHTAVLVIPGGGYSAVVRGHEGDSIAHAFNKIGVSAFVLKYRLPSDSIMVDKTIGPLQDAQSALVMIRKNAKQWNIDPAKVGVIGFSAGGHLASTLGTHFDKPAIKDYGNVSLRPDFMALIYPVITFGPFAHVGSRENLIGKNPSQELIDLYSNEKQVTPETPPTFLVHAEDDRTVPVQNTLMFYNALVQNKVQGEMHIYPHGDHGFGLNNWTTKDYWFDRLKEWMEANGWVK

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
9 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
97 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
112 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
113 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
116 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
117 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
118 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
119 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
120 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 0.5
Isolates 4.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.5
Nodule 0
Rhizoplane 0.5
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10023029 3300001979 Bacteria 2134
2 JGI24737J22298_10000333 3300001990 Bacteria 15751
3 JGI24737J22298_10008297 3300001990 Bacteria 3484
4 JGI24735J21928_10000003 3300002067 Bacteria 385983
5 JGI25162J39368_1000005 3300002737 Bacteria 435925
6 JGI25162J39368_1002471 3300002737 Bacteria 7139
7 JGI25164J39214_1003742 3300002772 Bacteria 1854
8 JGI25165J46597_1000399 3300003214 Bacteria 45926
9 rootH1_10005973 3300003316 Bacteria 11300
10 rootH2_10035311 3300003320 Bacteria 15199
11 rootH2_10160844 3300003320 Bacteria 4205
12 rootL2_10110501 3300003322 Bacteria 5074
13 rootH1_10029236 3300003323 Bacteria 5684
14 rootH1_10175076 3300003323 Bacteria 3309
15 rootH1_10209165 3300003323 Bacteria 2191
16 rootH1_10328926 3300003323 Bacteria 2799
17 Ga0070658_10000060 3300005327 Bacteria 112561
18 Ga0070658_10109345 3300005327 Bacteria 2289
19 Ga0070676_10015935 3300005328 Bacteria 4148
20 Ga0070683_100016372 3300005329 Bacteria 6539
21 Ga0068868_100261417 3300005338 Bacteria 1460
22 Ga0070660_100013606 3300005339 Bacteria 5845
23 Ga0070660_100036313 3300005339 Bacteria 3732
24 Ga0070660_100126421 3300005339 Bacteria 2043
25 Ga0070674_100224386 3300005356 Bacteria 1463
26 Ga0070673_100011689 3300005364 Bacteria 6000
27 Ga0070659_100019550 3300005366 Bacteria 5135
28 Ga0070659_100134382 3300005366 Bacteria 2011
29 Ga0070678_100290229 3300005456 Bacteria 1386
30 Ga0070662_100000145 3300005457 Bacteria 40435
31 Ga0070662_100000436 3300005457 Bacteria 24652
32 Ga0068867_100000996 3300005459 Bacteria 19320
33 Ga0070684_100039272 3300005535 Bacteria 4070
34 Ga0068853_100003458 3300005539 Bacteria 12076
35 Ga0068853_100431174 3300005539 Bacteria 1238
36 Ga0068855_100010994 3300005563 Bacteria 10922
37 Ga0068855_100030833 3300005563 Bacteria 6410
38 Ga0068855_100110844 3300005563 Bacteria 3150
39 Ga0068855_100158013 3300005563 Bacteria 2575
40 Ga0068855_100258891 3300005563 Bacteria 1939
41 Ga0068856_100007449 3300005614 Bacteria 10681
42 Ga0068856_100011413 3300005614 Bacteria 8618
43 Ga0068852_100000735 3300005616 Bacteria 21499
44 Ga0068866_10022046 3300005718 Bacteria 2943
45 Ga0068858_100063998 3300005842 Bacteria 3403
46 Ga0068858_100388101 3300005842 Bacteria 1340
47 Ga0075366_10015420 3300006195 Bacteria 4380
48 Ga0075366_10123104 3300006195 Bacteria 1563
49 Ga0097621_100000684 3300006237 Bacteria 23771
50 Ga0068871_100000037 3300006358 Bacteria 70231
51 Ga0068865_100000067 3300006881 Bacteria 54449
52 Ga0105240_10000068 3300009093 Bacteria 207756
53 Ga0105240_10029281 3300009093 Bacteria 7178
54 Ga0105240_10068164 3300009093 Bacteria 4407
55 Ga0105240_10439170 3300009093 Bacteria 1463
56 Ga0105245_10056922 3300009098 Bacteria 3515
57 Ga0105241_10000251 3300009174 Bacteria 40576
58 Ga0105241_10006137 3300009174 Bacteria 8859
59 Ga0105241_10012314 3300009174 Bacteria 6274
60 Ga0105241_10039789 3300009174 Bacteria 3547
61 Ga0105241_10077932 3300009174 Bacteria 2588
62 Ga0105241_10081024 3300009174 Bacteria 2542
63 Ga0105237_10001623 3300009545 Bacteria 29201
64 Ga0105237_10002578 3300009545 Bacteria 22344
65 Ga0105237_10073462 3300009545 Unclassified 3412
66 Ga0105237_10074145 3300009545 Unclassified 3395
67 Ga0105237_10561895 3300009545 Bacteria 1148
68 Ga0105238_10015735 3300009551 Bacteria 7659
69 Ga0105238_10032516 3300009551 Bacteria 5308
70 Ga0105239_10000032 3300010375 Bacteria 225528
71 Ga0105239_10001824 3300010375 Bacteria 27887
72 Ga0105239_10160676 3300010375 Bacteria 2510
73 Ga0105239_10312540 3300010375 Bacteria 1771
74 Ga0105246_10016999 3300011119 Bacteria 4619
75 Ga0157373_10000013 3300013100 Bacteria 186870
76 Ga0157373_10004429 3300013100 Bacteria 10576
77 Ga0157373_10062504 3300013100 Bacteria 2637
78 Ga0157371_10005280 3300013102 Bacteria 10945
79 Ga0157371_10006033 3300013102 Bacteria 10086
80 Ga0157371_10030370 3300013102 Bacteria 3899
81 Ga0157370_10081574 3300013104 Bacteria 3043
82 Ga0157369_10001043 3300013105 Bacteria 35027
83 Ga0157369_10085993 3300013105 Bacteria 3359
84 Ga0157369_10432424 3300013105 Bacteria 1364
85 Ga0157374_10000207 3300013296 Bacteria 54174
86 Ga0157374_10000418 3300013296 Bacteria 38471
87 Ga0157378_10091928 3300013297 Bacteria 2760
88 Ga0163162_10000008 3300013306 Bacteria 316194
89 Ga0163162_10011508 3300013306 Bacteria 8628
90 Ga0163162_10133464 3300013306 Bacteria 2593
91 Ga0157372_10000001 3300013307 Bacteria 791349
92 Ga0157372_10001765 3300013307 Bacteria 23452
93 Ga0157372_10106494 3300013307 Bacteria 3207
94 Ga0157372_10163569 3300013307 Bacteria 2572
95 Ga0157375_10014375 3300013308 Bacteria 7059
96 Ga0157375_10250492 3300013308 Unclassified 1932
97 Ga0157377_10035429 3300014745 Bacteria 2738
98 Ga0206351_10757906 3300020077 Bacteria 2077
99 Ga0213872_10010438 3300021361 Bacteria 4421
100 Ga0213872_10014637 3300021361 Bacteria 3657
101 Ga0209563_103312 3300025230 Bacteria 3367
102 Ga0207427_100072 3300025231 Bacteria 158364
103 Ga0209437_100026 3300025233 Bacteria 542698
104 Ga0209437_100043 3300025233 Bacteria 440454
105 Ga0209026_1002522 3300025250 Bacteria 6784
106 Ga0209129_1010738 3300025258 Bacteria 2253
107 Ga0209233_1000111 3300025261 Bacteria 260262
108 Ga0209233_1004642 3300025261 Bacteria 4644
109 Ga0207642_10093568 3300025899 Bacteria 1491
110 Ga0207647_10000079 3300025904 Bacteria 72325
111 Ga0207647_10000302 3300025904 Bacteria 40592
112 Ga0207647_10011709 3300025904 Bacteria 6139
113 Ga0207647_10125701 3300025904 Bacteria 1509
114 Ga0207645_10000067 3300025907 Bacteria 75648
115 Ga0207705_10000233 3300025909 Bacteria 55125
116 Ga0207654_10047145 3300025911 Bacteria 2461
117 Ga0207695_10000131 3300025913 Bacteria 223762
118 Ga0207695_10001921 3300025913 Bacteria 32318
119 Ga0207695_10003303 3300025913 Bacteria 22890
120 Ga0207695_10040100 3300025913 Bacteria 5026
121 Ga0207695_10078192 3300025913 Bacteria 3357
122 Ga0207695_10218091 3300025913 Bacteria 1816
123 Ga0207671_10000787 3300025914 Bacteria 40182
124 Ga0207671_10002013 3300025914 Bacteria 22350
125 Ga0207671_10011597 3300025914 Bacteria 7156
126 Ga0207671_10411093 3300025914 Bacteria 1076
127 Ga0207657_10106977 3300025919 Bacteria 2314
128 Ga0207657_10121762 3300025919 Bacteria 2146
129 Ga0207652_10057998 3300025921 Bacteria 3336
130 Ga0207690_10104250 3300025932 Bacteria 2031
131 Ga0207706_10000013 3300025933 Bacteria 188236
132 Ga0207706_10000538 3300025933 Bacteria 40240
133 Ga0207669_10224103 3300025937 Bacteria 1382
134 Ga0207704_10000056 3300025938 Bacteria 78848
135 Ga0207661_10020521 3300025944 Bacteria 4940
136 Ga0207667_10024828 3300025949 Bacteria 6572
137 Ga0207651_10010168 3300025960 Bacteria 5199
138 Ga0207703_10108922 3300026035 Bacteria 2360
139 Ga0207639_10129308 3300026041 Unclassified 2088
140 Ga0207639_10260060 3300026041 Bacteria 1518
141 Ga0207702_10047973 3300026078 Bacteria 3600
142 Ga0207648_10000738 3300026089 Bacteria 36673
143 Ga0207674_10257199 3300026116 Bacteria 1693
144 Ga0207698_10003486 3300026142 Bacteria 9485
145 Ga0265323_10020660 3300028653 Bacteria 2533
146 Ga0395899_0000001 3300037312 Bacteria 1750322
147 Ga0395899_0000027 3300037312 Bacteria 337387
148 Ga0395899_0000150 3300037312 Bacteria 105946
149 Ga0395899_0000474 3300037312 Bacteria 45411
150 Ga0395899_0065216 3300037312 Bacteria 2676
151 Ga0395900_0000413 3300037418 Bacteria 61555
152 Ga0395900_0011945 3300037418 Bacteria 8881
153 Ga0395898_0007319 3300037466 Bacteria 11721
154 Ga0395898_0189509 3300037466 Bacteria 1965
155 Ga0395905_0000188 3300037471 Bacteria 98070
156 Ga0395905_0000729 3300037471 Bacteria 43376
157 Ga0395901_0000611 3300038443 Bacteria 41511
158 Ga0395901_0002249 3300038443 Bacteria 19697
159 Ga0436361_0746278 3300039447 Bacteria 8494
160 Ga0436361_1166428 3300039447 Bacteria 7045
161 Ga0439448_0003040 3300042005 Bacteria 4610
162 Ga0466969_0109610 3300044656 Bacteria 1294
163 Ga0466966_0091505 3300044684 Bacteria 1888
164 Ga0453684_0001568 3300044712 Bacteria 63367
165 Ga0453684_0022122 3300044712 Bacteria 9454
166 Ga0453684_0182133 3300044712 Bacteria 2465
167 Ga0466959_0210511 3300045049 Bacteria 1351
168 Ga0451576_0018886 3300045051 Bacteria 7536
169 Ga0495650_0000107 3300046471 Bacteria 200864
170 Ga0495585_0000753 3300046492 Bacteria 28699
171 Ga0495583_0010597 3300046506 Bacteria 5362
172 Ga0495606_0000303 3300046507 Bacteria 84874
173 Ga0495616_0004163 3300046513 Bacteria 9168
174 Ga0495652_0106837 3300046529 Bacteria 2259
175 Ga0495633_0006747 3300046558 Bacteria 6750
176 Ga0495625_0000021 3300046660 Bacteria 282133
177 Ga0495625_0019736 3300046660 Bacteria 5219
178 Ga0495661_0005828 3300046665 Bacteria 8709
179 Ga0495661_0104798 3300046665 Bacteria 1585
180 Ga0495649_0000009 3300046694 Bacteria 451725
181 Ga0495687_001026 3300047443 Bacteria 27810
182 Ga0495687_001909 3300047443 Bacteria 17895
183 Ga0495687_002406 3300047443 Bacteria 15082
184 Ga0495677_0050490 3300047445 Bacteria 1531
185 Ga0495686_0040834 3300047472 Bacteria 2956
186 Ga0501219_000580 3300049703 Bacteria 5356
187 Ga0501284_00012 3300050005 Bacteria 124103
188 nmdc:mga0k408_147839_c1 3300050493 Bacteria 1399
189 Ga0500635_0008967 3300053080 Bacteria 2760
190 Ga0500618_021901 3300053125 Bacteria 1557
191 Ga0500622_0003583 3300053156 Bacteria 10247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2919186247 2919190557 248
2 3300050493 nmdc:mga0k408_147839_c1 nmdc:mga0k408_147839_c1_172_1023 283
3 3300006195 Ga0075366_10015420 Ga0075366_100154205 288
4 3300005563 Ga0068855_100030833 Ga0068855_1000308338 292
5 3300009174 Ga0105241_10081024 Ga0105241_100810243 292
6 3300010375 Ga0105239_10001824 Ga0105239_100018246 292
7 3300025949 Ga0207667_10024828 Ga0207667_100248281 292
8 3300044712 Ga0453684_0001568 Ga0453684_0001568_31646_32536 292
9 3300044712 Ga0453684_0022122 Ga0453684_0022122_6729_7619 292
10 3300044712 Ga0453684_0182133 Ga0453684_0182133_747_1637 292
11 3300005327 Ga0070658_10109345 Ga0070658_101093453 293
12 3300005339 Ga0070660_100126421 Ga0070660_1001264212 293
13 3300005457 Ga0070662_100000436 Ga0070662_1000004363 293
14 3300005563 Ga0068855_100258891 Ga0068855_1002588912 293
15 3300005842 Ga0068858_100063998 Ga0068858_1000639982 293
16 3300009551 Ga0105238_10032516 Ga0105238_100325163 293
17 3300021361 Ga0213872_10010438 Ga0213872_100104386 293
18 3300025904 Ga0207647_10011709 Ga0207647_100117095 293
19 3300025913 Ga0207695_10003303 Ga0207695_1000330313 293
20 3300025919 Ga0207657_10121762 Ga0207657_101217622 293
21 3300025933 Ga0207706_10000013 Ga0207706_1000001372 293
22 3300026035 Ga0207703_10108922 Ga0207703_101089222 293
23 3300037312 Ga0395899_0000027 Ga0395899_0000027_286024_286908 293
24 3300005356 Ga0070674_100224386 Ga0070674_1002243862 295
25 3300009174 Ga0105241_10077932 Ga0105241_100779322 295
26 3300025911 Ga0207654_10047145 Ga0207654_100471453 295
27 3300025913 Ga0207695_10078192 Ga0207695_100781924 295
28 3300025937 Ga0207669_10224103 Ga0207669_102241032 295
29 3300046529 Ga0495652_0106837 Ga0495652_0106837_382_1275 295
30 3300005563 Ga0068855_100158013 Ga0068855_1001580132 297
31 3300009093 Ga0105240_10068164 Ga0105240_100681642 297
32 3300009098 Ga0105245_10056922 Ga0105245_100569222 297
33 3300009174 Ga0105241_10039789 Ga0105241_100397893 297
34 3300009545 Ga0105237_10073462 Ga0105237_100734622 297
35 3300010375 Ga0105239_10160676 Ga0105239_101606762 297
36 3300013100 Ga0157373_10062504 Ga0157373_100625043 297
37 3300013308 Ga0157375_10014375 Ga0157375_100143754 297
38 3300025913 Ga0207695_10040100 Ga0207695_100401002 297
39 3300025913 Ga0207695_10218091 Ga0207695_102180912 297
40 3300025921 Ga0207652_10057998 Ga0207652_100579982 297
41 3300047443 Ga0495687_001026 Ga0495687_001026_11878_12777 297
42 3300053156 Ga0500622_0003583 Ga0500622_0003583_8299_9195 297
43 3300001990 JGI24737J22298_10008297 JGI24737J22298_100082971 298
44 3300005327 Ga0070658_10000060 Ga0070658_1000006025 298
45 3300005339 Ga0070660_100013606 Ga0070660_1000136065 298
46 3300005366 Ga0070659_100134382 Ga0070659_1001343822 298
47 3300005539 Ga0068853_100431174 Ga0068853_1004311742 298
48 3300005563 Ga0068855_100010994 Ga0068855_1000109949 298
49 3300009174 Ga0105241_10006137 Ga0105241_100061375 298
50 3300013100 Ga0157373_10004429 Ga0157373_100044297 298
51 3300013102 Ga0157371_10005280 Ga0157371_100052802 298
52 3300013105 Ga0157369_10085993 Ga0157369_100859933 298
53 3300013306 Ga0163162_10000008 Ga0163162_1000000892 298
54 3300013307 Ga0157372_10106494 Ga0157372_101064942 298
55 3300025261 Ga0209233_1004642 Ga0209233_10046421 298
56 3300025904 Ga0207647_10000079 Ga0207647_1000007919 298
57 3300025909 Ga0207705_10000233 Ga0207705_1000023325 298
58 3300025919 Ga0207657_10106977 Ga0207657_101069772 298
59 3300025932 Ga0207690_10104250 Ga0207690_101042502 298
60 3300026041 Ga0207639_10260060 Ga0207639_102600602 298
61 3300039447 Ga0436361_1166428 Ga0436361_1166428_2895_3800 298
62 3300042005 Ga0439448_0003040 Ga0439448_0003040_3214_4116 298
63 3300049703 Ga0501219_000580 Ga0501219_000580_1969_2883 298
64 3300050005 Ga0501284_00012 Ga0501284_00012_6162_7076 298
65 iso_pu_bacteria 2945977869 2945978064 298
66 3300002737 JGI25162J39368_1000005 JGI25162J39368_1000005253 299
67 3300003320 rootH2_10035311 rootH2_100353117 299
68 3300003320 rootH2_10160844 rootH2_101608442 299
69 3300003323 rootH1_10209165 rootH1_102091652 299
70 3300005328 Ga0070676_10015935 Ga0070676_100159353 299
71 3300005338 Ga0068868_100261417 Ga0068868_1002614172 299
72 3300005339 Ga0070660_100036313 Ga0070660_1000363132 299
73 3300005364 Ga0070673_100011689 Ga0070673_1000116895 299
74 3300005366 Ga0070659_100019550 Ga0070659_1000195503 299
75 3300005456 Ga0070678_100290229 Ga0070678_1002902292 299
76 3300005457 Ga0070662_100000145 Ga0070662_10000014515 299
77 3300005459 Ga0068867_100000996 Ga0068867_1000009969 299
78 3300005539 Ga0068853_100003458 Ga0068853_1000034586 299
79 3300005563 Ga0068855_100110844 Ga0068855_1001108442 299
80 3300005614 Ga0068856_100007449 Ga0068856_1000074491 299
81 3300005614 Ga0068856_100011413 Ga0068856_1000114134 299
82 3300005616 Ga0068852_100000735 Ga0068852_1000007356 299
83 3300005718 Ga0068866_10022046 Ga0068866_100220462 299
84 3300005842 Ga0068858_100388101 Ga0068858_1003881011 299
85 3300006237 Ga0097621_100000684 Ga0097621_10000068412 299
86 3300006358 Ga0068871_100000037 Ga0068871_10000003735 299
87 3300006881 Ga0068865_100000067 Ga0068865_1000000677 299
88 3300009093 Ga0105240_10029281 Ga0105240_100292814 299
89 3300009093 Ga0105240_10439170 Ga0105240_104391702 299
90 3300009174 Ga0105241_10000251 Ga0105241_1000025112 299
91 3300009545 Ga0105237_10001623 Ga0105237_1000162312 299
92 3300009551 Ga0105238_10015735 Ga0105238_100157352 299
93 3300010375 Ga0105239_10000032 Ga0105239_1000003295 299
94 3300010375 Ga0105239_10312540 Ga0105239_103125402 299
95 3300011119 Ga0105246_10016999 Ga0105246_100169994 299
96 3300013102 Ga0157371_10030370 Ga0157371_100303702 299
97 3300013105 Ga0157369_10432424 Ga0157369_104324242 299
98 3300013296 Ga0157374_10000207 Ga0157374_1000020730 299
99 3300013296 Ga0157374_10000418 Ga0157374_1000041812 299
100 3300013297 Ga0157378_10091928 Ga0157378_100919281 299
101 3300013308 Ga0157375_10250492 Ga0157375_102504922 299
102 3300014745 Ga0157377_10035429 Ga0157377_100354292 299
103 3300021361 Ga0213872_10014637 Ga0213872_100146372 299
104 3300025233 Ga0209437_100043 Ga0209437_100043154 299
105 3300025250 Ga0209026_1002522 Ga0209026_10025224 299
106 3300025258 Ga0209129_1010738 Ga0209129_10107382 299
107 3300025899 Ga0207642_10093568 Ga0207642_100935681 299
108 3300025904 Ga0207647_10000302 Ga0207647_1000030211 299
109 3300025907 Ga0207645_10000067 Ga0207645_1000006714 299
110 3300025913 Ga0207695_10001921 Ga0207695_100019216 299
111 3300025933 Ga0207706_10000538 Ga0207706_1000053814 299
112 3300025938 Ga0207704_10000056 Ga0207704_1000005619 299
113 3300025960 Ga0207651_10010168 Ga0207651_100101682 299
114 3300026041 Ga0207639_10129308 Ga0207639_101293081 299
115 3300026078 Ga0207702_10047973 Ga0207702_100479733 299
116 3300026089 Ga0207648_10000738 Ga0207648_1000073811 299
117 3300026142 Ga0207698_10003486 Ga0207698_100034862 299
118 3300037312 Ga0395899_0000001 Ga0395899_0000001_776892_777857 299
119 3300037312 Ga0395899_0000474 Ga0395899_0000474_30528_31430 299
120 3300037418 Ga0395900_0000413 Ga0395900_0000413_30532_31434 299
121 3300037466 Ga0395898_0007319 Ga0395898_0007319_4642_5544 299
122 3300037471 Ga0395905_0000188 Ga0395905_0000188_66637_67539 299
123 3300038443 Ga0395901_0000611 Ga0395901_0000611_10078_10980 299
124 3300039447 Ga0436361_0746278 Ga0436361_0746278_2059_2961 299
125 3300044684 Ga0466966_0091505 Ga0466966_0091505_729_1631 299
126 3300047443 Ga0495687_001909 Ga0495687_001909_3414_4316 299
127 3300047445 Ga0495677_0050490 Ga0495677_0050490_32_937 299
128 3300053080 Ga0500635_0008967 Ga0500635_0008967_606_1511 299
129 iso_pu_bacteria 2852623160 2852625574 299
130 iso_pu_bacteria 2977232053 2977235620 299
131 3300009093 Ga0105240_10000068 Ga0105240_10000068117 300
132 3300009174 Ga0105241_10012314 Ga0105241_100123147 300
133 3300009545 Ga0105237_10002578 Ga0105237_1000257811 300
134 3300025904 Ga0207647_10125701 Ga0207647_101257011 300
135 3300025913 Ga0207695_10000131 Ga0207695_10000131117 300
136 3300025914 Ga0207671_10000787 Ga0207671_100007874 300
137 3300025914 Ga0207671_10002013 Ga0207671_1000201316 300
138 3300025914 Ga0207671_10411093 Ga0207671_104110931 300
139 3300037312 Ga0395899_0065216 Ga0395899_0065216_15_926 300
140 3300037418 Ga0395900_0011945 Ga0395900_0011945_7629_8540 300
141 3300037466 Ga0395898_0189509 Ga0395898_0189509_256_1167 300
142 3300037471 Ga0395905_0000729 Ga0395905_0000729_11609_12520 300
143 3300038443 Ga0395901_0002249 Ga0395901_0002249_14920_15831 300
144 iso_pu_bacteria 2599185184 2599479688 300
145 iso_pu_bacteria 2884933994 2884934577 300
146 iso_pu_bacteria 2928078545 2928083757 300
147 iso_pu_bacteria 2928147474 2928152198 300
148 iso_pu_bacteria 2932082852 2932084759 300
149 3300002737 JGI25162J39368_1002471 JGI25162J39368_10024715 301
150 3300002772 JGI25164J39214_1003742 JGI25164J39214_10037422 301
151 3300003214 JGI25165J46597_1000399 JGI25165J46597_100039934 301
152 3300003323 rootH1_10328926 rootH1_103289262 301
153 3300005329 Ga0070683_100016372 Ga0070683_1000163724 301
154 3300005535 Ga0070684_100039272 Ga0070684_1000392723 301
155 3300013100 Ga0157373_10000013 Ga0157373_1000001393 301
156 3300013102 Ga0157371_10006033 Ga0157371_100060334 301
157 3300013104 Ga0157370_10081574 Ga0157370_100815742 301
158 3300013105 Ga0157369_10001043 Ga0157369_1000104349 301
159 3300013307 Ga0157372_10000001 Ga0157372_10000001516 301
160 3300013307 Ga0157372_10001765 Ga0157372_100017655 301
161 3300020077 Ga0206351_10757906 Ga0206351_107579062 301
162 3300025230 Ga0209563_103312 Ga0209563_1033123 301
163 3300025231 Ga0207427_100072 Ga0207427_100072105 301
164 3300025233 Ga0209437_100026 Ga0209437_100026237 301
165 3300025261 Ga0209233_1000111 Ga0209233_1000111131 301
166 3300025944 Ga0207661_10020521 Ga0207661_100205213 301
167 3300028653 Ga0265323_10020660 Ga0265323_100206602 301
168 3300037312 Ga0395899_0000150 Ga0395899_0000150_2611_3519 301
169 3300044656 Ga0466969_0109610 Ga0466969_0109610_325_1233 301
170 3300045049 Ga0466959_0210511 Ga0466959_0210511_66_974 301
171 3300045051 Ga0451576_0018886 Ga0451576_0018886_5889_6821 302
172 3300003323 rootH1_10029236 rootH1_100292362 303
173 3300009545 Ga0105237_10074145 Ga0105237_100741452 303
174 3300013306 Ga0163162_10133464 Ga0163162_101334644 303
175 3300001979 JGI24740J21852_10023029 JGI24740J21852_100230292 304
176 3300001990 JGI24737J22298_10000333 JGI24737J22298_1000033314 304
177 3300002067 JGI24735J21928_10000003 JGI24735J21928_1000000377 304
178 3300003316 rootH1_10005973 rootH1_100059735 304
179 3300003322 rootL2_10110501 rootL2_101105016 304
180 3300003323 rootH1_10175076 rootH1_101750765 304
181 3300006195 Ga0075366_10123104 Ga0075366_101231042 304
182 3300009545 Ga0105237_10561895 Ga0105237_105618951 304
183 3300013306 Ga0163162_10011508 Ga0163162_100115086 304
184 3300013307 Ga0157372_10163569 Ga0157372_101635691 304
185 3300025914 Ga0207671_10011597 Ga0207671_100115976 304
186 3300026116 Ga0207674_10257199 Ga0207674_102571991 304
187 3300046471 Ga0495650_0000107 Ga0495650_0000107_161769_162683 304
188 3300046492 Ga0495585_0000753 Ga0495585_0000753_18768_19682 304
189 3300046506 Ga0495583_0010597 Ga0495583_0010597_3400_4314 304
190 3300046507 Ga0495606_0000303 Ga0495606_0000303_22520_23434 304
191 3300046513 Ga0495616_0004163 Ga0495616_0004163_821_1735 304
192 3300046558 Ga0495633_0006747 Ga0495633_0006747_741_1655 304
193 3300046660 Ga0495625_0000021 Ga0495625_0000021_61885_62799 304
194 3300046660 Ga0495625_0019736 Ga0495625_0019736_1401_2315 304
195 3300046665 Ga0495661_0005828 Ga0495661_0005828_15_929 304
196 3300046665 Ga0495661_0104798 Ga0495661_0104798_15_929 304
197 3300046694 Ga0495649_0000009 Ga0495649_0000009_396728_397642 304
198 3300047443 Ga0495687_002406 Ga0495687_002406_8871_9785 304
199 3300047472 Ga0495686_0040834 Ga0495686_0040834_1003_1917 304
200 3300053125 Ga0500618_021901 Ga0500618_021901_518_1432 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

135

305

0.84

PF20434

BD-FAE

BD-FAE

82

276

0.83

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

93

297

0.78

PF00326

Peptidase_S9

Prolyl oligopeptidase family

145

318

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.9183 58 297
6a6o-assembly1.cif.gz_A crystal structure of acetyl ester-xyloside bifunctional hydrolase from caldicellulosiruptor lactoaceticus 0.9076 22 302
6a6o-assembly1.cif.gz_A crystal structure of acetyl ester-xyloside bifunctional hydrolase from caldicellulosiruptor lactoaceticus 0.8818 22 302
6nkf-assembly2.cif.gz_B crystal structure of the lipase lip_vut4 from goat rumen metagenome. 0.817 55 297
6mly-assembly4.cif.gz_D bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.8082 58 299
ID Description Score Start End Superfamily
af_P96402_114_379_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8473 57 285 3.40.50.1820
af_Q966P1_347_555_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7952 71 192 3.40.50.1820
3hxkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7916 42 302 3.40.50.1820
2z3wA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7884 55 275 3.40.50.1820
3hxkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7827 42 302 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7V1SQW2-F1-model_v4 Alpha/beta hydrolase 0.9907 160 302 GO:0006508
GO:0008236
AF-A0A7X8FGZ4-F1-model_v4 Alpha/beta hydrolase 0.978 54 300 GO:0016787
AF-A0A7Y2DH42-F1-model_v4 Prolyl oligopeptidase family serine peptidase 0.9753 143 300 GO:0006508
GO:0008236
AF-A0A7V1SQW2-F1-model_v4 Alpha/beta hydrolase 0.9705 160 302 GO:0006508
GO:0008236
AF-A0A1H7THI8-F1-model_v4 Acetyl esterase/lipase 0.9689 14 299 GO:0016787

Feature Viewer

pLDDT pTM Quality
92.38 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map