F307367

General Info

Members Datasets Scaffolds Average Seq Length
200 111 400 285

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100071903|Ga0307408_1000719032
Length 292
Sequence LRERRLLPEPFFAGPGLDRADALRCQPGRVAELATRSDARQLEWDNGAPALGADGRLRWSAVTGAPPLFLGLAGEVPHFSDLPPGNVPIDSRAHFGLLGALDAADAPVFAAALSLANWHRRHLYCSVCGEPTAPNRGGWSRACPSCAAEHYPRADPVVIMLAEHDGRLLLGRQPQYPPGRFSALAGFVEPGETIEGAVSRELFEEAGIEVRNVTYVASQPWPFPSTLMIGAHAFATSDSLTIDLTELDDARWFSRAEVEAALSGEAGATFLPPPRFAIARTLIEQWASGRLK

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 11
Rhizosphere 88
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100071903 3300031548 Bacteria 2559
2 JGI24737J22298_10009638 3300001990 Bacteria 3203
3 JGI24737J22298_10043560 3300001990 Bacteria 1374
4 rootH2_10110273 3300003320 Bacteria 1605
5 Ga0070658_10015770 3300005327 Bacteria 6040
6 Ga0070658_10057606 3300005327 Bacteria 3161
7 Ga0070683_100323143 3300005329 Bacteria 1469
8 Ga0070670_100138203 3300005331 Bacteria 2106
9 Ga0070666_10075328 3300005335 Bacteria 2301
10 Ga0070666_10164361 3300005335 Bacteria 1552
11 Ga0070660_100008634 3300005339 Bacteria 7135
12 Ga0070660_100011661 3300005339 Bacteria 6257
13 Ga0070661_100008611 3300005344 Bacteria 7056
14 Ga0070661_100343394 3300005344 Bacteria 1170
15 Ga0070692_10022121 3300005345 Bacteria 3103
16 Ga0070675_100077563 3300005354 Bacteria 2766
17 Ga0070671_100003638 3300005355 Bacteria 12072
18 Ga0070671_100055608 3300005355 Bacteria 3292
19 Ga0070671_100077163 3300005355 Bacteria 2784
20 Ga0070671_100083661 3300005355 Bacteria 2668
21 Ga0070671_100101626 3300005355 Bacteria 2412
22 Ga0070673_100086144 3300005364 Bacteria 2559
23 Ga0070659_100012014 3300005366 Bacteria 6410
24 Ga0070667_100057776 3300005367 Bacteria 3280
25 Ga0070667_100307148 3300005367 Bacteria 1429
26 Ga0070714_100031211 3300005435 Bacteria 4444
27 Ga0070714_100176370 3300005435 Bacteria 1942
28 Ga0070713_100003991 3300005436 Bacteria 9825
29 Ga0070713_100030876 3300005436 Bacteria 4261
30 Ga0070663_100005629 3300005455 Bacteria 7461
31 Ga0070663_100012624 3300005455 Bacteria 5354
32 Ga0070663_100046656 3300005455 Bacteria 3066
33 Ga0070662_100046464 3300005457 Bacteria 3120
34 Ga0068867_100018628 3300005459 Bacteria 4936
35 Ga0070679_100334024 3300005530 Bacteria 1464
36 Ga0068853_100038411 3300005539 Bacteria 4077
37 Ga0068855_100075685 3300005563 Bacteria 3908
38 Ga0070664_100010626 3300005564 Bacteria 7458
39 Ga0068857_100370781 3300005577 Bacteria 1328
40 Ga0068854_100009143 3300005578 Bacteria 6389
41 Ga0068854_100038680 3300005578 Bacteria 3356
42 Ga0068854_100218097 3300005578 Bacteria 1508
43 Ga0068856_100083271 3300005614 Bacteria 3176
44 Ga0068856_100135178 3300005614 Bacteria 2471
45 Ga0068852_100012686 3300005616 Bacteria 6411
46 Ga0068852_100068712 3300005616 Bacteria 3102
47 Ga0068859_100406652 3300005617 Bacteria 1457
48 Ga0068864_100003614 3300005618 Bacteria 12788
49 Ga0068864_100012266 3300005618 Bacteria 7083
50 Ga0068851_10000795 3300005834 Bacteria 13623
51 Ga0068863_100012527 3300005841 Bacteria 8182
52 Ga0068863_100100041 3300005841 Bacteria 2755
53 Ga0068863_100140678 3300005841 Bacteria 2306
54 Ga0070717_10023236 3300006028 Bacteria 4910
55 Ga0070716_100010913 3300006173 Bacteria 4569
56 Ga0068871_100013510 3300006358 Bacteria 6060
57 Ga0068871_100183617 3300006358 Bacteria 1799
58 Ga0068865_100058082 3300006881 Bacteria 2701
59 Ga0097620_100406647 3300006931 Bacteria 1457
60 Ga0105240_10165125 3300009093 Bacteria 2626
61 Ga0105240_10181993 3300009093 Bacteria 2479
62 Ga0105240_10268227 3300009093 Bacteria 1967
63 Ga0105248_10009653 3300009177 Bacteria 10628
64 Ga0105248_10247444 3300009177 Bacteria 2007
65 Ga0157371_10038766 3300013102 Bacteria 3408
66 Ga0157371_10055644 3300013102 Bacteria 2807
67 Ga0157371_10086270 3300013102 Bacteria 2223
68 Ga0157370_10016268 3300013104 Bacteria 7537
69 Ga0157370_10517097 3300013104 Bacteria 1096
70 Ga0157369_10022635 3300013105 Bacteria 7008
71 Ga0157369_10155255 3300013105 Bacteria 2418
72 Ga0157374_10018730 3300013296 Bacteria 6117
73 Ga0157374_10026895 3300013296 Bacteria 5181
74 Ga0157374_10280556 3300013296 Bacteria 1645
75 Ga0157378_10119500 3300013297 Bacteria 2427
76 Ga0157372_10266210 3300013307 Bacteria 1990
77 Ga0163163_10337319 3300014325 Bacteria 1562
78 Ga0207656_10012717 3300025321 Bacteria 3205
79 Ga0207680_10015203 3300025903 Bacteria 4012
80 Ga0207647_10046961 3300025904 Bacteria 2688
81 Ga0207705_10005717 3300025909 Bacteria 9289
82 Ga0207705_10006021 3300025909 Bacteria 9024
83 Ga0207705_10015673 3300025909 Bacteria 5443
84 Ga0207705_10037174 3300025909 Bacteria 3484
85 Ga0207695_10004707 3300025913 Bacteria 18479
86 Ga0207657_10001752 3300025919 Bacteria 23415
87 Ga0207657_10010177 3300025919 Bacteria 9394
88 Ga0207649_10004077 3300025920 Bacteria 7951
89 Ga0207664_10057267 3300025929 Bacteria 3098
90 Ga0207664_10166660 3300025929 Bacteria 1883
91 Ga0207644_10000135 3300025931 Bacteria 53131
92 Ga0207644_10002016 3300025931 Bacteria 13125
93 Ga0207644_10032848 3300025931 Bacteria 3623
94 Ga0207644_10063087 3300025931 Bacteria 2690
95 Ga0207644_10104016 3300025931 Bacteria 2137
96 Ga0207690_10027386 3300025932 Bacteria 3601
97 Ga0207706_10095117 3300025933 Bacteria 2621
98 Ga0207704_10071775 3300025938 Bacteria 2198
99 Ga0207665_10006852 3300025939 Bacteria 7543
100 Ga0207711_10011684 3300025941 Bacteria 7296
101 Ga0207711_10015207 3300025941 Bacteria 6390
102 Ga0207661_10288575 3300025944 Bacteria 1468
103 Ga0207679_10061996 3300025945 Bacteria 2785
104 Ga0207667_10153275 3300025949 Bacteria 2371
105 Ga0207651_10021066 3300025960 Bacteria 3952
106 Ga0207651_10289932 3300025960 Bacteria 1356
107 Ga0207640_10025647 3300025981 Bacteria 3570
108 Ga0207640_10028826 3300025981 Bacteria 3399
109 Ga0207640_10388737 3300025981 Bacteria 1133
110 Ga0207677_10224883 3300026023 Bacteria 1508
111 Ga0207639_10182046 3300026041 Bacteria 1788
112 Ga0207678_10000736 3300026067 Bacteria 29995
113 Ga0207678_10034690 3300026067 Bacteria 4394
114 Ga0207678_10102020 3300026067 Bacteria 2449
115 Ga0207702_10043115 3300026078 Bacteria 3787
116 Ga0207702_10138404 3300026078 Bacteria 2200
117 Ga0207641_10156889 3300026088 Bacteria 2065
118 Ga0207641_10260246 3300026088 Bacteria 1624
119 Ga0207641_10643068 3300026088 Bacteria 1041
120 Ga0207648_10015219 3300026089 Bacteria 7077
121 Ga0207676_10010375 3300026095 Bacteria 6634
122 Ga0207676_10011635 3300026095 Bacteria 6292
123 Ga0207674_10001496 3300026116 Bacteria 30156
124 Ga0207698_10014994 3300026142 Bacteria 5174
125 Ga0207698_10034733 3300026142 Bacteria 3679
126 Ga0207698_10547554 3300026142 Bacteria 1133
127 Ga0307408_100049525 3300031548 Bacteria 3018
128 Ga0307408_100166909 3300031548 Bacteria 1754
129 Ga0307406_10078025 3300031901 Bacteria 2193
130 Ga0307407_10035469 3300031903 Bacteria 2740
131 Ga0307407_10240655 3300031903 Bacteria 1234
132 Ga0307412_10129723 3300031911 Bacteria 1829
133 Ga0307412_10156060 3300031911 Bacteria 1689
134 Ga0307412_10224195 3300031911 Bacteria 1443
135 Ga0307414_10061988 3300032004 Bacteria 2651
136 Ga0307414_10374137 3300032004 Bacteria 1229
137 Ga0307414_10452272 3300032004 Bacteria 1126
138 Ga0307411_10048468 3300032005 Bacteria 2753
139 Ga0307411_10071707 3300032005 Bacteria 2349
140 Ga0307415_100102873 3300032126 Bacteria 2100
141 Ga0373935_0038730 3300035692 Bacteria 2986
142 Ga0395900_0080324 3300037418 Bacteria 3351
143 Ga0395900_0123704 3300037418 Bacteria 2653
144 Ga0395900_0224652 3300037418 Bacteria 1891
145 Ga0395900_0288228 3300037418 Bacteria 1631
146 Ga0395900_0554599 3300037418 Bacteria 1093
147 Ga0395898_0016607 3300037466 Bacteria 7525
148 Ga0395898_0027891 3300037466 Bacteria 5662
149 Ga0395905_0000946 3300037471 Bacteria 37278
150 Ga0395905_0002968 3300037471 Bacteria 18443
151 Ga0395905_0040975 3300037471 Bacteria 4345
152 Ga0395905_0046193 3300037471 Bacteria 4083
153 Ga0395905_0051441 3300037471 Bacteria 3859
154 Ga0395905_0194876 3300037471 Bacteria 1900
155 Ga0395905_0393560 3300037471 Bacteria 1280
156 Ga0395901_0027747 3300038443 Bacteria 5821
157 Ga0395901_0035267 3300038443 Bacteria 5168
158 Ga0395901_0141012 3300038443 Bacteria 2533
159 Ga0395901_0241143 3300038443 Bacteria 1885
160 Ga0466969_0004089 3300044656 Bacteria 7739
161 Ga0466966_0010263 3300044684 Bacteria 6214
162 Ga0466961_0025073 3300044693 Bacteria 3837
163 Ga0466963_0067715 3300044694 Bacteria 2396
164 Ga0466971_0004831 3300044719 Bacteria 5831
165 Ga0466971_0034871 3300044719 Bacteria 2255
166 Ga0466968_0009478 3300044735 Bacteria 3746
167 Ga0466957_0078864 3300044842 Bacteria 2048
168 Ga0466957_0133813 3300044842 Bacteria 1591
169 Ga0466959_0040210 3300045049 Bacteria 3455
170 Ga0466959_0065726 3300045049 Bacteria 2632
171 Ga0466967_0007059 3300045976 Bacteria 8046
172 Ga0466967_0023810 3300045976 Bacteria 5024
173 Ga0466967_0193449 3300045976 Bacteria 1923
174 Ga0466967_0199921 3300045976 Bacteria 1892
175 Ga0495647_0098817 3300046681 Unclassified 1206
176 Ga0496100_0049641 3300048903 Bacteria 2715
177 Ga0496100_0055397 3300048903 Bacteria 2590
178 Ga0496101_0111947 3300048904 Bacteria 2056
179 Ga0496101_0175263 3300048904 Bacteria 1649
180 Ga0496104_0059676 3300048907 Bacteria 3612
181 Ga0496105_0019452 3300048908 Bacteria 5477
182 Ga0496107_0067554 3300048910 Bacteria 2594
183 Ga0496107_0176978 3300048910 Bacteria 1584
184 Ga0496107_0250969 3300048910 Bacteria 1316
185 Ga0496108_0082535 3300048911 Bacteria 2726
186 Ga0496108_0091062 3300048911 Bacteria 2592
187 Ga0496109_0021169 3300048912 Bacteria 5749
188 Ga0496109_0115951 3300048912 Bacteria 2492
189 Ga0496110_0004587 3300048913 Bacteria 10734
190 Ga0496110_0070023 3300048913 Bacteria 3107
191 Ga0496111_0031164 3300048914 Bacteria 3797
192 Ga0496112_0030963 3300048915 Bacteria 5184
193 Ga0496112_0054064 3300048915 Bacteria 3944
194 Ga0496112_0276662 3300048915 Bacteria 1626
195 Ga0496113_0094703 3300048916 Bacteria 2307
196 Ga0496114_0004976 3300048917 Bacteria 10367
197 Ga0496115_0027156 3300048918 Bacteria 4474
198 Ga0501074_0030196 3300049590 Bacteria 3928
199 Ga0500616_0035175 3300053153 Bacteria 2725
200 Ga0466962_0041758 3300061719 Bacteria 2194
201 Ga0307408_100071903
202 JGI24737J22298_10009638
203 JGI24737J22298_10043560
204 rootH2_10110273
205 Ga0070658_10015770
206 Ga0070658_10057606
207 Ga0070683_100323143
208 Ga0070670_100138203
209 Ga0070666_10075328
210 Ga0070666_10164361
211 Ga0070660_100008634
212 Ga0070660_100011661
213 Ga0070661_100008611
214 Ga0070661_100343394
215 Ga0070692_10022121
216 Ga0070675_100077563
217 Ga0070671_100003638
218 Ga0070671_100055608
219 Ga0070671_100077163
220 Ga0070671_100083661
221 Ga0070671_100101626
222 Ga0070673_100086144
223 Ga0070659_100012014
224 Ga0070667_100057776
225 Ga0070667_100307148
226 Ga0070714_100031211
227 Ga0070714_100176370
228 Ga0070713_100003991
229 Ga0070713_100030876
230 Ga0070663_100005629
231 Ga0070663_100012624
232 Ga0070663_100046656
233 Ga0070662_100046464
234 Ga0068867_100018628
235 Ga0070679_100334024
236 Ga0068853_100038411
237 Ga0068855_100075685
238 Ga0070664_100010626
239 Ga0068857_100370781
240 Ga0068854_100009143
241 Ga0068854_100038680
242 Ga0068854_100218097
243 Ga0068856_100083271
244 Ga0068856_100135178
245 Ga0068852_100012686
246 Ga0068852_100068712
247 Ga0068859_100406652
248 Ga0068864_100003614
249 Ga0068864_100012266
250 Ga0068851_10000795
251 Ga0068863_100012527
252 Ga0068863_100100041
253 Ga0068863_100140678
254 Ga0070717_10023236
255 Ga0070716_100010913
256 Ga0068871_100013510
257 Ga0068871_100183617
258 Ga0068865_100058082
259 Ga0097620_100406647
260 Ga0105240_10165125
261 Ga0105240_10181993
262 Ga0105240_10268227
263 Ga0105248_10009653
264 Ga0105248_10247444
265 Ga0157371_10038766
266 Ga0157371_10055644
267 Ga0157371_10086270
268 Ga0157370_10016268
269 Ga0157370_10517097
270 Ga0157369_10022635
271 Ga0157369_10155255
272 Ga0157374_10018730
273 Ga0157374_10026895
274 Ga0157374_10280556
275 Ga0157378_10119500
276 Ga0157372_10266210
277 Ga0163163_10337319
278 Ga0207656_10012717
279 Ga0207680_10015203
280 Ga0207647_10046961
281 Ga0207705_10005717
282 Ga0207705_10006021
283 Ga0207705_10015673
284 Ga0207705_10037174
285 Ga0207695_10004707
286 Ga0207657_10001752
287 Ga0207657_10010177
288 Ga0207649_10004077
289 Ga0207664_10057267
290 Ga0207664_10166660
291 Ga0207644_10000135
292 Ga0207644_10002016
293 Ga0207644_10032848
294 Ga0207644_10063087
295 Ga0207644_10104016
296 Ga0207690_10027386
297 Ga0207706_10095117
298 Ga0207704_10071775
299 Ga0207665_10006852
300 Ga0207711_10011684
301 Ga0207711_10015207
302 Ga0207661_10288575
303 Ga0207679_10061996
304 Ga0207667_10153275
305 Ga0207651_10021066
306 Ga0207651_10289932
307 Ga0207640_10025647
308 Ga0207640_10028826
309 Ga0207640_10388737
310 Ga0207677_10224883
311 Ga0207639_10182046
312 Ga0207678_10000736
313 Ga0207678_10034690
314 Ga0207678_10102020
315 Ga0207702_10043115
316 Ga0207702_10138404
317 Ga0207641_10156889
318 Ga0207641_10260246
319 Ga0207641_10643068
320 Ga0207648_10015219
321 Ga0207676_10010375
322 Ga0207676_10011635
323 Ga0207674_10001496
324 Ga0207698_10014994
325 Ga0207698_10034733
326 Ga0207698_10547554
327 Ga0307408_100049525
328 Ga0307408_100166909
329 Ga0307406_10078025
330 Ga0307407_10035469
331 Ga0307407_10240655
332 Ga0307412_10129723
333 Ga0307412_10156060
334 Ga0307412_10224195
335 Ga0307414_10061988
336 Ga0307414_10374137
337 Ga0307414_10452272
338 Ga0307411_10048468
339 Ga0307411_10071707
340 Ga0307415_100102873
341 Ga0373935_0038730
342 Ga0395900_0080324
343 Ga0395900_0123704
344 Ga0395900_0224652
345 Ga0395900_0288228
346 Ga0395900_0554599
347 Ga0395898_0016607
348 Ga0395898_0027891
349 Ga0395905_0000946
350 Ga0395905_0002968
351 Ga0395905_0040975
352 Ga0395905_0046193
353 Ga0395905_0051441
354 Ga0395905_0194876
355 Ga0395905_0393560
356 Ga0395901_0027747
357 Ga0395901_0035267
358 Ga0395901_0141012
359 Ga0395901_0241143
360 Ga0466969_0004089
361 Ga0466966_0010263
362 Ga0466961_0025073
363 Ga0466963_0067715
364 Ga0466971_0004831
365 Ga0466971_0034871
366 Ga0466968_0009478
367 Ga0466957_0078864
368 Ga0466957_0133813
369 Ga0466959_0040210
370 Ga0466959_0065726
371 Ga0466967_0007059
372 Ga0466967_0023810
373 Ga0466967_0193449
374 Ga0466967_0199921
375 Ga0495647_0098817
376 Ga0496100_0049641
377 Ga0496100_0055397
378 Ga0496101_0111947
379 Ga0496101_0175263
380 Ga0496104_0059676
381 Ga0496105_0019452
382 Ga0496107_0067554
383 Ga0496107_0176978
384 Ga0496107_0250969
385 Ga0496108_0082535
386 Ga0496108_0091062
387 Ga0496109_0021169
388 Ga0496109_0115951
389 Ga0496110_0004587
390 Ga0496110_0070023
391 Ga0496111_0031164
392 Ga0496112_0030963
393 Ga0496112_0054064
394 Ga0496112_0276662
395 Ga0496113_0094703
396 Ga0496114_0004976
397 Ga0496115_0027156
398 Ga0501074_0030196
399 Ga0500616_0035175
400 Ga0466962_0041758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09297

zf-NADH-PPase

NADH pyrophosphatase zinc ribbon domain

120

151

0.99

PF00293

NUDIX

NUDIX domain

152

272

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kyx-assembly1.cif.gz_A crystal structure of adp-ribose pyrophosphatase mutt from rickettsia felis 0.8672 149 250
5wy6-assembly1.cif.gz_A crystal structure of atnudx1 (e56a) 0.8652 149 248
6ypf-assembly1.cif.gz_A nudix1 hydrolase from rosa x hybrida in complex with geranyl pyrophosphate 0.8638 149 250
6t5j-assembly1.cif.gz_B structure of nudt15 in complex with inhibitor th1760 0.8523 149 246
5gp0-assembly1.cif.gz_I crystal structure of geraniol-nudx1 complex 0.8521 149 248
ID Description Score Start End Superfamily
af_A0A0R4ISD4_291_431_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9753 149 282 3.90.79.10
af_I1MUA9_246_385_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9638 147 255 3.90.79.10
af_P9WIX5_169_312_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9378 149 283 3.90.79.10
af_Q94A82_242_424_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9252 147 283 3.90.79.10
af_A4I7A0_174_307_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9214 149 280 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A355SXE0-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9606 147 282 GO:0005777
GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-A0A529GC98-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9515 154 283 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-A0A351DPT9-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.945 150 282 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
AF-A0A355SXE0-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9403 147 282 GO:0005777
GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-A0A529GC98-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9376 154 283 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872

Map