F307259

General Info

Members Datasets Scaffolds Average Seq Length
200 129 400 209

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10513760|Ga0207650_105137602
Length 244
Sequence MKGERTRAGILDRAVDLASLEGLEGVTIGRLADELSMSKSGLFAHFGSKEELQLATVQAARDRFVDEVVRPALGTPRGYERLIAICRSWLDYVRRQVFPGGCFFAAASFEFDGRPGVVRDAIAAAMDDWMATLEKAIRMAREEKHLDSKIDPPQLAFELNALFFGANFAWNLRHDAKAFARAQRAIEERLEGVRVVAGASEGPGGAGGARKDATRVTRRPGSLAHARGKVKSSARAPRARRRNA

Samples

Sample ID Description Type Environment
1 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
109 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.5
Nodule 0
Rhizoplane 1
Rhizosphere 93
Stem 0
Stem Tuber 0
Unclassified 3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207650_10513760 3300025925 Bacteria 1002
2 Ga0065715_10352101 3300005293 Bacteria 949
3 Ga0065707_10126166 3300005295 Unclassified 2008
4 Ga0070670_100037570 3300005331 Bacteria 4166
5 Ga0070677_10081868 3300005333 Bacteria 1383
6 Ga0068869_100129051 3300005334 Bacteria 1942
7 Ga0068869_100227116 3300005334 Bacteria 1482
8 Ga0070682_100000003 3300005337 Bacteria 469319
9 Ga0068868_100002130 3300005338 Bacteria 13659
10 Ga0070689_100063162 3300005340 Bacteria 2882
11 Ga0070692_10017556 3300005345 Bacteria 3424
12 Ga0070675_100000038 3300005354 Bacteria 84939
13 Ga0070714_100005532 3300005435 Bacteria 9648
14 Ga0070713_100234555 3300005436 Bacteria 1669
15 Ga0070701_10000437 3300005438 Bacteria 14250
16 Ga0068867_100082020 3300005459 Bacteria 2432
17 Ga0070706_100053350 3300005467 Bacteria 3731
18 Ga0070706_100377899 3300005467 Bacteria 1320
19 Ga0070707_100012251 3300005468 Bacteria 8009
20 Ga0070707_100125718 3300005468 Bacteria 2491
21 Ga0070698_100213704 3300005471 Unclassified 1863
22 Ga0070698_100479653 3300005471 Bacteria 1180
23 Ga0070699_100015505 3300005518 Bacteria 6550
24 Ga0070697_100030994 3300005536 Bacteria 4299
25 Ga0070697_100447683 3300005536 Bacteria 1125
26 Ga0068853_100583424 3300005539 Bacteria 1061
27 Ga0070696_100081912 3300005546 Bacteria 2287
28 Ga0070693_100559984 3300005547 Bacteria 819
29 Ga0070693_100719851 3300005547 Bacteria 732
30 Ga0068857_100059496 3300005577 Bacteria 3394
31 Ga0070702_100061187 3300005615 Bacteria 2192
32 Ga0068864_100000059 3300005618 Bacteria 125184
33 Ga0068861_100043330 3300005719 Bacteria 3377
34 Ga0068858_100000320 3300005842 Bacteria 50732
35 Ga0068858_100698604 3300005842 Bacteria 987
36 Ga0081455_10017080 3300005937 Bacteria 6975
37 Ga0081455_10061820 3300005937 Bacteria 3150
38 Ga0081455_10180315 3300005937 Bacteria 1600
39 Ga0081538_10000529 3300005981 Bacteria 42265
40 Ga0081538_10011746 3300005981 Bacteria 7066
41 Ga0081539_10009415 3300005985 Bacteria 8171
42 Ga0081539_10139895 3300005985 Bacteria 1177
43 Ga0070717_10000048 3300006028 Bacteria 104474
44 Ga0075365_10095863 3300006038 Bacteria 2027
45 Ga0075364_10151925 3300006051 Bacteria 1560
46 Ga0070716_100206280 3300006173 Bacteria 1310
47 Ga0075362_10026956 3300006177 Bacteria 2458
48 Ga0097621_100755660 3300006237 Bacteria 898
49 Ga0075428_100009726 3300006844 Bacteria 10681
50 Ga0075430_100015889 3300006846 Bacteria 6411
51 Ga0075431_100008291 3300006847 Bacteria 10390
52 Ga0075433_10609031 3300006852 Bacteria 959
53 Ga0075434_100128191 3300006871 Bacteria 2555
54 Ga0075434_100251354 3300006871 Bacteria 1787
55 Ga0075434_100287980 3300006871 Bacteria 1663
56 Ga0075434_100582416 3300006871 Bacteria 1138
57 Ga0075434_100677447 3300006871 Unclassified 1049
58 Ga0075429_100074619 3300006880 Bacteria 2954
59 Ga0075429_100162616 3300006880 Bacteria 1955
60 Ga0075429_100766736 3300006880 Bacteria 845
61 Ga0068865_100181980 3300006881 Bacteria 1619
62 Ga0075436_100002497 3300006914 Bacteria 12654
63 Ga0075435_100000721 3300007076 Bacteria 20542
64 Ga0075435_100027050 3300007076 Bacteria 4483
65 Ga0099794_10006681 3300007265 Bacteria 4685
66 Ga0105244_10018187 3300009036 Bacteria 3951
67 Ga0111539_10084720 3300009094 Bacteria 3726
68 Ga0111539_10246723 3300009094 Bacteria 2079
69 Ga0105245_10001596 3300009098 Bacteria 20629
70 Ga0105245_10022891 3300009098 Bacteria 5481
71 Ga0105245_10133653 3300009098 Bacteria 2329
72 Ga0105245_10846837 3300009098 Bacteria 954
73 Ga0114129_10286458 3300009147 Bacteria 2199
74 Ga0105242_10004536 3300009176 Bacteria 10778
75 Ga0105238_10000041 3300009551 Bacteria 155330
76 Ga0105239_10123914 3300010375 Bacteria 2871
77 Ga0105246_10113475 3300011119 Bacteria 1995
78 Ga0157374_10000006 3300013296 Bacteria 640284
79 Ga0157378_10000542 3300013297 Bacteria 35926
80 Ga0157378_10000548 3300013297 Bacteria 35667
81 Ga0157378_10250496 3300013297 Bacteria 1695
82 Ga0157380_10133360 3300014326 Bacteria 2122
83 Ga0157380_10630192 3300014326 Unclassified 1066
84 Ga0157377_10000011 3300014745 Bacteria 305350
85 Ga0157377_10000125 3300014745 Bacteria 49824
86 Ga0157377_10296283 3300014745 Bacteria 1066
87 Ga0213876_10000007 3300021384 Bacteria 670340
88 Ga0213876_10267669 3300021384 Bacteria 908
89 Ga0207655_1072674 3300025728 Bacteria 1271
90 Ga0207682_10116164 3300025893 Bacteria 1183
91 Ga0207699_10085864 3300025906 Bacteria 1964
92 Ga0207699_10162976 3300025906 Bacteria 1486
93 Ga0207643_10034936 3300025908 Bacteria 2817
94 Ga0207684_10008992 3300025910 Bacteria 8858
95 Ga0207684_10423829 3300025910 Bacteria 1143
96 Ga0207660_10164524 3300025917 Bacteria 1714
97 Ga0207662_10001184 3300025918 Bacteria 12405
98 Ga0207646_10186409 3300025922 Unclassified 1874
99 Ga0207646_10187471 3300025922 Bacteria 1868
100 Ga0207646_10261457 3300025922 Bacteria 1564
101 Ga0207681_10682495 3300025923 Bacteria 853
102 Ga0207694_10000001 3300025924 Bacteria 4078485
103 Ga0207650_10222713 3300025925 Bacteria 1519
104 Ga0207659_10000009 3300025926 Bacteria 308304
105 Ga0207687_10000196 3300025927 Bacteria 40845
106 Ga0207687_10000885 3300025927 Bacteria 20316
107 Ga0207664_10004513 3300025929 Bacteria 9434
108 Ga0207686_10084105 3300025934 Bacteria 2084
109 Ga0207670_10021638 3300025936 Bacteria 3971
110 Ga0207670_10316580 3300025936 Bacteria 1227
111 Ga0207704_10010006 3300025938 Bacteria 4603
112 Ga0207665_10195354 3300025939 Bacteria 1472
113 Ga0207689_10001493 3300025942 Bacteria 22320
114 Ga0207661_10227125 3300025944 Bacteria 1652
115 Ga0207661_10534155 3300025944 Bacteria 1073
116 Ga0207651_10114826 3300025960 Bacteria 2029
117 Ga0207640_10004463 3300025981 Bacteria 7584
118 Ga0207677_10000006 3300026023 Bacteria 283855
119 Ga0207703_10000004 3300026035 Bacteria 526312
120 Ga0207703_11164448 3300026035 Bacteria 741
121 Ga0207648_10032443 3300026089 Bacteria 4611
122 Ga0207676_10000007 3300026095 Bacteria 591074
123 Ga0207674_10063084 3300026116 Bacteria 3741
124 Ga0207675_100062771 3300026118 Bacteria 3471
125 Ga0209588_1018167 3300027671 Bacteria 2188
126 Ga0207428_10021872 3300027907 Bacteria 5407
127 Ga0207428_10316525 3300027907 Bacteria 1153
128 Ga0307511_10067206 3300030521 Bacteria 2662
129 Ga0307416_100141969 3300032002 Bacteria 2185
130 Ga0373932_0000030 3300035112 Bacteria 38926
131 Ga0395899_0038233 3300037312 Bacteria 3595
132 Ga0395900_0013924 3300037418 Bacteria 8209
133 Ga0395900_0025595 3300037418 Bacteria 6040
134 Ga0395900_0130345 3300037418 Bacteria 2577
135 Ga0395900_0274353 3300037418 Bacteria 1680
136 Ga0395900_0713540 3300037418 Bacteria 935
137 Ga0395898_0007165 3300037466 Bacteria 11841
138 Ga0395898_0020621 3300037466 Bacteria 6694
139 Ga0395898_0056025 3300037466 Bacteria 3844
140 Ga0395898_0151158 3300037466 Bacteria 2221
141 Ga0395898_0227725 3300037466 Bacteria 1778
142 Ga0395898_0232343 3300037466 Bacteria 1759
143 Ga0395898_0399463 3300037466 Bacteria 1310
144 Ga0395898_0600448 3300037466 Bacteria 1043
145 Ga0395905_0010679 3300037471 Bacteria 8905
146 Ga0395905_0026163 3300037471 Bacteria 5503
147 Ga0395905_0042759 3300037471 Bacteria 4251
148 Ga0395905_0149131 3300037471 Bacteria 2200
149 Ga0395905_0212408 3300037471 Bacteria 1812
150 Ga0395905_0260320 3300037471 Bacteria 1620
151 Ga0395905_0577776 3300037471 Bacteria 1025
152 Ga0436364_0585321 3300037853 Bacteria 1651
153 Ga0395901_0005037 3300038443 Bacteria 13339
154 Ga0395901_0014944 3300038443 Bacteria 7888
155 Ga0395901_0023741 3300038443 Bacteria 6288
156 Ga0395901_0083992 3300038443 Bacteria 3328
157 Ga0395901_0086262 3300038443 Bacteria 3282
158 Ga0395901_0094465 3300038443 Bacteria 3132
159 Ga0395901_0666032 3300038443 Bacteria 1042
160 Ga0436365_0394061 3300039437 Bacteria 142715
161 Ga0436362_0290430 3300039453 Bacteria 772596
162 Ga0450915_002941 3300042119 Bacteria 929
163 Ga0466957_0311918 3300044842 Bacteria 1059
164 Ga0466959_0025156 3300045049 Bacteria 4410
165 Ga0451576_0494514 3300045051 Bacteria 1285
166 Ga0495607_0050206 3300046501 Bacteria 2430
167 Ga0495620_0000572 3300046515 Bacteria 23143
168 Ga0495630_0412970 3300046517 Bacteria 1034
169 Ga0495609_0122043 3300046538 Bacteria 1120
170 Ga0495659_0080152 3300046664 Bacteria 1238
171 Ga0496104_0096160 3300048907 Bacteria 2834
172 Ga0496106_0142654 3300048909 Bacteria 1885
173 Ga0501073_0003265 3300049589 Bacteria 12168
174 Ga0501074_0533356 3300049590 Bacteria 831
175 Ga0501080_0012145 3300049742 Bacteria 7891
176 Ga0501081_0795340 3300049743 Bacteria 712
177 nmdc:mga03683_34158_c1 3300050489 Bacteria 2057
178 nmdc:mga00v17_98598_c1 3300050491 Bacteria 1843
179 nmdc:mga0yw44_112886_c1 3300050492 Bacteria 1743
180 nmdc:mga0yw44_202713_c1 3300050492 Bacteria 1310
181 nmdc:mga05p37_314910_c1 3300050507 Bacteria 1854
182 nmdc:mga05p37_498329_c1 3300050507 Bacteria 1399
183 nmdc:mga05p37_599679_c1 3300050507 Bacteria 1243
184 nmdc:mga09592_108000_c1 3300050508 Bacteria 2387
185 nmdc:mga0qj67_134428_c1 3300050509 Bacteria 2004
186 nmdc:mga06r32_388743_c1 3300050510 Bacteria 1378
187 nmdc:mga06r32_662_c1 3300050510 Bacteria 29962
188 nmdc:mga08y16_221051_c1 3300050511 Bacteria 1961
189 nmdc:mga08y16_89065_c1 3300050511 Bacteria 3216
190 nmdc:mga0n895_139034_c1 3300050512 Bacteria 2456
191 nmdc:mga0n895_214574_c1 3300050512 Unclassified 1954
192 nmdc:mga0n895_453828_c1 3300050512 Bacteria 1294
193 nmdc:mga0n895_89108_c1 3300050512 Bacteria 3086
194 nmdc:mga0rr50_148_c1 3300050513 Bacteria 38704
195 nmdc:mga0rr50_19279_c1 3300050513 Bacteria 4600
196 nmdc:mga0rr50_20222_c1 3300050513 Bacteria 4513
197 nmdc:mga08x19_1825_c1 3300050514 Bacteria 13065
198 nmdc:mga0a205_375961_c1 3300050515 Bacteria 1286
199 Ga0495655_0000109 3300053083 Bacteria 15525
200 Ga0501082_0668196 3300060353 Bacteria 909
201 Ga0207650_10513760
202 Ga0065715_10352101
203 Ga0065707_10126166
204 Ga0070670_100037570
205 Ga0070677_10081868
206 Ga0068869_100129051
207 Ga0068869_100227116
208 Ga0070682_100000003
209 Ga0068868_100002130
210 Ga0070689_100063162
211 Ga0070692_10017556
212 Ga0070675_100000038
213 Ga0070714_100005532
214 Ga0070713_100234555
215 Ga0070701_10000437
216 Ga0068867_100082020
217 Ga0070706_100053350
218 Ga0070706_100377899
219 Ga0070707_100012251
220 Ga0070707_100125718
221 Ga0070698_100213704
222 Ga0070698_100479653
223 Ga0070699_100015505
224 Ga0070697_100030994
225 Ga0070697_100447683
226 Ga0068853_100583424
227 Ga0070696_100081912
228 Ga0070693_100559984
229 Ga0070693_100719851
230 Ga0068857_100059496
231 Ga0070702_100061187
232 Ga0068864_100000059
233 Ga0068861_100043330
234 Ga0068858_100000320
235 Ga0068858_100698604
236 Ga0081455_10017080
237 Ga0081455_10061820
238 Ga0081455_10180315
239 Ga0081538_10000529
240 Ga0081538_10011746
241 Ga0081539_10009415
242 Ga0081539_10139895
243 Ga0070717_10000048
244 Ga0075365_10095863
245 Ga0075364_10151925
246 Ga0070716_100206280
247 Ga0075362_10026956
248 Ga0097621_100755660
249 Ga0075428_100009726
250 Ga0075430_100015889
251 Ga0075431_100008291
252 Ga0075433_10609031
253 Ga0075434_100128191
254 Ga0075434_100251354
255 Ga0075434_100287980
256 Ga0075434_100582416
257 Ga0075434_100677447
258 Ga0075429_100074619
259 Ga0075429_100162616
260 Ga0075429_100766736
261 Ga0068865_100181980
262 Ga0075436_100002497
263 Ga0075435_100000721
264 Ga0075435_100027050
265 Ga0099794_10006681
266 Ga0105244_10018187
267 Ga0111539_10084720
268 Ga0111539_10246723
269 Ga0105245_10001596
270 Ga0105245_10022891
271 Ga0105245_10133653
272 Ga0105245_10846837
273 Ga0114129_10286458
274 Ga0105242_10004536
275 Ga0105238_10000041
276 Ga0105239_10123914
277 Ga0105246_10113475
278 Ga0157374_10000006
279 Ga0157378_10000542
280 Ga0157378_10000548
281 Ga0157378_10250496
282 Ga0157380_10133360
283 Ga0157380_10630192
284 Ga0157377_10000011
285 Ga0157377_10000125
286 Ga0157377_10296283
287 Ga0213876_10000007
288 Ga0213876_10267669
289 Ga0207655_1072674
290 Ga0207682_10116164
291 Ga0207699_10085864
292 Ga0207699_10162976
293 Ga0207643_10034936
294 Ga0207684_10008992
295 Ga0207684_10423829
296 Ga0207660_10164524
297 Ga0207662_10001184
298 Ga0207646_10186409
299 Ga0207646_10187471
300 Ga0207646_10261457
301 Ga0207681_10682495
302 Ga0207694_10000001
303 Ga0207650_10222713
304 Ga0207659_10000009
305 Ga0207687_10000196
306 Ga0207687_10000885
307 Ga0207664_10004513
308 Ga0207686_10084105
309 Ga0207670_10021638
310 Ga0207670_10316580
311 Ga0207704_10010006
312 Ga0207665_10195354
313 Ga0207689_10001493
314 Ga0207661_10227125
315 Ga0207661_10534155
316 Ga0207651_10114826
317 Ga0207640_10004463
318 Ga0207677_10000006
319 Ga0207703_10000004
320 Ga0207703_11164448
321 Ga0207648_10032443
322 Ga0207676_10000007
323 Ga0207674_10063084
324 Ga0207675_100062771
325 Ga0209588_1018167
326 Ga0207428_10021872
327 Ga0207428_10316525
328 Ga0307511_10067206
329 Ga0307416_100141969
330 Ga0373932_0000030
331 Ga0395899_0038233
332 Ga0395900_0013924
333 Ga0395900_0025595
334 Ga0395900_0130345
335 Ga0395900_0274353
336 Ga0395900_0713540
337 Ga0395898_0007165
338 Ga0395898_0020621
339 Ga0395898_0056025
340 Ga0395898_0151158
341 Ga0395898_0227725
342 Ga0395898_0232343
343 Ga0395898_0399463
344 Ga0395898_0600448
345 Ga0395905_0010679
346 Ga0395905_0026163
347 Ga0395905_0042759
348 Ga0395905_0149131
349 Ga0395905_0212408
350 Ga0395905_0260320
351 Ga0395905_0577776
352 Ga0436364_0585321
353 Ga0395901_0005037
354 Ga0395901_0014944
355 Ga0395901_0023741
356 Ga0395901_0083992
357 Ga0395901_0086262
358 Ga0395901_0094465
359 Ga0395901_0666032
360 Ga0436365_0394061
361 Ga0436362_0290430
362 Ga0450915_002941
363 Ga0466957_0311918
364 Ga0466959_0025156
365 Ga0451576_0494514
366 Ga0495607_0050206
367 Ga0495620_0000572
368 Ga0495630_0412970
369 Ga0495609_0122043
370 Ga0495659_0080152
371 Ga0496104_0096160
372 Ga0496106_0142654
373 Ga0501073_0003265
374 Ga0501074_0533356
375 Ga0501080_0012145
376 Ga0501081_0795340
377 nmdc:mga03683_34158_c1
378 nmdc:mga00v17_98598_c1
379 nmdc:mga0yw44_112886_c1
380 nmdc:mga0yw44_202713_c1
381 nmdc:mga05p37_314910_c1
382 nmdc:mga05p37_498329_c1
383 nmdc:mga05p37_599679_c1
384 nmdc:mga09592_108000_c1
385 nmdc:mga0qj67_134428_c1
386 nmdc:mga06r32_388743_c1
387 nmdc:mga06r32_662_c1
388 nmdc:mga08y16_221051_c1
389 nmdc:mga08y16_89065_c1
390 nmdc:mga0n895_139034_c1
391 nmdc:mga0n895_214574_c1
392 nmdc:mga0n895_453828_c1
393 nmdc:mga0n895_89108_c1
394 nmdc:mga0rr50_148_c1
395 nmdc:mga0rr50_19279_c1
396 nmdc:mga0rr50_20222_c1
397 nmdc:mga08x19_1825_c1
398 nmdc:mga0a205_375961_c1
399 Ga0495655_0000109
400 Ga0501082_0668196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16925

TetR_C_13

Tetracyclin repressor-like, C-terminal domain

78

186

0.99

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

10

56

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hyj-assembly1.cif.gz_A-2 the crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor 0.9413 1 190
2hyj-assembly1.cif.gz_A-2 the crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor 0.9226 1 190
3qbm-assembly1.cif.gz_B crystal structure of a tetr transcriptional regulator (caur_2221) from chloroflexus aurantiacus j-10-fl at 1.80 a resolution 0.9033 2 195
3qbm-assembly1.cif.gz_B crystal structure of a tetr transcriptional regulator (caur_2221) from chloroflexus aurantiacus j-10-fl at 1.80 a resolution 0.8946 2 195
3g7r-assembly1.cif.gz_B crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor 0.8868 10 193
ID Description Score Start End Superfamily
2hyjA02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9554 47 190 1.10.357.10
2hyjA02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9305 47 190 1.10.357.10
3fiwD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9142 6 57 1.10.10.60
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9125 6 58 1.10.10.60
3fiwA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9112 6 57 1.10.10.60
ID Description Score Start End GO Terms
AF-H0BL55-F1-model_v4 TetR family transcriptional regulator 0.9838 16 195 GO:0006355
AF-A0A655JT49-F1-model_v4 TetR family transcriptional regulatory protein 0.9802 64 195 GO:0003677
GO:0006355
AF-A0A2V7VYJ2-F1-model_v4 TetR family transcriptional regulator 0.9796 1 195 GO:0003677
GO:0006355
AF-A0A4R7GRR3-F1-model_v4 deleted 0.9791 11 195
AF-A0A2V9T601-F1-model_v4 HTH tetR-type domain-containing protein 0.9769 11 195 GO:0003677
GO:0006355

Map