F307241

General Info

Members Datasets Scaffolds Average Seq Length
200 141 400 333

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10334182|Ga0207684_103341821
Length 358
Sequence LVPGGNTGSDEKHRGFVPELFHWWPAMILLAPHITAFLQQRLPIERRASPNTCDSYAHAFRLLLEYASYCVRLPPSKLQLEQLDAPLIVNFLNHLETSRGNAAGSRNIRLAAIKSFMHYMEYRVPAALEQIQRILAIPAKKTDTRLVRHLTAQEMQSILDAPDPTVRDGIRDRAMLHLCFAGGLRVSELVGLRIEDMMLQPQASVLIHGKGRKERCLPLWKETASAVRAWLSVRGEVRVPELFPNARNDAMTRAGFEYILRKHVHTAETRCSTLASKHVTCALTILQATKDLRKVSLWLGHSSMQTTEIYTRADPSVKLEALESVIAPKLRTGRFKATDKLIEMLKAAPNMRSKNTAK

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
4 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
32 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
33 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
34 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
35 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
49 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
50 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
53 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
54 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
55 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
56 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
57 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
58 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
59 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
60 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
61 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
62 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
63 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
64 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
65 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
66 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
67 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
68 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
71 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
72 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
73 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
77 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
78 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
79 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
80 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
85 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
90 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
95 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
96 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
97 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
114 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0.5
Rhizoplane 12.5
Rhizosphere 74
Stem 0
Stem Tuber 0
Unclassified 17.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10334182 3300025910 Unclassified 1305
2 Ga0070709_10030262 3300005434 Bacteria 3247
3 Ga0070710_10131706 3300005437 Bacteria 1525
4 Ga0070694_100030735 3300005444 Bacteria 3516
5 Ga0070694_100294051 3300005444 Unclassified 1242
6 Ga0070708_100034934 3300005445 Bacteria 4377
7 Ga0070708_100044057 3300005445 Unclassified 3922
8 Ga0070706_100009236 3300005467 Bacteria 9185
9 Ga0070706_100039498 3300005467 Bacteria 4357
10 Ga0070706_100043816 3300005467 Bacteria 4133
11 Ga0070707_100062745 3300005468 Bacteria 3565
12 Ga0070707_100077621 3300005468 Bacteria 3205
13 Ga0070707_100105788 3300005468 Bacteria 2728
14 Ga0070698_100032398 3300005471 Bacteria 5414
15 Ga0070698_100035764 3300005471 Bacteria 5133
16 Ga0070698_100097468 3300005471 Bacteria 2916
17 Ga0070698_100441014 3300005471 Bacteria 1237
18 Ga0070699_100036114 3300005518 Unclassified 4274
19 Ga0070699_100062373 3300005518 Bacteria 3231
20 Ga0070699_100063017 3300005518 Bacteria 3214
21 Ga0070699_100143767 3300005518 Bacteria 2107
22 Ga0070697_100046291 3300005536 Bacteria 3525
23 Ga0068861_100044598 3300005719 Bacteria 3335
24 Ga0068863_100011583 3300005841 Bacteria 8532
25 Ga0081455_10099540 3300005937 Bacteria 2338
26 Ga0081539_10011054 3300005985 Bacteria 7215
27 Ga0070717_10032398 3300006028 Bacteria 4211
28 Ga0070717_10043853 3300006028 Bacteria 3652
29 Ga0075428_100071760 3300006844 Bacteria 3784
30 Ga0075428_100144074 3300006844 Bacteria 2590
31 Ga0075430_100043728 3300006846 Bacteria 3787
32 Ga0075430_100066288 3300006846 Bacteria 3032
33 Ga0075430_100142890 3300006846 Bacteria 1993
34 Ga0075431_100044891 3300006847 Unclassified 4557
35 Ga0075431_100063767 3300006847 Unclassified 3803
36 Ga0075431_100064770 3300006847 Bacteria 3774
37 Ga0075433_10360303 3300006852 Bacteria 1285
38 Ga0075434_100065735 3300006871 Unclassified 3612
39 Ga0075434_100068896 3300006871 Bacteria 3526
40 Ga0075429_100227317 3300006880 Bacteria 1634
41 Ga0075429_100445275 3300006880 Bacteria 1135
42 Ga0075436_100028675 3300006914 Bacteria 3829
43 Ga0111539_10093227 3300009094 Bacteria 3538
44 Ga0114129_10159663 3300009147 Bacteria 3081
45 Ga0114129_10200613 3300009147 Unclassified 2702
46 Ga0105237_10039979 3300009545 Bacteria 4732
47 Ga0099796_10002634 3300010159 Bacteria 3993
48 Ga0157370_10248348 3300013104 Bacteria 1646
49 Ga0157374_10035800 3300013296 Bacteria 4543
50 Ga0157378_10059100 3300013297 Unclassified 3420
51 Ga0163163_10505215 3300014325 Unclassified 1271
52 Ga0163161_10339113 3300017792 Bacteria 1192
53 Ga0213874_10022033 3300021377 Bacteria 1763
54 Ga0213874_10024861 3300021377 Bacteria 1684
55 Ga0213871_10000680 3300021441 Bacteria 4922
56 Ga0224572_1000174 3300024225 Bacteria 5887
57 Ga0209676_1015184 3300025292 Bacteria 2847
58 Ga0209025_1000672 3300025294 Bacteria 58988
59 Ga0209257_1010777 3300025304 Bacteria 4544
60 Ga0207684_10017653 3300025910 Bacteria 6121
61 Ga0207684_10028941 3300025910 Bacteria 4718
62 Ga0207684_10051167 3300025910 Bacteria 3504
63 Ga0207671_10033154 3300025914 Bacteria 3843
64 Ga0207646_10040510 3300025922 Bacteria 4188
65 Ga0207646_10059594 3300025922 Bacteria 3409
66 Ga0207646_10093013 3300025922 Bacteria 2699
67 Ga0207646_10119250 3300025922 Bacteria 2370
68 Ga0207702_10049860 3300026078 Unclassified 3533
69 Ga0207641_10000814 3300026088 Bacteria 33251
70 Ga0207675_100136367 3300026118 Unclassified 2329
71 Ga0209179_1021111 3300027512 Unclassified 1269
72 Ga0207428_10133903 3300027907 Bacteria 1895
73 Ga0207428_10220875 3300027907 Bacteria 1420
74 Ga0265338_10190916 3300028800 Bacteria 1553
75 Ga0316579_10010300 3300031691 Bacteria 3948
76 Ga0307416_100300480 3300032002 Bacteria 1595
77 Ga0373927_0068926 3300035695 Unclassified 2289
78 Ga0373947_0026270 3300035725 Plasmid 3402
79 Ga0316584_0067837 3300036712 Bacteria 2673
80 Ga0436364_0580590 3300037853 Bacteria 4572
81 Ga0436364_0633823 3300037853 Bacteria 1224
82 Ga0400490_01041 3300038726 Unclassified 3642
83 Ga0400490_29793 3300038726 Bacteria 15058
84 Ga0400488_61437 3300038741 Bacteria 8172
85 Ga0436365_1456784 3300039437 Bacteria 6431
86 Ga0436360_0506756 3300039438 Bacteria 4003
87 Ga0436361_0485309 3300039447 Bacteria 2250
88 Ga0436363_0093314 3300039450 Bacteria 1864
89 Ga0436363_1430698 3300039450 Bacteria 4867
90 Ga0436363_1643378 3300039450 Bacteria 3720
91 Ga0439433_0004274 3300041999 Bacteria 3072
92 Ga0450923_010934 3300042125 Bacteria 1622
93 Ga0450916_015582 3300042530 Bacteria 1000
94 Ga0495629_0126331 3300046459 Bacteria 1781
95 Ga0495641_0006347 3300046461 Bacteria 7676
96 Ga0495651_0222245 3300046462 Unclassified 1306
97 Ga0495653_0001193 3300046463 Bacteria 20132
98 Ga0495650_0020175 3300046471 Bacteria 3256
99 Ga0495580_0037014 3300046472 Plasmid 3503
100 Ga0495580_0044937 3300046472 Bacteria 3139
101 Ga0495580_0046782 3300046472 Bacteria 3069
102 Ga0495580_0058090 3300046472 Bacteria 2722
103 Ga0495580_0148946 3300046472 Bacteria 1621
104 Ga0495582_0025731 3300046473 Bacteria 3223
105 Ga0495639_0155929 3300046475 Unclassified 1103
106 Ga0495662_0005147 3300046476 Bacteria 6555
107 Ga0495584_0025466 3300046491 Bacteria 3000
108 Ga0495585_0006104 3300046492 Bacteria 7526
109 Ga0495596_0001814 3300046500 Bacteria 11868
110 Ga0495606_0051472 3300046507 Bacteria 2686
111 Ga0495628_0039858 3300046516 Bacteria 3756
112 Ga0495628_0049340 3300046516 Bacteria 3334
113 Ga0495628_0062104 3300046516 Bacteria 2929
114 Ga0495630_0520526 3300046517 Bacteria 912
115 Ga0495648_0036973 3300046524 Bacteria 3142
116 Ga0495666_0135723 3300046526 Bacteria 1148
117 Ga0495642_0017046 3300046528 Bacteria 2836
118 Ga0495652_0042512 3300046529 Bacteria 3918
119 Ga0495665_0020057 3300046531 Bacteria 3592
120 Ga0495665_0109737 3300046531 Bacteria 1447
121 Ga0495640_0042681 3300046533 Bacteria 3162
122 Ga0495586_0158696 3300046535 Bacteria 1275
123 Ga0495645_0039846 3300046543 Bacteria 3426
124 Ga0495635_0214306 3300046663 Bacteria 1304
125 Ga0495646_0027865 3300046680 Bacteria 3541
126 Ga0495646_0140989 3300046680 Bacteria 1348
127 Ga0495658_0046846 3300046683 Bacteria 2432
128 Ga0495613_0040154 3300046689 Bacteria 3468
129 Ga0495624_0018177 3300046690 Bacteria 4704
130 Ga0495624_0033044 3300046690 Bacteria 3351
131 Ga0495649_0055033 3300046694 Bacteria 2151
132 Ga0495589_0019792 3300046794 Bacteria 3444
133 Ga0495674_0065825 3300047319 Bacteria 3146
134 Ga0495676_0031478 3300047321 Bacteria 4486
135 Ga0495676_0055161 3300047321 Bacteria 3153
136 Ga0495680_0026152 3300047322 Bacteria 4816
137 Ga0495687_020222 3300047443 Bacteria 3248
138 Ga0495679_037901 3300047446 Bacteria 1513
139 Ga0495673_0018294 3300047469 Bacteria 3537
140 Ga0495593_0018649 3300047673 Bacteria 3897
141 Ga0496100_0030255 3300048903 Bacteria 3357
142 Ga0496100_0032541 3300048903 Bacteria 3254
143 Ga0496101_0025307 3300048904 Bacteria 4117
144 Ga0496102_0009986 3300048905 Bacteria 8160
145 Ga0496102_0033856 3300048905 Bacteria 4593
146 Ga0496103_0014798 3300048906 Bacteria 4638
147 Ga0496103_0076349 3300048906 Bacteria 2102
148 Ga0496104_0043410 3300048907 Bacteria 4223
149 Ga0496104_0182013 3300048907 Unclassified 2012
150 Ga0496105_0032519 3300048908 Bacteria 4281
151 Ga0496105_0047647 3300048908 Bacteria 3537
152 Ga0496106_0025614 3300048909 Bacteria 4391
153 Ga0496107_0024988 3300048910 Bacteria 4228
154 Ga0496108_0026107 3300048911 Bacteria 4818
155 Ga0496108_0118929 3300048911 Bacteria 2265
156 Ga0496109_0059091 3300048912 Unclassified 3503
157 Ga0496110_0089122 3300048913 Unclassified 2757
158 Ga0496110_0161143 3300048913 Unclassified 2033
159 Ga0496110_0309523 3300048913 Bacteria 1439
160 Ga0496110_0323305 3300048913 Bacteria 1405
161 Ga0496111_0248216 3300048914 Unclassified 1321
162 Ga0496114_0042648 3300048917 Bacteria 3761
163 Ga0496114_0048419 3300048917 Unclassified 3536
164 Ga0496114_0051702 3300048917 Bacteria 3421
165 Ga0496115_0026372 3300048918 Bacteria 4535
166 Ga0496116_0034041 3300048919 Bacteria 3603
167 Ga0496117_0006078 3300048920 Bacteria 12381
168 Ga0496118_0045979 3300048921 Unclassified 3400
169 Ga0496121_0033081 3300048924 Unclassified 4687
170 Ga0496125_0019643 3300048928 Bacteria 6364
171 Ga0496126_0031251 3300048929 Bacteria 5033
172 Ga0496126_0060659 3300048929 Unclassified 3400
173 Ga0501036_0073486 3300049572 Bacteria 2891
174 Ga0501039_0097739 3300049575 Unclassified 2290
175 Ga0501040_0282285 3300049576 Unclassified 1186
176 Ga0501041_0108630 3300049577 Bacteria 1721
177 Ga0501076_0394793 3300049592 Bacteria 1137
178 Ga0501221_005076 3300049704 Bacteria 2194
179 Ga0501081_0119846 3300049743 Unclassified 1873
180 Ga0501045_0192390 3300049824 Bacteria 1520
181 nmdc:mga09592_137060_c1 3300050508 Unclassified 2108
182 nmdc:mga0qj67_20939_c1 3300050509 Bacteria 5011
183 nmdc:mga0qj67_212524_c1 3300050509 Bacteria 1571
184 nmdc:mga06r32_434841_c1 3300050510 Bacteria 1293
185 nmdc:mga06r32_45378_c1 3300050510 Unclassified 4189
186 nmdc:mga06r32_62078_c1 3300050510 Bacteria 3599
187 nmdc:mga08y16_539251_c1 3300050511 Unclassified 1182
188 nmdc:mga08y16_75776_c1 3300050511 Bacteria 3506
189 nmdc:mga0n895_34590_c1 3300050512 Unclassified 4865
190 nmdc:mga08x19_24648_c1 3300050514 Bacteria 3742
191 nmdc:mga0a205_73338_c1 3300050515 Bacteria 1999
192 Ga0495601_0011002 3300053077 Bacteria 5405
193 Ga0495619_0030650 3300053085 Bacteria 3482
194 Ga0500556_0128149 3300053104 Unclassified 993
195 Ga0500562_057200 3300053108 Bacteria 1046
196 Ga0500658_0156497 3300053134 Unclassified 1030
197 Ga0500622_0007894 3300053156 Bacteria 5990
198 Ga0500645_064573 3300053730 Bacteria 1056
199 Ga0501082_0059243 3300060353 Bacteria 3300
200 2513558811 2513237082 Bacteria 8640282
201 Ga0207684_10334182
202 Ga0070709_10030262
203 Ga0070710_10131706
204 Ga0070694_100030735
205 Ga0070694_100294051
206 Ga0070708_100034934
207 Ga0070708_100044057
208 Ga0070706_100009236
209 Ga0070706_100039498
210 Ga0070706_100043816
211 Ga0070707_100062745
212 Ga0070707_100077621
213 Ga0070707_100105788
214 Ga0070698_100032398
215 Ga0070698_100035764
216 Ga0070698_100097468
217 Ga0070698_100441014
218 Ga0070699_100036114
219 Ga0070699_100062373
220 Ga0070699_100063017
221 Ga0070699_100143767
222 Ga0070697_100046291
223 Ga0068861_100044598
224 Ga0068863_100011583
225 Ga0081455_10099540
226 Ga0081539_10011054
227 Ga0070717_10032398
228 Ga0070717_10043853
229 Ga0075428_100071760
230 Ga0075428_100144074
231 Ga0075430_100043728
232 Ga0075430_100066288
233 Ga0075430_100142890
234 Ga0075431_100044891
235 Ga0075431_100063767
236 Ga0075431_100064770
237 Ga0075433_10360303
238 Ga0075434_100065735
239 Ga0075434_100068896
240 Ga0075429_100227317
241 Ga0075429_100445275
242 Ga0075436_100028675
243 Ga0111539_10093227
244 Ga0114129_10159663
245 Ga0114129_10200613
246 Ga0105237_10039979
247 Ga0099796_10002634
248 Ga0157370_10248348
249 Ga0157374_10035800
250 Ga0157378_10059100
251 Ga0163163_10505215
252 Ga0163161_10339113
253 Ga0213874_10022033
254 Ga0213874_10024861
255 Ga0213871_10000680
256 Ga0224572_1000174
257 Ga0209676_1015184
258 Ga0209025_1000672
259 Ga0209257_1010777
260 Ga0207684_10017653
261 Ga0207684_10028941
262 Ga0207684_10051167
263 Ga0207671_10033154
264 Ga0207646_10040510
265 Ga0207646_10059594
266 Ga0207646_10093013
267 Ga0207646_10119250
268 Ga0207702_10049860
269 Ga0207641_10000814
270 Ga0207675_100136367
271 Ga0209179_1021111
272 Ga0207428_10133903
273 Ga0207428_10220875
274 Ga0265338_10190916
275 Ga0316579_10010300
276 Ga0307416_100300480
277 Ga0373927_0068926
278 Ga0373947_0026270
279 Ga0316584_0067837
280 Ga0436364_0580590
281 Ga0436364_0633823
282 Ga0400490_01041
283 Ga0400490_29793
284 Ga0400488_61437
285 Ga0436365_1456784
286 Ga0436360_0506756
287 Ga0436361_0485309
288 Ga0436363_0093314
289 Ga0436363_1430698
290 Ga0436363_1643378
291 Ga0439433_0004274
292 Ga0450923_010934
293 Ga0450916_015582
294 Ga0495629_0126331
295 Ga0495641_0006347
296 Ga0495651_0222245
297 Ga0495653_0001193
298 Ga0495650_0020175
299 Ga0495580_0037014
300 Ga0495580_0044937
301 Ga0495580_0046782
302 Ga0495580_0058090
303 Ga0495580_0148946
304 Ga0495582_0025731
305 Ga0495639_0155929
306 Ga0495662_0005147
307 Ga0495584_0025466
308 Ga0495585_0006104
309 Ga0495596_0001814
310 Ga0495606_0051472
311 Ga0495628_0039858
312 Ga0495628_0049340
313 Ga0495628_0062104
314 Ga0495630_0520526
315 Ga0495648_0036973
316 Ga0495666_0135723
317 Ga0495642_0017046
318 Ga0495652_0042512
319 Ga0495665_0020057
320 Ga0495665_0109737
321 Ga0495640_0042681
322 Ga0495586_0158696
323 Ga0495645_0039846
324 Ga0495635_0214306
325 Ga0495646_0027865
326 Ga0495646_0140989
327 Ga0495658_0046846
328 Ga0495613_0040154
329 Ga0495624_0018177
330 Ga0495624_0033044
331 Ga0495649_0055033
332 Ga0495589_0019792
333 Ga0495674_0065825
334 Ga0495676_0031478
335 Ga0495676_0055161
336 Ga0495680_0026152
337 Ga0495687_020222
338 Ga0495679_037901
339 Ga0495673_0018294
340 Ga0495593_0018649
341 Ga0496100_0030255
342 Ga0496100_0032541
343 Ga0496101_0025307
344 Ga0496102_0009986
345 Ga0496102_0033856
346 Ga0496103_0014798
347 Ga0496103_0076349
348 Ga0496104_0043410
349 Ga0496104_0182013
350 Ga0496105_0032519
351 Ga0496105_0047647
352 Ga0496106_0025614
353 Ga0496107_0024988
354 Ga0496108_0026107
355 Ga0496108_0118929
356 Ga0496109_0059091
357 Ga0496110_0089122
358 Ga0496110_0161143
359 Ga0496110_0309523
360 Ga0496110_0323305
361 Ga0496111_0248216
362 Ga0496114_0042648
363 Ga0496114_0048419
364 Ga0496114_0051702
365 Ga0496115_0026372
366 Ga0496116_0034041
367 Ga0496117_0006078
368 Ga0496118_0045979
369 Ga0496121_0033081
370 Ga0496125_0019643
371 Ga0496126_0031251
372 Ga0496126_0060659
373 Ga0501036_0073486
374 Ga0501039_0097739
375 Ga0501040_0282285
376 Ga0501041_0108630
377 Ga0501076_0394793
378 Ga0501221_005076
379 Ga0501081_0119846
380 Ga0501045_0192390
381 nmdc:mga09592_137060_c1
382 nmdc:mga0qj67_20939_c1
383 nmdc:mga0qj67_212524_c1
384 nmdc:mga06r32_434841_c1
385 nmdc:mga06r32_45378_c1
386 nmdc:mga06r32_62078_c1
387 nmdc:mga08y16_539251_c1
388 nmdc:mga08y16_75776_c1
389 nmdc:mga0n895_34590_c1
390 nmdc:mga08x19_24648_c1
391 nmdc:mga0a205_73338_c1
392 Ga0495601_0011002
393 Ga0495619_0030650
394 Ga0500556_0128149
395 Ga0500562_057200
396 Ga0500658_0156497
397 Ga0500622_0007894
398 Ga0500645_064573
399 Ga0501082_0059243
400 2513558811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00589

Phage_integrase

Phage integrase family

148

316

0.92

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

34

123

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1aih-assembly2.cif.gz_C catalytic domain of bacteriophage hp1 integrase 0.7675 122 303
6emy-assembly1.cif.gz_A structure of the tn1549 transposon integrase (aa 82-397, y379f) in complex with transposon right end dna 0.7326 4 302
6en1-assembly1.cif.gz_B structure of the tn1549 transposon integrase (aa 82-397, r225k) in complex with a circular intermediate dna (ci6a-dna) 0.7309 1 302
5jjv-assembly1.cif.gz_A-2 crystal structure of xerh site-specific recombinase bound to palindromic difh substrate: post-cleavage complex 0.7297 53 305
5dor-assembly2.cif.gz_C p2 integrase catalytic domain in space group p21 0.7294 123 302
ID Description Score Start End Superfamily
af_P0A8P6_113_288_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8623 125 304 1.10.443.10
af_P0A8P6_113_288_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8484 125 304 1.10.443.10
af_Q57813_134_326_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8424 118 304 1.10.443.10
af_Q2FZ30_110_286_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8322 124 303 1.10.443.10
af_Q2FY74_109_289_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8305 123 304 1.10.443.10
ID Description Score Start End GO Terms
AF-A0A5S4VSY3-F1-model_v4 Integrase 0.996 4 115 GO:0003677
GO:0015074
AF-A0A843S6I4-F1-model_v4 Integrase 0.988 1 115 GO:0003677
GO:0015074
AF-F8XQ50-F1-model_v4 deleted 0.9874 5 97
AF-A0A518U8Q6-F1-model_v4 Core-binding (CB) domain-containing protein 0.9852 5 109 GO:0003677
GO:0015074
AF-A3JFA6-F1-model_v4 Phage-related integrase 0.9841 4 112 GO:0003677
GO:0015074

Map