F307126

General Info

Members Datasets Scaffolds Average Seq Length
200 164 400 128

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10334625|Ga0099796_103346252
Length 153
Sequence MDERPERELADEPPATGAAGQRLAAVGPMLRVKNWARALRRDAHAIYLASRDPRVPWTVKLLAIAVAGYALSPIDLIPDFIPVLGYLDDLIIVPLGIWLVIELIPEDVMREYRAMASAAAQRPVSKAAAIIIVALWISGTLLLGWIAFVHWRA

Samples

Sample ID Description Type Environment
1 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
80 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
83 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
157 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
158 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
159 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
160 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
163 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
164 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.5
Nodule 0
Rhizoplane 3.5
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 9.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099796_10334625 3300010159 Bacteria 649
2 Ga0055526_1021848 3300003771 Bacteria 2206
3 Ga0070658_10953278 3300005327 Bacteria 746
4 Ga0070680_100023366 3300005336 Bacteria 4931
5 Ga0070682_100001240 3300005337 Bacteria 14513
6 Ga0070660_100372508 3300005339 Bacteria 1178
7 Ga0070691_10057565 3300005341 Bacteria 1865
8 Ga0070659_100018983 3300005366 Bacteria 5199
9 Ga0070710_10550065 3300005437 Bacteria 797
10 Ga0070710_10775140 3300005437 Bacteria 683
11 Ga0070711_100386320 3300005439 Bacteria 1133
12 Ga0070662_100728377 3300005457 Bacteria 840
13 Ga0070681_10017805 3300005458 Bacteria 7099
14 Ga0070698_100561285 3300005471 Unclassified 1081
15 Ga0070679_100001405 3300005530 Bacteria 21255
16 Ga0070679_100844084 3300005530 Unclassified 859
17 Ga0068853_100004927 3300005539 Bacteria 10394
18 Ga0070695_100380222 3300005545 Bacteria 1065
19 Ga0070696_100444562 3300005546 Bacteria 1022
20 Ga0070693_100015507 3300005547 Bacteria 3925
21 Ga0068855_100032318 3300005563 Bacteria 6250
22 Ga0068857_100187956 3300005577 Bacteria 1881
23 Ga0068854_100078670 3300005578 Bacteria 2430
24 Ga0068856_100000050 3300005614 Bacteria 108220
25 Ga0068852_100777045 3300005616 Bacteria 971
26 Ga0081455_10000307 3300005937 Bacteria 64591
27 Ga0075365_10015677 3300006038 Bacteria 4590
28 Ga0075368_10502937 3300006042 Bacteria 541
29 Ga0075367_10248410 3300006178 Bacteria 1115
30 Ga0075367_10269165 3300006178 Bacteria 1070
31 Ga0075369_10012952 3300006186 Bacteria 3300
32 Ga0075366_10399337 3300006195 Bacteria 846
33 Ga0075366_10561258 3300006195 Bacteria 707
34 Ga0075428_100038616 3300006844 Bacteria 5255
35 Ga0075436_101285383 3300006914 Unclassified 553
36 Ga0075435_100658920 3300007076 Bacteria 909
37 Ga0099794_10009699 3300007265 Bacteria 4062
38 Ga0099795_10054235 3300007788 Bacteria 1469
39 Ga0099795_10108882 3300007788 Bacteria 1096
40 Ga0099795_10265028 3300007788 Bacteria 745
41 Ga0105240_12459741 3300009093 Bacteria 539
42 Ga0105245_10001953 3300009098 Bacteria 18698
43 Ga0114129_10563739 3300009147 Bacteria 1480
44 Ga0105241_10039666 3300009174 Bacteria 3552
45 Ga0105241_10558144 3300009174 Bacteria 1029
46 Ga0105248_10086723 3300009177 Unclassified 3522
47 Ga0105237_10292653 3300009545 Bacteria 1631
48 Ga0105237_10627961 3300009545 Bacteria 1081
49 Ga0099796_10008531 3300010159 Bacteria 2736
50 Ga0157321_1007599 3300012487 Bacteria 767
51 Ga0157373_10005751 3300013100 Bacteria 9281
52 Ga0163162_10447185 3300013306 Bacteria 1424
53 Ga0157372_10001645 3300013307 Bacteria 24280
54 Ga0209130_1060407 3300025284 Bacteria 659
55 Ga0209564_1001380 3300025295 Bacteria 25330
56 Ga0207692_10480464 3300025898 Bacteria 786
57 Ga0207654_10019445 3300025911 Bacteria 3585
58 Ga0207707_10010285 3300025912 Bacteria 8119
59 Ga0207671_10407998 3300025914 Bacteria 1081
60 Ga0207660_10278343 3300025917 Bacteria 1327
61 Ga0207657_10331573 3300025919 Bacteria 1202
62 Ga0207652_10041894 3300025921 Bacteria 3895
63 Ga0207652_10255744 3300025921 Bacteria 1580
64 Ga0207652_11174497 3300025921 Archaea 669
65 Ga0207690_10067597 3300025932 Bacteria 2452
66 Ga0207665_10125376 3300025939 Bacteria 1818
67 Ga0207665_10542600 3300025939 Bacteria 903
68 Ga0207667_10189117 3300025949 Bacteria 2113
69 Ga0207667_10312536 3300025949 Bacteria 1605
70 Ga0207712_10032592 3300025961 Bacteria 3517
71 Ga0207668_10108679 3300025972 Bacteria 2076
72 Ga0207640_10034385 3300025981 Bacteria 3163
73 Ga0207639_10007710 3300026041 Bacteria 7349
74 Ga0207702_10000192 3300026078 Bacteria 72539
75 Ga0207674_10152119 3300026116 Bacteria 2271
76 Ga0209179_1058307 3300027512 Bacteria 836
77 Ga0209983_1022241 3300027665 Bacteria 1328
78 Ga0209588_1063855 3300027671 Bacteria 1190
79 Ga0209813_10421543 3300027866 Bacteria 541
80 Ga0265331_10102086 3300031250 Bacteria 1319
81 Ga0307513_10015966 3300031456 Bacteria 9083
82 Ga0307513_10037649 3300031456 Bacteria 5381
83 Ga0307509_10261013 3300031507 Bacteria 1508
84 Ga0265313_10133070 3300031595 Bacteria 1076
85 Ga0307508_10079845 3300031616 Bacteria 2853
86 Ga0307415_100193339 3300032126 Bacteria 1608
87 Ga0307510_10058074 3300033180 Bacteria 4010
88 Ga0373944_0090386 3300035089 Bacteria 1023
89 Ga0373923_0039809 3300035111 Bacteria 1932
90 Ga0373936_0018598 3300035113 Bacteria 2685
91 Ga0373936_0338306 3300035113 Bacteria 684
92 Ga0373945_0037022 3300035116 Bacteria 1750
93 Ga0373954_0084842 3300035118 Bacteria 1516
94 Ga0373956_0169214 3300035119 Unclassified 1031
95 Ga0373957_0245080 3300035120 Unclassified 753
96 Ga0373943_0608679 3300035170 Bacteria 644
97 Ga0373946_0143237 3300035171 Bacteria 1110
98 Ga0373924_0248313 3300035410 Unclassified 788
99 Ga0373935_0004764 3300035692 Bacteria 7979
100 Ga0373935_0222247 3300035692 Bacteria 1312
101 Ga0373927_0001167 3300035695 Bacteria 19879
102 Ga0373933_0057655 3300035724 Bacteria 2335
103 Ga0373947_0028582 3300035725 Bacteria 3270
104 Ga0373937_0022039 3300036401 Bacteria 5722
105 Ga0373925_0014593 3300037068 Bacteria 5676
106 Ga0373925_0030180 3300037068 Bacteria 3978
107 Ga0395899_0464934 3300037312 Bacteria 826
108 Ga0395900_0018259 3300037418 Bacteria 7154
109 Ga0395900_0368215 3300037418 Unclassified 1407
110 Ga0395898_0017476 3300037466 Bacteria 7322
111 Ga0395898_0265130 3300037466 Unclassified 1638
112 Ga0395905_1340137 3300037471 Bacteria 620
113 Ga0395901_0009211 3300038443 Bacteria 10002
114 Ga0495603_0004271 3300046455 Bacteria 8514
115 Ga0495603_0446834 3300046455 Bacteria 740
116 Ga0495629_0078396 3300046459 Bacteria 2306
117 Ga0495641_0027383 3300046461 Bacteria 2772
118 Ga0495653_0014704 3300046463 Bacteria 6385
119 Ga0495580_0025091 3300046472 Bacteria 4357
120 Ga0495582_0005012 3300046473 Bacteria 7420
121 Ga0495582_0009589 3300046473 Bacteria 5331
122 Ga0495639_0007957 3300046475 Bacteria 4554
123 Ga0495662_0028614 3300046476 Bacteria 2690
124 Ga0495664_0093349 3300046477 Bacteria 1810
125 Ga0495664_0155917 3300046477 Bacteria 1385
126 Ga0495594_0008146 3300046499 Bacteria 5392
127 Ga0495594_0034443 3300046499 Bacteria 2754
128 Ga0495606_0000939 3300046507 Bacteria 42966
129 Ga0495628_0042808 3300046516 Bacteria 3610
130 Ga0495630_0013089 3300046517 Bacteria 6031
131 Ga0495630_0014219 3300046517 Bacteria 5795
132 Ga0495630_0694801 3300046517 Bacteria 778
133 Ga0495666_0080228 3300046526 Bacteria 1544
134 Ga0495666_0159247 3300046526 Unclassified 1047
135 Ga0495652_0009460 3300046529 Bacteria 8855
136 Ga0495665_0006999 3300046531 Bacteria 6085
137 Ga0495640_0005354 3300046533 Bacteria 10207
138 Ga0495640_0018627 3300046533 Bacteria 5141
139 Ga0495622_0058562 3300046557 Unclassified 1784
140 Ga0495667_0009723 3300046559 Bacteria 6516
141 Ga0495667_0031452 3300046559 Bacteria 3563
142 Ga0495634_0007363 3300046642 Bacteria 8283
143 Ga0495634_0152055 3300046642 Bacteria 1463
144 Ga0495635_0001001 3300046663 Bacteria 18667
145 Ga0495588_0118210 3300046674 Bacteria 1397
146 Ga0495599_0182561 3300046678 Unclassified 1293
147 Ga0495646_0390736 3300046680 Unclassified 724
148 Ga0495647_0068823 3300046681 Bacteria 1412
149 Ga0495647_0230240 3300046681 Bacteria 820
150 Ga0495658_0012552 3300046683 Bacteria 4295
151 Ga0495658_0013753 3300046683 Bacteria 4124
152 Ga0495613_0026557 3300046689 Bacteria 4312
153 Ga0495624_0002541 3300046690 Bacteria 13825
154 Ga0495581_0291729 3300047315 Unclassified 953
155 Ga0495604_0412764 3300047317 Unclassified 887
156 Ga0495674_0069055 3300047319 Bacteria 3056
157 Ga0495676_0042201 3300047321 Bacteria 3747
158 Ga0495680_0565243 3300047322 Unclassified 765
159 Ga0495675_0370940 3300047444 Bacteria 839
160 Ga0495684_0007291 3300047471 Bacteria 8569
161 Ga0495684_0026074 3300047471 Bacteria 4493
162 Ga0495684_0649803 3300047471 Bacteria 705
163 Ga0495686_0031210 3300047472 Bacteria 3457
164 Ga0495593_0039436 3300047673 Bacteria 2546
165 Ga0495593_0054150 3300047673 Bacteria 2115
166 Ga0496103_0847622 3300048906 Bacteria 575
167 Ga0496104_0052808 3300048907 Bacteria 3839
168 Ga0496104_0747618 3300048907 Bacteria 885
169 Ga0496108_0239804 3300048911 Bacteria 1577
170 Ga0496110_1096355 3300048913 Bacteria 704
171 Ga0496112_0000960 3300048915 Bacteria 20955
172 Ga0496114_0073453 3300048917 Bacteria 2878
173 Ga0496121_0410731 3300048924 Bacteria 884
174 Ga0496121_0694755 3300048924 Bacteria 613
175 Ga0496126_0028156 3300048929 Bacteria 5358
176 Ga0501033_0010228 3300049570 Bacteria 7200
177 Ga0501038_0180598 3300049574 Bacteria 1703
178 Ga0501073_0403299 3300049589 Bacteria 945
179 Ga0501076_0324614 3300049592 Bacteria 1263
180 Ga0501083_0380316 3300049744 Bacteria 918
181 nmdc:mga0yw44_1863_c1 3300050492 Bacteria 8666
182 nmdc:mga06z11_70963_c1 3300050494 Bacteria 1843
183 nmdc:mga04h51_456612_c1 3300050495 Bacteria 541
184 nmdc:mga05p37_436304_c1 3300050507 Bacteria 1520
185 nmdc:mga0rr50_1305657_c1 3300050513 Bacteria 615
186 nmdc:mga08x19_945980_c1 3300050514 Unclassified 612
187 nmdc:mga0sz30_5350_c1 3300050516 Bacteria 4702
188 Ga0495601_0026503 3300053077 Bacteria 3579
189 Ga0500635_0041083 3300053080 Bacteria 1545
190 Ga0495595_0431422 3300053084 Bacteria 669
191 Ga0495619_0042147 3300053085 Bacteria 2988
192 Ga0500583_0069566 3300053092 Unclassified 1681
193 Ga0500566_0226679 3300053094 Bacteria 925
194 Ga0500641_0058590 3300053096 Unclassified 1600
195 Ga0500554_021120 3300053102 Bacteria 1800
196 Ga0500603_000600 3300053150 Bacteria 8956
197 Ga0500616_0003865 3300053153 Bacteria 11047
198 Ga0500638_372857 3300053162 Bacteria 521
199 Ga0500636_0360600 3300053177 Bacteria 690
200 Ga0500637_0019469 3300053178 Bacteria 3661
201 Ga0099796_10334625
202 Ga0055526_1021848
203 Ga0070658_10953278
204 Ga0070680_100023366
205 Ga0070682_100001240
206 Ga0070660_100372508
207 Ga0070691_10057565
208 Ga0070659_100018983
209 Ga0070710_10550065
210 Ga0070710_10775140
211 Ga0070711_100386320
212 Ga0070662_100728377
213 Ga0070681_10017805
214 Ga0070698_100561285
215 Ga0070679_100001405
216 Ga0070679_100844084
217 Ga0068853_100004927
218 Ga0070695_100380222
219 Ga0070696_100444562
220 Ga0070693_100015507
221 Ga0068855_100032318
222 Ga0068857_100187956
223 Ga0068854_100078670
224 Ga0068856_100000050
225 Ga0068852_100777045
226 Ga0081455_10000307
227 Ga0075365_10015677
228 Ga0075368_10502937
229 Ga0075367_10248410
230 Ga0075367_10269165
231 Ga0075369_10012952
232 Ga0075366_10399337
233 Ga0075366_10561258
234 Ga0075428_100038616
235 Ga0075436_101285383
236 Ga0075435_100658920
237 Ga0099794_10009699
238 Ga0099795_10054235
239 Ga0099795_10108882
240 Ga0099795_10265028
241 Ga0105240_12459741
242 Ga0105245_10001953
243 Ga0114129_10563739
244 Ga0105241_10039666
245 Ga0105241_10558144
246 Ga0105248_10086723
247 Ga0105237_10292653
248 Ga0105237_10627961
249 Ga0099796_10008531
250 Ga0157321_1007599
251 Ga0157373_10005751
252 Ga0163162_10447185
253 Ga0157372_10001645
254 Ga0209130_1060407
255 Ga0209564_1001380
256 Ga0207692_10480464
257 Ga0207654_10019445
258 Ga0207707_10010285
259 Ga0207671_10407998
260 Ga0207660_10278343
261 Ga0207657_10331573
262 Ga0207652_10041894
263 Ga0207652_10255744
264 Ga0207652_11174497
265 Ga0207690_10067597
266 Ga0207665_10125376
267 Ga0207665_10542600
268 Ga0207667_10189117
269 Ga0207667_10312536
270 Ga0207712_10032592
271 Ga0207668_10108679
272 Ga0207640_10034385
273 Ga0207639_10007710
274 Ga0207702_10000192
275 Ga0207674_10152119
276 Ga0209179_1058307
277 Ga0209983_1022241
278 Ga0209588_1063855
279 Ga0209813_10421543
280 Ga0265331_10102086
281 Ga0307513_10015966
282 Ga0307513_10037649
283 Ga0307509_10261013
284 Ga0265313_10133070
285 Ga0307508_10079845
286 Ga0307415_100193339
287 Ga0307510_10058074
288 Ga0373944_0090386
289 Ga0373923_0039809
290 Ga0373936_0018598
291 Ga0373936_0338306
292 Ga0373945_0037022
293 Ga0373954_0084842
294 Ga0373956_0169214
295 Ga0373957_0245080
296 Ga0373943_0608679
297 Ga0373946_0143237
298 Ga0373924_0248313
299 Ga0373935_0004764
300 Ga0373935_0222247
301 Ga0373927_0001167
302 Ga0373933_0057655
303 Ga0373947_0028582
304 Ga0373937_0022039
305 Ga0373925_0014593
306 Ga0373925_0030180
307 Ga0395899_0464934
308 Ga0395900_0018259
309 Ga0395900_0368215
310 Ga0395898_0017476
311 Ga0395898_0265130
312 Ga0395905_1340137
313 Ga0395901_0009211
314 Ga0495603_0004271
315 Ga0495603_0446834
316 Ga0495629_0078396
317 Ga0495641_0027383
318 Ga0495653_0014704
319 Ga0495580_0025091
320 Ga0495582_0005012
321 Ga0495582_0009589
322 Ga0495639_0007957
323 Ga0495662_0028614
324 Ga0495664_0093349
325 Ga0495664_0155917
326 Ga0495594_0008146
327 Ga0495594_0034443
328 Ga0495606_0000939
329 Ga0495628_0042808
330 Ga0495630_0013089
331 Ga0495630_0014219
332 Ga0495630_0694801
333 Ga0495666_0080228
334 Ga0495666_0159247
335 Ga0495652_0009460
336 Ga0495665_0006999
337 Ga0495640_0005354
338 Ga0495640_0018627
339 Ga0495622_0058562
340 Ga0495667_0009723
341 Ga0495667_0031452
342 Ga0495634_0007363
343 Ga0495634_0152055
344 Ga0495635_0001001
345 Ga0495588_0118210
346 Ga0495599_0182561
347 Ga0495646_0390736
348 Ga0495647_0068823
349 Ga0495647_0230240
350 Ga0495658_0012552
351 Ga0495658_0013753
352 Ga0495613_0026557
353 Ga0495624_0002541
354 Ga0495581_0291729
355 Ga0495604_0412764
356 Ga0495674_0069055
357 Ga0495676_0042201
358 Ga0495680_0565243
359 Ga0495675_0370940
360 Ga0495684_0007291
361 Ga0495684_0026074
362 Ga0495684_0649803
363 Ga0495686_0031210
364 Ga0495593_0039436
365 Ga0495593_0054150
366 Ga0496103_0847622
367 Ga0496104_0052808
368 Ga0496104_0747618
369 Ga0496108_0239804
370 Ga0496110_1096355
371 Ga0496112_0000960
372 Ga0496114_0073453
373 Ga0496121_0410731
374 Ga0496121_0694755
375 Ga0496126_0028156
376 Ga0501033_0010228
377 Ga0501038_0180598
378 Ga0501073_0403299
379 Ga0501076_0324614
380 Ga0501083_0380316
381 nmdc:mga0yw44_1863_c1
382 nmdc:mga06z11_70963_c1
383 nmdc:mga04h51_456612_c1
384 nmdc:mga05p37_436304_c1
385 nmdc:mga0rr50_1305657_c1
386 nmdc:mga08x19_945980_c1
387 nmdc:mga0sz30_5350_c1
388 Ga0495601_0026503
389 Ga0500635_0041083
390 Ga0495595_0431422
391 Ga0495619_0042147
392 Ga0500583_0069566
393 Ga0500566_0226679
394 Ga0500641_0058590
395 Ga0500554_021120
396 Ga0500603_000600
397 Ga0500616_0003865
398 Ga0500638_372857
399 Ga0500636_0360600
400 Ga0500637_0019469

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06803

DUF1232

Protein of unknown function (DUF1232)

59

95

0.97

Map