F307106

General Info

Members Datasets Scaffolds Average Seq Length
200 151 400 287

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10060002|Ga0105237_100600023
Length 312
Sequence MGREPIAQPAVVLPSATNSEYPMTQIDARASGQFAIGGDMTVNRLGFGAMRITGPGIWGEPEDRDACLAVLRRLPEIGVDLIDTADSYGPFVSETLIAEALHPYEGLTIATKGGLVRYPDNPSPWPQVGDPHYLRQCVHMSLRRLKIDRIDLWQLHRIDPKVPQDEQFDAIRSFIKEGLIRHAGLSQVSVEQIEAARKVFPVATVQNRYNLIDRADEDVLEYCETNGIGFIPWFPLAAGELAKDGGIVDTVAKARGATPGQIALAWILKRSPVILPIPGTSKVAHLEENVAGAAIELSDEEFGDIDAASPLP

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
86 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
110 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
111 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
140 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
141 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
146 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
147 2643221584 Caulobacter sp. Root656 Isolate Unclassified
148 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
149 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
150 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
151 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 0
Isolates 3.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.5
Nodule 0
Rhizoplane 2.5
Rhizosphere 77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10060002 3300009545 Bacteria 3805
2 Ga0070658_10012139 3300005327 Bacteria 6916
3 Ga0070683_100025593 3300005329 Bacteria 5302
4 Ga0070670_100000804 3300005331 Bacteria 24410
5 Ga0070660_100014765 3300005339 Bacteria 5635
6 Ga0070660_100334884 3300005339 Bacteria 1245
7 Ga0070661_100003809 3300005344 Bacteria 10393
8 Ga0070661_100026425 3300005344 Bacteria 4175
9 Ga0070668_100006245 3300005347 Bacteria 8826
10 Ga0070659_100009861 3300005366 Bacteria 7024
11 Ga0070659_100047465 3300005366 Bacteria 3368
12 Ga0070659_100232115 3300005366 Bacteria 1525
13 Ga0070659_100393632 3300005366 Bacteria 1169
14 Ga0070667_100030095 3300005367 Bacteria 4527
15 Ga0070714_100150734 3300005435 Bacteria 2095
16 Ga0070713_100155077 3300005436 Bacteria 2041
17 Ga0070710_10015788 3300005437 Bacteria 3828
18 Ga0070711_100026736 3300005439 Bacteria 3784
19 Ga0070662_100443489 3300005457 Bacteria 1076
20 Ga0070681_10031708 3300005458 Bacteria 5305
21 Ga0070679_100002424 3300005530 Bacteria 16892
22 Ga0070684_100080989 3300005535 Bacteria 2873
23 Ga0068853_100105737 3300005539 Bacteria 2493
24 Ga0070665_100165780 3300005548 Bacteria 2212
25 Ga0068855_100126671 3300005563 Bacteria 2919
26 Ga0070664_100052404 3300005564 Bacteria 3456
27 Ga0068857_100026304 3300005577 Bacteria 5127
28 Ga0068856_100057421 3300005614 Bacteria 3842
29 Ga0068856_100080335 3300005614 Bacteria 3234
30 Ga0068852_100057323 3300005616 Bacteria 3370
31 Ga0068863_100216265 3300005841 Bacteria 1846
32 Ga0068862_100046359 3300005844 Bacteria 3709
33 Ga0075363_100018916 3300006048 Bacteria 3438
34 Ga0070715_10008624 3300006163 Bacteria 3560
35 Ga0075362_10002186 3300006177 Bacteria 6484
36 Ga0075370_10097691 3300006353 Bacteria 1698
37 Ga0075430_100018301 3300006846 Bacteria 5963
38 Ga0075431_100094449 3300006847 Bacteria 3086
39 Ga0075429_100016334 3300006880 Bacteria 6434
40 Ga0105240_10013678 3300009093 Bacteria 11129
41 Ga0105240_10020204 3300009093 Bacteria 8890
42 Ga0111539_10407590 3300009094 Bacteria 1583
43 Ga0105245_10115452 3300009098 Bacteria 2502
44 Ga0105245_10329958 3300009098 Bacteria 1505
45 Ga0114129_10115687 3300009147 Bacteria 3696
46 Ga0105243_10328482 3300009148 Bacteria 1396
47 Ga0105241_10212977 3300009174 Bacteria 1620
48 Ga0105237_10745112 3300009545 Bacteria 986
49 Ga0105238_10020597 3300009551 Bacteria 6717
50 Ga0105238_10099950 3300009551 Bacteria 2884
51 Ga0105238_10383436 3300009551 Bacteria 1397
52 Ga0105249_10051695 3300009553 Bacteria 3750
53 Ga0105239_10000051 3300010375 Bacteria 169036
54 Ga0105239_10241258 3300010375 Bacteria 2028
55 Ga0157371_10030757 3300013102 Bacteria 3871
56 Ga0157371_10225348 3300013102 Bacteria 1347
57 Ga0157370_10053032 3300013104 Bacteria 3869
58 Ga0157369_10026540 3300013105 Bacteria 6424
59 Ga0157372_10158303 3300013307 Bacteria 2616
60 Ga0157372_10164062 3300013307 Bacteria 2569
61 Ga0163163_10024639 3300014325 Bacteria 5728
62 Ga0157379_10076952 3300014968 Bacteria 2988
63 Ga0157376_10004631 3300014969 Bacteria 9583
64 Ga0213876_10004154 3300021384 Bacteria 8124
65 Ga0213876_10006208 3300021384 Bacteria 6521
66 Ga0213876_10045103 3300021384 Bacteria 2332
67 Ga0213875_10009539 3300021388 Bacteria 4915
68 Ga0213875_10032129 3300021388 Bacteria 2481
69 Ga0213875_10124530 3300021388 Bacteria 1204
70 Ga0209233_1000142 3300025261 Bacteria 192193
71 Ga0207705_10011491 3300025909 Bacteria 6404
72 Ga0207654_10126796 3300025911 Bacteria 1610
73 Ga0207707_10034122 3300025912 Bacteria 4452
74 Ga0207695_10016643 3300025913 Bacteria 8594
75 Ga0207695_10023426 3300025913 Bacteria 6976
76 Ga0207695_10044478 3300025913 Bacteria 4723
77 Ga0207671_10003522 3300025914 Bacteria 15538
78 Ga0207693_10017093 3300025915 Bacteria 5789
79 Ga0207663_10024403 3300025916 Bacteria 3482
80 Ga0207657_10019310 3300025919 Bacteria 6477
81 Ga0207657_10093238 3300025919 Bacteria 2508
82 Ga0207649_10007229 3300025920 Bacteria 6037
83 Ga0207649_10151234 3300025920 Bacteria 1599
84 Ga0207694_10197717 3300025924 Bacteria 1635
85 Ga0207650_10000782 3300025925 Bacteria 24485
86 Ga0207664_10099106 3300025929 Bacteria 2404
87 Ga0207690_10016215 3300025932 Bacteria 4529
88 Ga0207690_10166944 3300025932 Bacteria 1646
89 Ga0207665_10056471 3300025939 Bacteria 2650
90 Ga0207711_10305675 3300025941 Bacteria 1467
91 Ga0207661_10125484 3300025944 Bacteria 2191
92 Ga0207679_10009225 3300025945 Bacteria 6307
93 Ga0207679_10018885 3300025945 Bacteria 4625
94 Ga0207667_10002392 3300025949 Bacteria 23492
95 Ga0207667_10176233 3300025949 Bacteria 2196
96 Ga0207667_10481724 3300025949 Bacteria 1259
97 Ga0207712_10023206 3300025961 Bacteria 4092
98 Ga0207668_10051735 3300025972 Bacteria 2838
99 Ga0207658_10004106 3300025986 Bacteria 10155
100 Ga0207639_10077513 3300026041 Bacteria 2620
101 Ga0207676_10034096 3300026095 Bacteria 3852
102 Ga0207674_10047683 3300026116 Bacteria 4390
103 Ga0207698_10094677 3300026142 Bacteria 2456
104 Ga0268266_10269823 3300028379 Bacteria 1579
105 Ga0265318_10036143 3300028577 Bacteria 1896
106 Ga0307515_10057827 3300028794 Bacteria 5603
107 Ga0265330_10002970 3300031235 Bacteria 9029
108 Ga0265325_10000940 3300031241 Bacteria 21017
109 Ga0265325_10121366 3300031241 Bacteria 1259
110 Ga0265339_10001865 3300031249 Bacteria 15496
111 Ga0265339_10016096 3300031249 Bacteria 4466
112 Ga0265313_10000199 3300031595 Bacteria 64705
113 Ga0265313_10067960 3300031595 Bacteria 1647
114 Ga0316575_10055150 3300031665 Bacteria 1583
115 Ga0316579_10039049 3300031691 Bacteria 2198
116 Ga0265314_10082559 3300031711 Bacteria 2114
117 Ga0265342_10197483 3300031712 Bacteria 1095
118 Ga0373935_0000579 3300035692 Bacteria 19068
119 Ga0373947_0000009 3300035725 Bacteria 172751
120 Ga0373937_0028881 3300036401 Bacteria 5022
121 Ga0373937_0203146 3300036401 Bacteria 1863
122 Ga0436364_0071400 3300037853 Bacteria 7610
123 Ga0436364_0562549 3300037853 Bacteria 2883
124 Ga0436364_0689540 3300037853 Bacteria 5902
125 Ga0436364_0848863 3300037853 Bacteria 7069
126 Ga0436364_1154304 3300037853 Bacteria 15815
127 Ga0395901_0397300 3300038443 Bacteria 1416
128 Ga0436365_0090198 3300039437 Bacteria 12256
129 Ga0436365_0155896 3300039437 Bacteria 3467
130 Ga0436365_1071804 3300039437 Bacteria 4119
131 Ga0436365_1082193 3300039437 Bacteria 13609
132 Ga0436365_1752289 3300039437 Bacteria 3562
133 Ga0436363_0015268 3300039450 Bacteria 1767
134 Ga0436363_0077484 3300039450 Bacteria 4429
135 Ga0436363_1270437 3300039450 Bacteria 1577
136 Ga0436363_1684255 3300039450 Bacteria 1006
137 Ga0436362_0229384 3300039453 Bacteria 1736
138 Ga0466965_0002609 3300044683 Bacteria 7714
139 Ga0466963_0012252 3300044694 Bacteria 5243
140 Ga0466963_0391643 3300044694 Bacteria 980
141 Ga0466971_0170507 3300044719 Bacteria 1021
142 Ga0466957_0037524 3300044842 Bacteria 2918
143 Ga0466960_0004448 3300044901 Bacteria 5479
144 Ga0466958_0052406 3300045836 Bacteria 2473
145 Ga0466967_0052348 3300045976 Bacteria 3583
146 Ga0495638_0000530 3300046460 Bacteria 44348
147 Ga0495650_0027700 3300046471 Bacteria 2614
148 Ga0495631_0052233 3300046518 Bacteria 1785
149 Ga0495668_0018768 3300046616 Bacteria 3997
150 Ga0495625_0000676 3300046660 Bacteria 48679
151 Ga0495625_0017082 3300046660 Bacteria 5686
152 Ga0495679_054341 3300047446 Bacteria 1193
153 Ga0495673_0061314 3300047469 Bacteria 1611
154 Ga0495626_0154881 3300048091 Bacteria 964
155 Ga0496104_0025361 3300048907 Bacteria 5465
156 Ga0496109_0104891 3300048912 Bacteria 2625
157 Ga0496111_0375402 3300048914 Bacteria 1052
158 Ga0496112_0196698 3300048915 Bacteria 1976
159 Ga0496113_0050385 3300048916 Bacteria 3104
160 Ga0496117_0142072 3300048920 Bacteria 1436
161 Ga0496118_0024380 3300048921 Bacteria 5222
162 Ga0496121_0001253 3300048924 Bacteria 43985
163 Ga0496121_0012779 3300048924 Bacteria 9095
164 Ga0496121_0167822 3300048924 Bacteria 1598
165 Ga0496121_0260055 3300048924 Bacteria 1199
166 Ga0501031_0006302 3300049568 Bacteria 7733
167 Ga0501034_0126718 3300049571 Bacteria 2538
168 Ga0501034_0469964 3300049571 Bacteria 1173
169 Ga0501036_0019590 3300049572 Bacteria 5680
170 Ga0501038_0043266 3300049574 Bacteria 3916
171 Ga0501039_0016085 3300049575 Bacteria 5729
172 Ga0501043_0109452 3300049579 Bacteria 2170
173 Ga0501046_0102109 3300049580 Bacteria 2199
174 Ga0501046_0213723 3300049580 Bacteria 1431
175 Ga0501069_0041761 3300049585 Bacteria 2536
176 Ga0501070_0022904 3300049586 Bacteria 5228
177 Ga0501072_0142285 3300049588 Bacteria 1913
178 Ga0501073_0060550 3300049589 Bacteria 2642
179 Ga0501080_0221337 3300049742 Bacteria 1732
180 Ga0501080_0297425 3300049742 Bacteria 1464
181 Ga0501035_0437233 3300049822 Bacteria 1084
182 Ga0501044_0601109 3300049823 Bacteria 993
183 nmdc:mga03683_4712_c1 3300050489 Bacteria 4550
184 nmdc:mga05p37_102280_c1 3300050507 Bacteria 3528
185 nmdc:mga06r32_82452_c1 3300050510 Bacteria 3133
186 Ga0495655_0004799 3300053083 Bacteria 2342
187 Ga0500556_0011377 3300053104 Bacteria 2635
188 Ga0500595_018022 3300053119 Bacteria 2591
189 Ga0500618_000642 3300053125 Bacteria 20854
190 Ga0500559_0014742 3300053136 Bacteria 3302
191 Ga0500616_0018151 3300053153 Bacteria 3981
192 Ga0500622_0154931 3300053156 Bacteria 1079
193 Ga0501082_0332986 3300060353 Bacteria 1323
194 2585147767 2582581279 Bacteria 4980720
195 2643782325 2643221552 Bacteria 5708754
196 2643929251 2643221584 Bacteria 5511711
197 2883293415 2883291878 Bacteria 5894118
198 2886629700 2886627955 Bacteria 7618130
199 2898795217 2898795034 Bacteria 4294459
200 3005410900 3005409236 Bacteria 7188837
201 Ga0105237_10060002
202 Ga0070658_10012139
203 Ga0070683_100025593
204 Ga0070670_100000804
205 Ga0070660_100014765
206 Ga0070660_100334884
207 Ga0070661_100003809
208 Ga0070661_100026425
209 Ga0070668_100006245
210 Ga0070659_100009861
211 Ga0070659_100047465
212 Ga0070659_100232115
213 Ga0070659_100393632
214 Ga0070667_100030095
215 Ga0070714_100150734
216 Ga0070713_100155077
217 Ga0070710_10015788
218 Ga0070711_100026736
219 Ga0070662_100443489
220 Ga0070681_10031708
221 Ga0070679_100002424
222 Ga0070684_100080989
223 Ga0068853_100105737
224 Ga0070665_100165780
225 Ga0068855_100126671
226 Ga0070664_100052404
227 Ga0068857_100026304
228 Ga0068856_100057421
229 Ga0068856_100080335
230 Ga0068852_100057323
231 Ga0068863_100216265
232 Ga0068862_100046359
233 Ga0075363_100018916
234 Ga0070715_10008624
235 Ga0075362_10002186
236 Ga0075370_10097691
237 Ga0075430_100018301
238 Ga0075431_100094449
239 Ga0075429_100016334
240 Ga0105240_10013678
241 Ga0105240_10020204
242 Ga0111539_10407590
243 Ga0105245_10115452
244 Ga0105245_10329958
245 Ga0114129_10115687
246 Ga0105243_10328482
247 Ga0105241_10212977
248 Ga0105237_10745112
249 Ga0105238_10020597
250 Ga0105238_10099950
251 Ga0105238_10383436
252 Ga0105249_10051695
253 Ga0105239_10000051
254 Ga0105239_10241258
255 Ga0157371_10030757
256 Ga0157371_10225348
257 Ga0157370_10053032
258 Ga0157369_10026540
259 Ga0157372_10158303
260 Ga0157372_10164062
261 Ga0163163_10024639
262 Ga0157379_10076952
263 Ga0157376_10004631
264 Ga0213876_10004154
265 Ga0213876_10006208
266 Ga0213876_10045103
267 Ga0213875_10009539
268 Ga0213875_10032129
269 Ga0213875_10124530
270 Ga0209233_1000142
271 Ga0207705_10011491
272 Ga0207654_10126796
273 Ga0207707_10034122
274 Ga0207695_10016643
275 Ga0207695_10023426
276 Ga0207695_10044478
277 Ga0207671_10003522
278 Ga0207693_10017093
279 Ga0207663_10024403
280 Ga0207657_10019310
281 Ga0207657_10093238
282 Ga0207649_10007229
283 Ga0207649_10151234
284 Ga0207694_10197717
285 Ga0207650_10000782
286 Ga0207664_10099106
287 Ga0207690_10016215
288 Ga0207690_10166944
289 Ga0207665_10056471
290 Ga0207711_10305675
291 Ga0207661_10125484
292 Ga0207679_10009225
293 Ga0207679_10018885
294 Ga0207667_10002392
295 Ga0207667_10176233
296 Ga0207667_10481724
297 Ga0207712_10023206
298 Ga0207668_10051735
299 Ga0207658_10004106
300 Ga0207639_10077513
301 Ga0207676_10034096
302 Ga0207674_10047683
303 Ga0207698_10094677
304 Ga0268266_10269823
305 Ga0265318_10036143
306 Ga0307515_10057827
307 Ga0265330_10002970
308 Ga0265325_10000940
309 Ga0265325_10121366
310 Ga0265339_10001865
311 Ga0265339_10016096
312 Ga0265313_10000199
313 Ga0265313_10067960
314 Ga0316575_10055150
315 Ga0316579_10039049
316 Ga0265314_10082559
317 Ga0265342_10197483
318 Ga0373935_0000579
319 Ga0373947_0000009
320 Ga0373937_0028881
321 Ga0373937_0203146
322 Ga0436364_0071400
323 Ga0436364_0562549
324 Ga0436364_0689540
325 Ga0436364_0848863
326 Ga0436364_1154304
327 Ga0395901_0397300
328 Ga0436365_0090198
329 Ga0436365_0155896
330 Ga0436365_1071804
331 Ga0436365_1082193
332 Ga0436365_1752289
333 Ga0436363_0015268
334 Ga0436363_0077484
335 Ga0436363_1270437
336 Ga0436363_1684255
337 Ga0436362_0229384
338 Ga0466965_0002609
339 Ga0466963_0012252
340 Ga0466963_0391643
341 Ga0466971_0170507
342 Ga0466957_0037524
343 Ga0466960_0004448
344 Ga0466958_0052406
345 Ga0466967_0052348
346 Ga0495638_0000530
347 Ga0495650_0027700
348 Ga0495631_0052233
349 Ga0495668_0018768
350 Ga0495625_0000676
351 Ga0495625_0017082
352 Ga0495679_054341
353 Ga0495673_0061314
354 Ga0495626_0154881
355 Ga0496104_0025361
356 Ga0496109_0104891
357 Ga0496111_0375402
358 Ga0496112_0196698
359 Ga0496113_0050385
360 Ga0496117_0142072
361 Ga0496118_0024380
362 Ga0496121_0001253
363 Ga0496121_0012779
364 Ga0496121_0167822
365 Ga0496121_0260055
366 Ga0501031_0006302
367 Ga0501034_0126718
368 Ga0501034_0469964
369 Ga0501036_0019590
370 Ga0501038_0043266
371 Ga0501039_0016085
372 Ga0501043_0109452
373 Ga0501046_0102109
374 Ga0501046_0213723
375 Ga0501069_0041761
376 Ga0501070_0022904
377 Ga0501072_0142285
378 Ga0501073_0060550
379 Ga0501080_0221337
380 Ga0501080_0297425
381 Ga0501035_0437233
382 Ga0501044_0601109
383 nmdc:mga03683_4712_c1
384 nmdc:mga05p37_102280_c1
385 nmdc:mga06r32_82452_c1
386 Ga0495655_0004799
387 Ga0500556_0011377
388 Ga0500595_018022
389 Ga0500618_000642
390 Ga0500559_0014742
391 Ga0500616_0018151
392 Ga0500622_0154931
393 Ga0501082_0332986
394 2585147767
395 2643782325
396 2643929251
397 2883293415
398 2886629700
399 2898795217
400 3005410900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

44

310

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9832 3 273
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9083 1 275
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8951 1 276
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8944 1 276
3uyi-assembly1.cif.gz_A-2 crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8907 1 275
ID Description Score Start End Superfamily
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9978 9 285 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9631 9 285 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9192 12 277 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9121 1 277 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9083 1 275 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A126NS02-F1-model_v4 Oxidoreductase 0.997 3 283 GO:0004033
GO:0005737
AF-A0A8A3LYI6-F1-model_v4 deleted 0.9969 3 283
AF-A0A4R0AD32-F1-model_v4 deleted 0.9967 3 283
AF-A0A1D8UVI4-F1-model_v4 Oxidoreductase 0.9963 3 286 GO:0004033
GO:0005737
AF-A0A3C0BVS3-F1-model_v4 Oxidoreductase 0.9941 3 283 GO:0004033
GO:0005737

Map