F307084

General Info

Members Datasets Scaffolds Average Seq Length
200 131 199 338

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10001709|Ga0105243_1000170910
Length 396
Sequence LTGARAATCGRQRVPQFRLPACFAHLPAGVGFWNIVNRDFVRYDSNAILSGQMHSVATSTLAWVGFCSFILVMLAIDLGVFNRKPHEISYRNAAIWSAVWVTLALIFFGFLLGPLGWQLFGDERHQKAFEFITGYLIELSLSVDNLFVFLLIFSYFKVPPKYQHRVLYWGVLGALVMRVTMILVGTELIARFHWIIYLLGAFLVYTGIQMLRGGETELEPDKQPIIRFITRHVPIVRHYEKRKFFTKVDGKRVGTLLFLVLIVVEVTDLVFAVDSIPAIFGVTTDRFIVYTSNVFAILGLRTFYFLLAGVVEKFHYLKVGLGIVLGFIGIKMLLPLITKILGAGLHALGFESWARNVHHFEDIPVVIALGFVAVVLLSSVAASLIWPKPAAEDNEE

Samples

Sample ID Description Type Environment
1 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 0.5
Rhizosphere 96.5
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J14986_100072 3300001432 Bacteria 4183
2 JGI24748J21848_1000010 3300002074 Bacteria 166979
3 JGI24034J26672_10000001 3300002239 Bacteria 1118280
4 JGI25406J46586_10018674 3300003203 Bacteria 2845
5 Ga0065712_10096945 3300005290 Bacteria 2166
6 Ga0065707_10095387 3300005295 Unclassified 3384
7 Ga0070690_100092607 3300005330 Bacteria 1993
8 Ga0070687_100159809 3300005343 Bacteria 1331
9 Ga0070668_100002907 3300005347 Bacteria 12653
10 Ga0070701_10020069 3300005438 Bacteria 3167
11 Ga0070694_100005118 3300005444 Bacteria 7905
12 Ga0070694_100007875 3300005444 Bacteria 6504
13 Ga0070694_100135053 3300005444 Bacteria 1787
14 Ga0070708_100010503 3300005445 Bacteria 7506
15 Ga0070708_100180250 3300005445 Unclassified 1974
16 Ga0070708_100355651 3300005445 Bacteria 1380
17 Ga0070663_100009302 3300005455 Bacteria 6081
18 Ga0068867_100090617 3300005459 Unclassified 2320
19 Ga0070706_100015159 3300005467 Bacteria 7117
20 Ga0070706_100026556 3300005467 Bacteria 5328
21 Ga0070707_100000612 3300005468 Bacteria 35823
22 Ga0070707_100038750 3300005468 Bacteria 4553
23 Ga0070707_100266656 3300005468 Bacteria 1665
24 Ga0070707_100508036 3300005468 Bacteria 1167
25 Ga0070698_100000398 3300005471 Bacteria 45901
26 Ga0070698_100034162 3300005471 Bacteria 5267
27 Ga0070698_100237214 3300005471 Bacteria 1757
28 Ga0070699_100096071 3300005518 Bacteria 2595
29 Ga0070697_100050705 3300005536 Bacteria 3370
30 Ga0068853_100076268 3300005539 Bacteria 2927
31 Ga0070686_100021251 3300005544 Bacteria 3855
32 Ga0070696_100024907 3300005546 Bacteria 4066
33 Ga0070696_100077701 3300005546 Unclassified 2346
34 Ga0070665_100027978 3300005548 Bacteria 5678
35 Ga0070704_100009128 3300005549 Bacteria 5984
36 Ga0070704_100025562 3300005549 Bacteria 3889
37 Ga0070704_100039802 3300005549 Bacteria 3229
38 Ga0070704_100057760 3300005549 Bacteria 2761
39 Ga0070704_100189708 3300005549 Bacteria 1651
40 Ga0070704_100260277 3300005549 Unclassified 1429
41 Ga0068854_100083000 3300005578 Bacteria 2369
42 Ga0068854_100129691 3300005578 Bacteria 1924
43 Ga0068856_100081144 3300005614 Bacteria 3218
44 Ga0068859_100003569 3300005617 Bacteria 15854
45 Ga0068859_100008220 3300005617 Bacteria 10587
46 Ga0068861_100023904 3300005719 Unclassified 4413
47 Ga0068861_100063307 3300005719 Unclassified 2843
48 Ga0068858_100000005 3300005842 Bacteria 305830
49 Ga0068858_100033066 3300005842 Unclassified 4803
50 Ga0068858_100274409 3300005842 Unclassified 1605
51 Ga0068862_100023339 3300005844 Bacteria 5182
52 Ga0068862_100027468 3300005844 Bacteria 4790
53 Ga0081455_10001880 3300005937 Bacteria 25259
54 Ga0081538_10037833 3300005981 Bacteria 3122
55 Ga0081540_1024294 3300005983 Bacteria 3519
56 Ga0081539_10000502 3300005985 Bacteria 82098
57 Ga0081539_10001333 3300005985 Bacteria 43002
58 Ga0081539_10063409 3300005985 Bacteria 2016
59 Ga0081539_10074142 3300005985 Bacteria 1813
60 Ga0070715_10000024 3300006163 Bacteria 110647
61 Ga0070716_100000046 3300006173 Bacteria 49780
62 Ga0097621_100223318 3300006237 Bacteria 1642
63 Ga0075428_100084121 3300006844 Bacteria 3471
64 Ga0075428_100119639 3300006844 Bacteria 2867
65 Ga0075430_100175725 3300006846 Bacteria 1781
66 Ga0075431_100041528 3300006847 Bacteria 4742
67 Ga0075431_100406312 3300006847 Unclassified 1362
68 Ga0075434_100043016 3300006871 Unclassified 4478
69 Ga0075434_100221542 3300006871 Bacteria 1912
70 Ga0068865_100080209 3300006881 Bacteria 2340
71 Ga0075436_100000002 3300006914 Bacteria 475522
72 Ga0097620_100003568 3300006931 Bacteria 15854
73 Ga0097620_100008220 3300006931 Bacteria 10587
74 Ga0075435_100000687 3300007076 Bacteria 20986
75 Ga0099794_10001085 3300007265 Bacteria 9307
76 Ga0111539_10008452 3300009094 Bacteria 13094
77 Ga0105247_10000002 3300009101 Bacteria 724587
78 Ga0114129_10020304 3300009147 Bacteria 9451
79 Ga0114129_10024266 3300009147 Bacteria 8591
80 Ga0105243_10001709 3300009148 Bacteria 18920
81 Ga0105243_10047687 3300009148 Bacteria 3374
82 Ga0105241_10114872 3300009174 Bacteria 2160
83 Ga0105242_10000301 3300009176 Bacteria 39312
84 Ga0105242_10000554 3300009176 Bacteria 29570
85 Ga0105248_10098831 3300009177 Unclassified 3288
86 Ga0105249_10000521 3300009553 Bacteria 35462
87 Ga0105249_10066329 3300009553 Unclassified 3323
88 Ga0105249_10086910 3300009553 Bacteria 2917
89 Ga0105249_10432975 3300009553 Unclassified 1351
90 Ga0105239_10031266 3300010375 Bacteria 5855
91 Ga0105239_10206992 3300010375 Unclassified 2198
92 Ga0157371_10079966 3300013102 Unclassified 2315
93 Ga0157378_10000003 3300013297 Bacteria 203725
94 Ga0157378_10005802 3300013297 Bacteria 10820
95 Ga0157378_10054993 3300013297 Bacteria 3545
96 Ga0157378_10161890 3300013297 Bacteria 2093
97 Ga0163162_10000009 3300013306 Bacteria 316099
98 Ga0163162_10014274 3300013306 Bacteria 7761
99 Ga0163162_10036545 3300013306 Unclassified 4897
100 Ga0157375_10001002 3300013308 Bacteria 24391
101 Ga0157375_10018348 3300013308 Bacteria 6344
102 Ga0157375_10183979 3300013308 Bacteria 2242
103 Ga0157380_10039263 3300014326 Unclassified 3680
104 Ga0157380_10107448 3300014326 Bacteria 2337
105 Ga0157380_10169596 3300014326 Bacteria 1905
106 Ga0157379_10396934 3300014968 Bacteria 1267
107 Ga0157376_10128876 3300014969 Unclassified 2255
108 Ga0213876_10000033 3300021384 Bacteria 205318
109 Ga0213876_10000359 3300021384 Bacteria 39020
110 Ga0207672_1000173 3300025223 Bacteria 8911
111 Ga0207710_10000002 3300025900 Bacteria 1251998
112 Ga0207647_10007008 3300025904 Bacteria 8174
113 Ga0207685_10000018 3300025905 Bacteria 145715
114 Ga0207684_10001316 3300025910 Bacteria 27254
115 Ga0207695_10043925 3300025913 Bacteria 4758
116 Ga0207671_10000580 3300025914 Bacteria 48907
117 Ga0207662_10017913 3300025918 Unclassified 4011
118 Ga0207662_10107501 3300025918 Bacteria 1736
119 Ga0207646_10001205 3300025922 Bacteria 32528
120 Ga0207646_10022643 3300025922 Bacteria 5785
121 Ga0207646_10070626 3300025922 Unclassified 3119
122 Ga0207646_10360025 3300025922 Bacteria 1314
123 Ga0207694_10023951 3300025924 Bacteria 4636
124 Ga0207644_10014233 3300025931 Bacteria 5320
125 Ga0207644_10027143 3300025931 Bacteria 3954
126 Ga0207686_10000018 3300025934 Bacteria 189717
127 Ga0207686_10000021 3300025934 Bacteria 181793
128 Ga0207686_10000132 3300025934 Bacteria 58994
129 Ga0207686_10000436 3300025934 Bacteria 28156
130 Ga0207709_10000069 3300025935 Bacteria 183367
131 Ga0207709_10024346 3300025935 Bacteria 3456
132 Ga0207704_10135961 3300025938 Unclassified 1711
133 Ga0207665_10000131 3300025939 Bacteria 49773
134 Ga0207665_10020132 3300025939 Bacteria 4382
135 Ga0207665_10220716 3300025939 Bacteria 1389
136 Ga0207689_10044969 3300025942 Bacteria 3651
137 Ga0207689_10101266 3300025942 Bacteria 2366
138 Ga0207651_10163158 3300025960 Unclassified 1749
139 Ga0207712_10000445 3300025961 Bacteria 35170
140 Ga0207712_10050864 3300025961 Bacteria 2895
141 Ga0207668_10007075 3300025972 Bacteria 6657
142 Ga0207640_10049038 3300025981 Bacteria 2732
143 Ga0207640_10208552 3300025981 Bacteria 1487
144 Ga0207703_10000150 3300026035 Bacteria 80047
145 Ga0207703_10089199 3300026035 Bacteria 2589
146 Ga0207708_10013325 3300026075 Bacteria 6142
147 Ga0207641_10067665 3300026088 Bacteria 3061
148 Ga0207648_10269799 3300026089 Unclassified 1520
149 Ga0207674_10258177 3300026116 Unclassified 1690
150 Ga0207675_100001831 3300026118 Bacteria 21313
151 Ga0207428_10012962 3300027907 Bacteria 7306
152 Ga0207428_10041851 3300027907 Bacteria 3707
153 Ga0268265_10022655 3300028380 Bacteria 4416
154 Ga0268264_10567130 3300028381 Bacteria 1115
155 Ga0265339_10024650 3300031249 Bacteria 3463
156 Ga0307513_10001605 3300031456 Bacteria 32470
157 Ga0316577_10040269 3300031733 Bacteria 2613
158 Ga0307416_100121742 3300032002 Archaea 2327
159 Ga0316582_0036068 3300036647 Bacteria 3058
160 Ga0316584_0127004 3300036712 Bacteria 1904
161 Ga0436365_0198252 3300039437 Bacteria 179679
162 Ga0436365_1311852 3300039437 Bacteria 65317
163 Ga0439462_0023153 3300042015 Bacteria 1628
164 Ga0451577_0057742 3300042876 Bacteria 3459
165 Ga0466969_0002063 3300044656 Bacteria 10724
166 Ga0453683_0022173 3300044673 Bacteria 4052
167 Ga0466966_0025713 3300044684 Bacteria 3845
168 Ga0453684_0005617 3300044712 Bacteria 24662
169 Ga0453684_0029985 3300044712 Bacteria 7701
170 Ga0466959_0024573 3300045049 Bacteria 4464
171 Ga0451576_0018389 3300045051 Bacteria 7662
172 Ga0495622_0025500 3300046557 Bacteria 2761
173 Ga0495670_0037142 3300046691 Bacteria 2428
174 Ga0495684_0140893 3300047471 Bacteria 1808
175 Ga0495615_0003253 3300048090 Bacteria 2700
176 Ga0496106_0014419 3300048909 Bacteria 5839
177 Ga0501034_0072290 3300049571 Bacteria 3458
178 Ga0501047_0017863 3300049581 Bacteria 6795
179 Ga0501070_0346585 3300049586 Unclassified 1206
180 Ga0501075_0461493 3300049591 Bacteria 969
181 Ga0501035_0019722 3300049822 Bacteria 6195
182 Ga0501044_0010270 3300049823 Bacteria 10171
183 nmdc:mga05p37_487160_c1 3300050507 Unclassified 1419
184 nmdc:mga0qj67_149078_c1 3300050509 Bacteria 1897
185 nmdc:mga06r32_393107_c1 3300050510 Unclassified 1369
186 nmdc:mga08y16_14312_c1 3300050511 Bacteria 8350
187 nmdc:mga08y16_9981_c1 3300050511 Bacteria 9964
188 nmdc:mga0n895_187956_c1 3300050512 Bacteria 2097
189 nmdc:mga0n895_248443_c1 3300050512 Bacteria 1805
190 nmdc:mga0n895_464137_c1 3300050512 Unclassified 1278
191 nmdc:mga0rr50_377_c1 3300050513 Bacteria 24435
192 nmdc:mga08x19_53_c1 3300050514 Bacteria 123767
193 nmdc:mga0a205_155266_c1 3300050515 Unclassified 2187
194 nmdc:mga0a205_206331_c1 3300050515 Bacteria 1854
195 nmdc:mga0a205_334536_c1 3300050515 Unclassified 1384
196 Ga0500616_0002746 3300053153 Bacteria 14243
197 Ga0501084_0150469 3300054114 Bacteria 1962
198 Ga0501082_0166969 3300060353 Bacteria 1913
199 Ga0530510_0211573 3300061734 Bacteria 1441

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0166969 Ga0501082_0166969_12_884 282
2 3300049591 Ga0501075_0461493 Ga0501075_0461493_62_958 290
3 3300009553 Ga0105249_10000521 Ga0105249_1000052118 291
4 3300013306 Ga0163162_10000009 Ga0163162_10000009215 291
5 3300014326 Ga0157380_10039263 Ga0157380_100392631 291
6 3300014326 Ga0157380_10107448 Ga0157380_101074483 292
7 3300046557 Ga0495622_0025500 Ga0495622_0025500_1098_2150 292
8 3300005937 Ga0081455_10001880 Ga0081455_1000188013 293
9 3300032002 Ga0307416_100121742 Ga0307416_1001217421 294
10 3300049571 Ga0501034_0072290 Ga0501034_0072290_2337_3326 298
11 3300049581 Ga0501047_0017863 Ga0501047_0017863_2337_3326 298
12 3300049586 Ga0501070_0346585 Ga0501070_0346585_183_1172 298
13 3300049822 Ga0501035_0019722 Ga0501035_0019722_3588_4577 298
14 3300049823 Ga0501044_0010270 Ga0501044_0010270_6292_7281 298
15 3300005985 Ga0081539_10001333 Ga0081539_1000133324 300
16 3300009553 Ga0105249_10086910 Ga0105249_100869103 301
17 3300054114 Ga0501084_0150469 Ga0501084_0150469_335_1264 301
18 3300061734 Ga0530510_0211573 Ga0530510_0211573_107_1036 301
19 3300021384 Ga0213876_10000359 Ga0213876_100003593 302
20 3300039437 Ga0436365_1311852 Ga0436365_1311852_55804_56865 302
21 3300050509 nmdc:mga0qj67_149078_c1 nmdc:mga0qj67_149078_c1_215_1153 302
22 3300025981 Ga0207640_10208552 Ga0207640_102085521 303
23 3300048090 Ga0495615_0003253 Ga0495615_0003253_346_1311 303
24 3300013308 Ga0157375_10018348 Ga0157375_100183483 306
25 3300005438 Ga0070701_10020069 Ga0070701_100200692 307
26 3300005445 Ga0070708_100010503 Ga0070708_1000105033 307
27 3300005544 Ga0070686_100021251 Ga0070686_1000212517 307
28 3300005546 Ga0070696_100077701 Ga0070696_1000777012 307
29 3300005549 Ga0070704_100057760 Ga0070704_1000577603 307
30 3300005617 Ga0068859_100008220 Ga0068859_1000082202 307
31 3300005844 Ga0068862_100023339 Ga0068862_1000233394 307
32 3300005981 Ga0081538_10037833 Ga0081538_100378335 307
33 3300005983 Ga0081540_1024294 Ga0081540_10242943 307
34 3300005985 Ga0081539_10074142 Ga0081539_100741422 307
35 3300006846 Ga0075430_100175725 Ga0075430_1001757252 307
36 3300006931 Ga0097620_100008220 Ga0097620_10000822010 307
37 3300026116 Ga0207674_10258177 Ga0207674_102581772 307
38 3300028381 Ga0268264_10567130 Ga0268264_105671301 307
39 3300005444 Ga0070694_100007875 Ga0070694_1000078752 308
40 3300006844 Ga0075428_100119639 Ga0075428_1001196392 308
41 3300006847 Ga0075431_100041528 Ga0075431_1000415283 308
42 3300006871 Ga0075434_100221542 Ga0075434_1002215422 308
43 3300013308 Ga0157375_10183979 Ga0157375_101839792 308
44 3300014969 Ga0157376_10128876 Ga0157376_101288762 308
45 3300031456 Ga0307513_10001605 Ga0307513_1000160521 308
46 3300042015 Ga0439462_0023153 Ga0439462_0023153_38_1000 308
47 3300050512 nmdc:mga0n895_248443_c1 nmdc:mga0n895_248443_c1_257_1213 308
48 3300003203 JGI25406J46586_10018674 JGI25406J46586_100186741 309
49 3300005985 Ga0081539_10000502 Ga0081539_1000050248 309
50 3300025931 Ga0207644_10014233 Ga0207644_100142334 309
51 3300036712 Ga0316584_0127004 Ga0316584_0127004_108_1178 309
52 3300005347 Ga0070668_100002907 Ga0070668_1000029075 310
53 3300005719 Ga0068861_100023904 Ga0068861_1000239043 310
54 3300006847 Ga0075431_100406312 Ga0075431_1004063121 310
55 3300025961 Ga0207712_10000445 Ga0207712_1000044518 310
56 3300025972 Ga0207668_10007075 Ga0207668_100070755 310
57 3300044712 Ga0453684_0005617 Ga0453684_0005617_9603_10595 310
58 3300044712 Ga0453684_0029985 Ga0453684_0029985_1751_2743 310
59 3300050510 nmdc:mga06r32_393107_c1 nmdc:mga06r32_393107_c1_210_1292 310
60 3300005290 Ga0065712_10096945 Ga0065712_100969451 311
61 3300005445 Ga0070708_100355651 Ga0070708_1003556511 311
62 3300005578 Ga0068854_100129691 Ga0068854_1001296912 311
63 3300009094 Ga0111539_10008452 Ga0111539_100084523 311
64 3300027907 Ga0207428_10041851 Ga0207428_100418512 311
65 3300050511 nmdc:mga08y16_9981_c1 nmdc:mga08y16_9981_c1_2732_3709 311
66 iso_pu_bacteria 2873314349 2873319352 311
67 3300031733 Ga0316577_10040269 Ga0316577_100402692 314
68 3300036647 Ga0316582_0036068 Ga0316582_0036068_1359_2384 314
69 3300021384 Ga0213876_10000033 Ga0213876_1000003354 316
70 3300039437 Ga0436365_0198252 Ga0436365_0198252_111343_112368 316
71 3300044656 Ga0466969_0002063 Ga0466969_0002063_6244_7260 316
72 3300044684 Ga0466966_0025713 Ga0466966_0025713_1113_2129 316
73 3300045049 Ga0466959_0024573 Ga0466959_0024573_3193_4209 316
74 3300031249 Ga0265339_10024650 Ga0265339_100246502 318
75 3300025922 Ga0207646_10360025 Ga0207646_103600252 319
76 3300005455 Ga0070663_100009302 Ga0070663_1000093022 320
77 3300005539 Ga0068853_100076268 Ga0068853_1000762683 320
78 3300005548 Ga0070665_100027978 Ga0070665_1000279782 320
79 3300005614 Ga0068856_100081144 Ga0068856_1000811443 320
80 3300009174 Ga0105241_10114872 Ga0105241_101148722 320
81 3300013306 Ga0163162_10036545 Ga0163162_100365453 320
82 3300025904 Ga0207647_10007008 Ga0207647_100070084 320
83 3300025913 Ga0207695_10043925 Ga0207695_100439253 320
84 3300025914 Ga0207671_10000580 Ga0207671_1000058044 320
85 3300025924 Ga0207694_10023951 Ga0207694_100239514 320
86 3300005444 Ga0070694_100005118 Ga0070694_1000051184 321
87 3300047471 Ga0495684_0140893 Ga0495684_0140893_373_1338 321
88 3300053153 Ga0500616_0002746 Ga0500616_0002746_9789_10841 321
89 3300005343 Ga0070687_100159809 Ga0070687_1001598091 322
90 3300050513 nmdc:mga0rr50_377_c1 nmdc:mga0rr50_377_c1_14278_15252 322
91 3300050514 nmdc:mga08x19_53_c1 nmdc:mga08x19_53_c1_120896_121870 322
92 3300006871 Ga0075434_100043016 Ga0075434_1000430162 323
93 3300026088 Ga0207641_10067665 Ga0207641_100676653 323
94 3300046691 Ga0495670_0037142 Ga0495670_0037142_95_1198 323
95 3300050512 nmdc:mga0n895_187956_c1 nmdc:mga0n895_187956_c1_754_1779 323
96 3300005445 Ga0070708_100180250 Ga0070708_1001802502 327
97 3300026075 Ga0207708_10013325 Ga0207708_100133253 327
98 3300005536 Ga0070697_100050705 Ga0070697_1000507052 329
99 3300009177 Ga0105248_10098831 Ga0105248_100988312 331
100 3300005549 Ga0070704_100039802 Ga0070704_1000398022 336
101 3300006881 Ga0068865_100080209 Ga0068865_1000802091 338
102 3300009147 Ga0114129_10020304 Ga0114129_100203042 338
103 3300009147 Ga0114129_10024266 Ga0114129_100242663 338
104 3300009148 Ga0105243_10047687 Ga0105243_100476872 338
105 3300025938 Ga0207704_10135961 Ga0207704_101359612 338
106 3300050507 nmdc:mga05p37_487160_c1 nmdc:mga05p37_487160_c1_111_1127 338
107 3300050515 nmdc:mga0a205_155266_c1 nmdc:mga0a205_155266_c1_166_1182 338
108 3300050515 nmdc:mga0a205_206331_c1 nmdc:mga0a205_206331_c1_326_1342 338
109 3300005467 Ga0070706_100015159 Ga0070706_1000151597 339
110 3300005468 Ga0070707_100266656 Ga0070707_1002666562 339
111 3300005471 Ga0070698_100034162 Ga0070698_1000341622 339
112 3300005518 Ga0070699_100096071 Ga0070699_1000960712 339
113 3300005549 Ga0070704_100189708 Ga0070704_1001897081 339
114 3300007265 Ga0099794_10001085 Ga0099794_100010855 339
115 3300013297 Ga0157378_10005802 Ga0157378_1000580210 339
116 3300025910 Ga0207684_10001316 Ga0207684_100013166 339
117 3300025918 Ga0207662_10017913 Ga0207662_100179133 339
118 3300025922 Ga0207646_10022643 Ga0207646_100226433 339
119 3300025934 Ga0207686_10000132 Ga0207686_1000013225 339
120 3300026035 Ga0207703_10089199 Ga0207703_100891992 339
121 3300005330 Ga0070690_100092607 Ga0070690_1000926071 340
122 3300005467 Ga0070706_100026556 Ga0070706_1000265561 340
123 3300005468 Ga0070707_100508036 Ga0070707_1005080361 340
124 3300025939 Ga0207665_10220716 Ga0207665_102207161 340
125 3300001432 JGI24034J14986_100072 JGI24034J14986_1000723 341
126 3300002074 JGI24748J21848_1000010 JGI24748J21848_100001072 341
127 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001610 341
128 3300005295 Ga0065707_10095387 Ga0065707_100953872 341
129 3300005444 Ga0070694_100135053 Ga0070694_1001350532 341
130 3300005459 Ga0068867_100090617 Ga0068867_1000906172 341
131 3300005468 Ga0070707_100000612 Ga0070707_10000061213 341
132 3300005468 Ga0070707_100038750 Ga0070707_1000387501 341
133 3300005471 Ga0070698_100000398 Ga0070698_10000039824 341
134 3300005471 Ga0070698_100237214 Ga0070698_1002372142 341
135 3300005546 Ga0070696_100024907 Ga0070696_1000249072 341
136 3300005549 Ga0070704_100009128 Ga0070704_1000091282 341
137 3300005549 Ga0070704_100025562 Ga0070704_1000255621 341
138 3300005549 Ga0070704_100260277 Ga0070704_1002602771 341
139 3300005578 Ga0068854_100083000 Ga0068854_1000830002 341
140 3300005617 Ga0068859_100003569 Ga0068859_1000035695 341
141 3300005719 Ga0068861_100063307 Ga0068861_1000633072 341
142 3300005842 Ga0068858_100000005 Ga0068858_100000005129 341
143 3300005842 Ga0068858_100033066 Ga0068858_1000330663 341
144 3300005842 Ga0068858_100274409 Ga0068858_1002744092 341
145 3300005844 Ga0068862_100027468 Ga0068862_1000274682 341
146 3300005985 Ga0081539_10063409 Ga0081539_100634092 341
147 3300006163 Ga0070715_10000024 Ga0070715_1000002445 341
148 3300006173 Ga0070716_100000046 Ga0070716_10000004624 341
149 3300006237 Ga0097621_100223318 Ga0097621_1002233181 341
150 3300006844 Ga0075428_100084121 Ga0075428_1000841212 341
151 3300006914 Ga0075436_100000002 Ga0075436_100000002361 341
152 3300006931 Ga0097620_100003568 Ga0097620_1000035685 341
153 3300007076 Ga0075435_100000687 Ga0075435_1000006878 341
154 3300009101 Ga0105247_10000002 Ga0105247_10000002385 341
155 3300009148 Ga0105243_10001709 Ga0105243_1000170910 341
156 3300009176 Ga0105242_10000301 Ga0105242_1000030110 341
157 3300009176 Ga0105242_10000554 Ga0105242_100005549 341
158 3300009553 Ga0105249_10066329 Ga0105249_100663292 341
159 3300009553 Ga0105249_10432975 Ga0105249_104329751 341
160 3300010375 Ga0105239_10031266 Ga0105239_100312665 341
161 3300010375 Ga0105239_10206992 Ga0105239_102069922 341
162 3300013102 Ga0157371_10079966 Ga0157371_100799662 341
163 3300013297 Ga0157378_10000003 Ga0157378_1000000319 341
164 3300013297 Ga0157378_10054993 Ga0157378_100549932 341
165 3300013297 Ga0157378_10161890 Ga0157378_101618902 341
166 3300013306 Ga0163162_10014274 Ga0163162_100142747 341
167 3300013308 Ga0157375_10001002 Ga0157375_100010025 341
168 3300014326 Ga0157380_10169596 Ga0157380_101695962 341
169 3300014968 Ga0157379_10396934 Ga0157379_103969341 341
170 3300025223 Ga0207672_1000173 Ga0207672_10001734 341
171 3300025900 Ga0207710_10000002 Ga0207710_10000002385 341
172 3300025905 Ga0207685_10000018 Ga0207685_1000001841 341
173 3300025918 Ga0207662_10107501 Ga0207662_101075011 341
174 3300025922 Ga0207646_10001205 Ga0207646_100012059 341
175 3300025922 Ga0207646_10070626 Ga0207646_100706262 341
176 3300025931 Ga0207644_10027143 Ga0207644_100271432 341
177 3300025934 Ga0207686_10000018 Ga0207686_1000001870 341
178 3300025934 Ga0207686_10000021 Ga0207686_10000021120 341
179 3300025934 Ga0207686_10000436 Ga0207686_1000043617 341
180 3300025935 Ga0207709_10000069 Ga0207709_1000006931 341
181 3300025935 Ga0207709_10024346 Ga0207709_100243462 341
182 3300025939 Ga0207665_10000131 Ga0207665_1000013118 341
183 3300025939 Ga0207665_10020132 Ga0207665_100201323 341
184 3300025942 Ga0207689_10044969 Ga0207689_100449692 341
185 3300025942 Ga0207689_10101266 Ga0207689_101012662 341
186 3300025960 Ga0207651_10163158 Ga0207651_101631582 341
187 3300025961 Ga0207712_10050864 Ga0207712_100508642 341
188 3300025981 Ga0207640_10049038 Ga0207640_100490382 341
189 3300026035 Ga0207703_10000150 Ga0207703_1000015027 341
190 3300026089 Ga0207648_10269799 Ga0207648_102697991 341
191 3300026118 Ga0207675_100001831 Ga0207675_1000018316 341
192 3300027907 Ga0207428_10012962 Ga0207428_100129626 341
193 3300028380 Ga0268265_10022655 Ga0268265_100226552 341
194 3300042876 Ga0451577_0057742 Ga0451577_0057742_519_1544 341
195 3300044673 Ga0453683_0022173 Ga0453683_0022173_1954_2979 341
196 3300045051 Ga0451576_0018389 Ga0451576_0018389_3723_4748 341
197 3300048909 Ga0496106_0014419 Ga0496106_0014419_26_1051 341
198 3300050511 nmdc:mga08y16_14312_c1 nmdc:mga08y16_14312_c1_5598_6632 341
199 3300050512 nmdc:mga0n895_464137_c1 nmdc:mga0n895_464137_c1_176_1201 341
200 3300050515 nmdc:mga0a205_334536_c1 nmdc:mga0a205_334536_c1_83_1108 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

132

335

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ghj-assembly1.cif.gz_A peptst in complex with tripeptide phe-ala-gln 0.4035 6 280
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.382 60 279
8sc4-assembly1.cif.gz_A human oct1 bound to metformin in inward-open conformation 0.3746 64 277
4d2b-assembly1.cif.gz_A structure of a ligand free pot family peptide transporter 0.3618 6 275
6hcl-assembly1.cif.gz_A crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.3574 77 279
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5604 80 281 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5492 80 281 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4636 86 279 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4607 76 280 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4531 86 279 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V8PHN2-F1-model_v4 TerC family protein 0.9801 2 332 GO:0016020
AF-A0A2V8QR74-F1-model_v4 TerC family protein 0.9765 6 332 GO:0016020
AF-A0A357N1H6-F1-model_v4 TerC family protein 0.9656 10 277 GO:0016020
AF-A0A2V5RGB9-F1-model_v4 Tellurium resistance protein TerC 0.9572 7 238 GO:0016020
AF-A0A3M0YVU3-F1-model_v4 TerC family protein 0.9548 72 336 GO:0016020

Feature Viewer

pLDDT pTM Quality
76.51 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map