F307060

General Info

Members Datasets Scaffolds Average Seq Length
200 154 189 485

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10170452|Ga0111539_101704521
Length 585
Sequence MQRLSDHYVEFGVLLALFLIVMASGFWAARWRSPTTMYSLDEWGLGGRSFGPVLSWFLITGNLYTAYTFVAVPAALYAIGAAGFFAVPFAAITPPLVYVALIRMWSVSHVHGLVTPADFVRIRFDSRALAMLVAVAGIVASMPYVALQLVGIEAVFKVIGLNGPWPLWAAFGILALFTFNAGLRAPALISIIKDVLFLWVILAALVFVAASYGGWGKVFEAADARFTATPNPADGLLLPQLGQFNFGTLVLGSALALFLYPHAVTAVLAAKNRGSVRVALAAVPIYTFGLGILALLGYVAIFRRVLPVGADPTRGVPGDLNTVLPRLFGDHFPDWVAGTAFAAIIFGAFVPAAILSIGAANLFTRNIYLAYLRPNASPAEQTRVSRFGSLGVKFGAIAFIIFLEPQLALDLQLIGGVIILQTLPAVGLGLFTSWLHRRALLLGMTAGPGGTVLRAHFGGSAWPLSHLGIEGGHTVYTGLAALVVNIVVAFVATPLVRFAGLRDGYDITWRRDYAADEGDPQIRRLDEILDGQPVHDSTTTEVPASHALLNARTAEHPYVDQRWPTQGNHAQINLPISGRFPDRPY

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
4 2738543010 Bacillus sp. YR335 Isolate Unclassified
5 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
6 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
7 2902330777 Methylobacterium sp. 2A Isolate Unclassified
8 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
9 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
60 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
106 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
107 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
145 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
146 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
147 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
148 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
153 8022792930 Bacillus sp. Xin Isolate Rhizosphere
154 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94
Metatranscriptomes 0.5
Isolates 5.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23
Nodule 2
Rhizoplane 1
Rhizosphere 64.5
Stem 0
Stem Tuber 0
Unclassified 9.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1006627 3300002773 Bacteria 3110
2 JGI25159J45721_1000839 3300002987 Bacteria 13387
3 JGI25151J46595_10000337 3300003187 Bacteria 50281
4 JGI25153J46596_10008960 3300003215 Bacteria 4717
5 JGI25160J50197_1000046 3300003354 Bacteria 141352
6 JGI25161J50226_1000031 3300003374 Bacteria 141352
7 Ga0055529_1001826 3300003763 Bacteria 5070
8 Ga0055526_1004003 3300003771 Bacteria 9068
9 Ga0055524_1000875 3300003775 Bacteria 19614
10 Ga0055528_1008651 3300003790 Bacteria 4329
11 Ga0055540_1000066 3300003792 Bacteria 122947
12 Ga0055540_1002392 3300003792 Bacteria 9988
13 Ga0055543_1000278 3300004625 Bacteria 37671
14 Ga0055543_1002439 3300004625 Bacteria 6154
15 Ga0065165_1000693 3300005262 Bacteria 48076
16 Ga0070658_10006962 3300005327 Bacteria 9135
17 Ga0070670_100000017 3300005331 Bacteria 224429
18 Ga0070669_100004123 3300005353 Bacteria 10540
19 Ga0070659_100053754 3300005366 Bacteria 3170
20 Ga0070709_10004443 3300005434 Bacteria 7566
21 Ga0070714_100022564 3300005435 Bacteria 5161
22 Ga0070713_100001422 3300005436 Bacteria 15343
23 Ga0070713_100110553 3300005436 Bacteria 2396
24 Ga0070708_100001834 3300005445 Bacteria 16291
25 Ga0070708_100007696 3300005445 Bacteria 8634
26 Ga0070678_100081238 3300005456 Bacteria 2457
27 Ga0070697_100118593 3300005536 Bacteria 2212
28 Ga0068855_100011725 3300005563 Bacteria 10595
29 Ga0068855_100194275 3300005563 Bacteria 2287
30 Ga0068854_100035656 3300005578 Bacteria 3483
31 Ga0068852_100014423 3300005616 Bacteria 6085
32 Ga0068863_100030031 3300005841 Bacteria 5192
33 Ga0081455_10007507 3300005937 Bacteria 11471
34 Ga0070717_10004775 3300006028 Bacteria 9853
35 Ga0075362_10013238 3300006177 Bacteria 3298
36 Ga0075369_10007883 3300006186 Bacteria 4076
37 Ga0075366_10007792 3300006195 Bacteria 5928
38 Ga0075370_10006654 3300006353 Bacteria 5830
39 Ga0075431_100138590 3300006847 Bacteria 2508
40 Ga0105240_10003684 3300009093 Bacteria 23694
41 Ga0105240_10004081 3300009093 Bacteria 22462
42 Ga0105240_10155767 3300009093 Bacteria 2717
43 Ga0111539_10170452 3300009094 Bacteria 2543
44 Ga0105243_10058309 3300009148 Bacteria 3077
45 Ga0105237_10002476 3300009545 Bacteria 22919
46 Ga0105238_10005099 3300009551 Bacteria 12985
47 Ga0123341_1000005 3300009765 Bacteria 150422
48 Ga0099796_10001936 3300010159 Bacteria 4389
49 Ga0105239_10003906 3300010375 Bacteria 18071
50 Ga0157370_10000496 3300013104 Bacteria 48992
51 Ga0157369_10071465 3300013105 Bacteria 3725
52 Ga0157372_10040321 3300013307 Bacteria 5157
53 Ga0182005_1004282 3300015265 Bacteria 4649
54 Ga0213872_10001289 3300021361 Bacteria 16736
55 Ga0213876_10004542 3300021384 Bacteria 7751
56 Ga0213876_10014524 3300021384 Unclassified 4172
57 Ga0209148_1000946 3300025254 Bacteria 19054
58 Ga0209759_1000660 3300025256 Bacteria 31995
59 Ga0209129_1001120 3300025258 Bacteria 15568
60 Ga0209455_1000370 3300025272 Bacteria 41453
61 Ga0209455_1000453 3300025272 Bacteria 31372
62 Ga0209673_1000433 3300025273 Bacteria 72554
63 Ga0209673_1001482 3300025273 Bacteria 21938
64 Ga0209025_1000081 3300025294 Bacteria 265899
65 Ga0209564_1012276 3300025295 Bacteria 3749
66 Ga0209758_1000076 3300025297 Bacteria 270615
67 Ga0209758_1020268 3300025297 Bacteria 3155
68 Ga0209050_1008254 3300025298 Bacteria 5613
69 Ga0209256_1001407 3300025299 Bacteria 25000
70 Ga0207426_1000169 3300025302 Bacteria 164859
71 Ga0209051_1000038 3300025303 Bacteria 320926
72 Ga0209051_1001306 3300025303 Bacteria 21908
73 Ga0209051_1002319 3300025303 Bacteria 13843
74 Ga0209051_1011188 3300025303 Bacteria 4453
75 Ga0209257_1010924 3300025304 Bacteria 4480
76 Ga0207692_10009601 3300025898 Bacteria 4047
77 Ga0207699_10004297 3300025906 Bacteria 6814
78 Ga0207705_10000357 3300025909 Bacteria 41431
79 Ga0207695_10049350 3300025913 Bacteria 4438
80 Ga0207693_10027124 3300025915 Bacteria 4529
81 Ga0207663_10005793 3300025916 Bacteria 6258
82 Ga0207646_10007929 3300025922 Bacteria 10717
83 Ga0207646_10101361 3300025922 Bacteria 2581
84 Ga0207681_10004464 3300025923 Bacteria 8609
85 Ga0207694_10006104 3300025924 Bacteria 9213
86 Ga0207700_10005161 3300025928 Bacteria 7775
87 Ga0207700_10091718 3300025928 Bacteria 2400
88 Ga0207665_10009797 3300025939 Bacteria 6290
89 Ga0207667_10002975 3300025949 Bacteria 21053
90 Ga0207674_10049163 3300026116 Bacteria 4314
91 Ga0265334_10004780 3300028573 Bacteria 5952
92 Ga0265338_10016007 3300028800 Bacteria 8195
93 Ga0265338_10042210 3300028800 Bacteria 4252
94 Ga0265770_1002247 3300030878 Bacteria 2628
95 Ga0265339_10071259 3300031249 Bacteria 1852
96 Ga0307509_10080320 3300031507 Bacteria 3373
97 Ga0265313_10000419 3300031595 Bacteria 45369
98 Ga0265313_10004678 3300031595 Bacteria 10336
99 Ga0265314_10074917 3300031711 Bacteria 2253
100 Ga0265342_10049055 3300031712 Bacteria 2528
101 Ga0307516_10000499 3300031730 Bacteria 52269
102 Ga0373931_0000600 3300035691 Bacteria 14883
103 Ga0373925_0004362 3300037068 Bacteria 10699
104 Ga0395899_0000038 3300037312 Bacteria 272627
105 Ga0395900_0000030 3300037418 Bacteria 272630
106 Ga0395900_0116767 3300037418 Bacteria 2738
107 Ga0395900_0281126 3300037418 Bacteria 1656
108 Ga0395898_0000409 3300037466 Bacteria 92805
109 Ga0395898_0005732 3300037466 Bacteria 13373
110 Ga0395898_0053683 3300037466 Bacteria 3936
111 Ga0395905_0000012 3300037471 Bacteria 420861
112 Ga0436364_0400233 3300037853 Bacteria 17156
113 Ga0395901_0000002 3300038443 Bacteria 761045
114 Ga0395901_0000079 3300038443 Bacteria 134462
115 Ga0395901_0000529 3300038443 Bacteria 43995
116 Ga0395901_0055284 3300038443 Bacteria 4128
117 Ga0395901_0063694 3300038443 Bacteria 3838
118 Ga0436365_0198308 3300039437 Bacteria 10494
119 Ga0436365_1073202 3300039437 Bacteria 1717
120 Ga0436365_1243132 3300039437 Bacteria 1590
121 Ga0436361_0499901 3300039447 Bacteria 5501
122 Ga0436361_0531594 3300039447 Bacteria 4029
123 Ga0436363_0014397 3300039450 Bacteria 20368
124 Ga0439465_0005285 3300041413 Bacteria 4130
125 Ga0451833_0153633 3300041491 Bacteria 2838
126 Ga0451845_0019269 3300041501 Bacteria 1972
127 Ga0451843_0580228 3300041509 Bacteria 2412
128 Ga0466969_0000683 3300044656 Bacteria 18470
129 Ga0466969_0005259 3300044656 Bacteria 6893
130 Ga0466972_0014545 3300044658 Bacteria 3941
131 Ga0466965_0003152 3300044683 Bacteria 7195
132 Ga0466965_0005846 3300044683 Bacteria 5551
133 Ga0466966_0003476 3300044684 Bacteria 10378
134 Ga0466966_0037888 3300044684 Bacteria 3107
135 Ga0466961_0000736 3300044693 Bacteria 20526
136 Ga0466961_0009462 3300044693 Bacteria 6205
137 Ga0466964_0010655 3300044706 Bacteria 3468
138 Ga0466971_0008094 3300044719 Bacteria 4584
139 Ga0466968_0012507 3300044735 Bacteria 3325
140 Ga0466970_0046962 3300044765 Bacteria 2300
141 Ga0466957_0013601 3300044842 Bacteria 4723
142 Ga0466957_0081396 3300044842 Bacteria 2016
143 Ga0466959_0002548 3300045049 Bacteria 11689
144 Ga0466959_0067242 3300045049 Bacteria 2598
145 Ga0466967_0077046 3300045976 Bacteria 3001
146 Ga0495638_0000210 3300046460 Bacteria 82776
147 Ga0495650_0004672 3300046471 Bacteria 9247
148 Ga0495585_0057746 3300046492 Bacteria 2141
149 Ga0495607_0005906 3300046501 Bacteria 8684
150 Ga0495607_0018198 3300046501 Bacteria 4485
151 Ga0495583_0000324 3300046506 Bacteria 75413
152 Ga0495606_0000487 3300046507 Bacteria 64941
153 Ga0495606_0000514 3300046507 Bacteria 62799
154 Ga0495606_0003217 3300046507 Bacteria 17584
155 Ga0495606_0004903 3300046507 Bacteria 13099
156 Ga0495606_0022036 3300046507 Bacteria 4655
157 Ga0495616_0036702 3300046513 Bacteria 2528
158 Ga0495616_0055882 3300046513 Bacteria 1952
159 Ga0495620_0006672 3300046515 Bacteria 6325
160 Ga0495631_0019916 3300046518 Bacteria 3140
161 Ga0495648_0001262 3300046524 Bacteria 25238
162 Ga0495648_0003148 3300046524 Bacteria 14683
163 Ga0495654_0036249 3300046530 Bacteria 2480
164 Ga0495597_0005731 3300046542 Bacteria 6525
165 Ga0495645_0075405 3300046543 Bacteria 2427
166 Ga0495633_0067260 3300046558 Bacteria 1673
167 Ga0495625_0034077 3300046660 Bacteria 3759
168 Ga0495649_0000207 3300046694 Bacteria 51510
169 Ga0495660_0033511 3300046810 Bacteria 2879
170 Ga0495672_0004036 3300047320 Bacteria 12270
171 Ga0495672_0034622 3300047320 Bacteria 3118
172 Ga0495687_021267 3300047443 Bacteria 3143
173 Ga0496107_0070969 3300048910 Bacteria 2530
174 Ga0496112_0000045 3300048915 Bacteria 85873
175 Ga0496121_0000894 3300048924 Bacteria 53831
176 Ga0496121_0029812 3300048924 Bacteria 5030
177 Ga0496126_0005477 3300048929 Bacteria 14469
178 Ga0501044_0000062 3300049823 Bacteria 131395
179 Ga0500635_0001455 3300053080 Bacteria 5687
180 Ga0500651_0054698 3300053093 Bacteria 2500
181 Ga0500594_0008437 3300053118 Bacteria 2350
182 Ga0500618_001197 3300053125 Bacteria 12455
183 Ga0500618_001939 3300053125 Bacteria 8496
184 Ga0500658_0000486 3300053134 Bacteria 16965
185 Ga0500568_0000173 3300053139 Bacteria 56326
186 Ga0500616_0004741 3300053153 Bacteria 9563
187 Ga0500616_0006634 3300053153 Bacteria 7534
188 Ga0466962_0007810 3300061719 Bacteria 5128
189 Ga0530510_0063975 3300061734 Bacteria 2664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10006962 Ga0070658_100069627 408
2 3300005563 Ga0068855_100011725 Ga0068855_10001172510 408
3 3300009093 Ga0105240_10155767 Ga0105240_101557672 408
4 3300013104 Ga0157370_10000496 Ga0157370_1000049624 408
5 3300025909 Ga0207705_10000357 Ga0207705_1000035729 408
6 3300025949 Ga0207667_10002975 Ga0207667_100029755 408
7 3300038443 Ga0395901_0000079 Ga0395901_0000079_62134_63684 409
8 3300037312 Ga0395899_0000038 Ga0395899_0000038_116585_118135 415
9 3300037418 Ga0395900_0000030 Ga0395900_0000030_154504_156054 415
10 3300037466 Ga0395898_0000409 Ga0395898_0000409_14965_16515 415
11 3300037418 Ga0395900_0116767 Ga0395900_0116767_604_2154 419
12 3300037466 Ga0395898_0005732 Ga0395898_0005732_10812_12362 419
13 3300038443 Ga0395901_0000529 Ga0395901_0000529_276_1826 419
14 3300038443 Ga0395901_0000002 Ga0395901_0000002_642590_644140 424
15 3300028573 Ga0265334_10004780 Ga0265334_100047802 425
16 3300028800 Ga0265338_10042210 Ga0265338_100422103 425
17 3300031595 Ga0265313_10004678 Ga0265313_100046782 425
18 3300053125 Ga0500618_001939 Ga0500618_001939_4264_5814 429
19 3300061734 Ga0530510_0063975 Ga0530510_0063975_185_1690 430
20 3300025254 Ga0209148_1000946 Ga0209148_100094613 431
21 3300025272 Ga0209455_1000370 Ga0209455_100037025 431
22 3300005937 Ga0081455_10007507 Ga0081455_1000750714 437
23 3300031249 Ga0265339_10071259 Ga0265339_100712591 439
24 3300031595 Ga0265313_10000419 Ga0265313_1000041944 439
25 3300031711 Ga0265314_10074917 Ga0265314_100749171 439
26 3300031712 Ga0265342_10049055 Ga0265342_100490553 439
27 3300053093 Ga0500651_0054698 Ga0500651_0054698_446_1927 439
28 3300053118 Ga0500594_0008437 Ga0500594_0008437_456_1937 439
29 3300005445 Ga0070708_100007696 Ga0070708_1000076966 441
30 3300025922 Ga0207646_10007929 Ga0207646_1000792912 441
31 3300028800 Ga0265338_10016007 Ga0265338_100160072 441
32 3300037471 Ga0395905_0000012 Ga0395905_0000012_82610_84160 443
33 iso_pu_bacteria 2738541299 2738839560 443
34 iso_pu_bacteria 2738543010 2739234233 443
35 iso_pu_bacteria 2956897341 2956899047 443
36 iso_pu_bacteria 8022792930 8022798941 443
37 3300025295 Ga0209564_1012276 Ga0209564_10122763 444
38 3300026116 Ga0207674_10049163 Ga0207674_100491631 446
39 3300045049 Ga0466959_0002548 Ga0466959_0002548_8392_9912 446
40 3300053125 Ga0500618_001197 Ga0500618_001197_8953_10509 446
41 3300046507 Ga0495606_0000514 Ga0495606_0000514_16614_18101 448
42 3300030878 Ga0265770_1002247 Ga0265770_10022472 449
43 3300044656 Ga0466969_0000683 Ga0466969_0000683_3094_4614 450
44 3300044683 Ga0466965_0003152 Ga0466965_0003152_1766_3286 450
45 3300044693 Ga0466961_0000736 Ga0466961_0000736_9661_11181 450
46 3300046471 Ga0495650_0004672 Ga0495650_0004672_2844_4340 450
47 3300003763 Ga0055529_1001826 Ga0055529_10018264 451
48 3300025272 Ga0209455_1000453 Ga0209455_100045313 451
49 3300046506 Ga0495583_0000324 Ga0495583_0000324_55423_56922 451
50 3300046507 Ga0495606_0000487 Ga0495606_0000487_54418_55917 451
51 3300046694 Ga0495649_0000207 Ga0495649_0000207_29341_30840 451
52 3300049823 Ga0501044_0000062 Ga0501044_0000062_116048_117523 451
53 3300006028 Ga0070717_10004775 Ga0070717_1000477511 452
54 3300046524 Ga0495648_0001262 Ga0495648_0001262_3179_4684 453
55 3300048924 Ga0496121_0029812 Ga0496121_0029812_387_1892 453
56 3300037068 Ga0373925_0004362 Ga0373925_0004362_6737_8395 454
57 3300048910 Ga0496107_0070969 Ga0496107_0070969_111_1601 454
58 3300048924 Ga0496121_0000894 Ga0496121_0000894_13617_15107 454
59 3300048929 Ga0496126_0005477 Ga0496126_0005477_6200_7690 454
60 iso_pu_bacteria 2904434214 2904436961 455
61 3300005331 Ga0070670_100000017 Ga0070670_1000000173 456
62 3300005353 Ga0070669_100004123 Ga0070669_10000412311 456
63 3300025923 Ga0207681_10004464 Ga0207681_100044642 456
64 3300005841 Ga0068863_100030031 Ga0068863_1000300313 457
65 3300009148 Ga0105243_10058309 Ga0105243_100583092 457
66 3300009551 Ga0105238_10005099 Ga0105238_100050999 457
67 3300025303 Ga0209051_1001306 Ga0209051_10013068 457
68 3300025924 Ga0207694_10006104 Ga0207694_100061045 457
69 3300031507 Ga0307509_10080320 Ga0307509_100803202 457
70 3300002987 JGI25159J45721_1000839 JGI25159J45721_10008398 458
71 3300003354 JGI25160J50197_1000046 JGI25160J50197_100004618 458
72 3300003374 JGI25161J50226_1000031 JGI25161J50226_100003118 458
73 3300004625 Ga0055543_1000278 Ga0055543_100027817 458
74 3300005262 Ga0065165_1000693 Ga0065165_100069319 458
75 3300005578 Ga0068854_100035656 Ga0068854_1000356563 458
76 3300005616 Ga0068852_100014423 Ga0068852_1000144233 458
77 3300009093 Ga0105240_10003684 Ga0105240_1000368414 458
78 3300009093 Ga0105240_10004081 Ga0105240_100040813 458
79 3300009545 Ga0105237_10002476 Ga0105237_1000247616 458
80 3300010375 Ga0105239_10003906 Ga0105239_100039063 458
81 3300013105 Ga0157369_10071465 Ga0157369_100714654 458
82 3300013307 Ga0157372_10040321 Ga0157372_100403213 458
83 3300015265 Ga0182005_1004282 Ga0182005_10042823 458
84 3300021361 Ga0213872_10001289 Ga0213872_100012899 458
85 3300025913 Ga0207695_10049350 Ga0207695_100493503 458
86 3300038443 Ga0395901_0055284 Ga0395901_0055284_2233_3723 458
87 3300039447 Ga0436361_0499901 Ga0436361_0499901_3666_5192 458
88 3300044658 Ga0466972_0014545 Ga0466972_0014545_2202_3701 458
89 3300044684 Ga0466966_0037888 Ga0466966_0037888_396_1895 458
90 3300044842 Ga0466957_0081396 Ga0466957_0081396_247_1746 458
91 3300045049 Ga0466959_0067242 Ga0466959_0067242_524_2023 458
92 3300045976 Ga0466967_0077046 Ga0466967_0077046_933_2432 458
93 3300046460 Ga0495638_0000210 Ga0495638_0000210_7753_9234 458
94 3300046492 Ga0495585_0057746 Ga0495585_0057746_133_1614 458
95 3300046513 Ga0495616_0036702 Ga0495616_0036702_24_1523 458
96 3300046513 Ga0495616_0055882 Ga0495616_0055882_237_1718 458
97 3300046518 Ga0495631_0019916 Ga0495631_0019916_28_1509 458
98 3300046530 Ga0495654_0036249 Ga0495654_0036249_547_2028 458
99 3300046660 Ga0495625_0034077 Ga0495625_0034077_391_1872 458
100 3300047320 Ga0495672_0034622 Ga0495672_0034622_1560_3041 458
101 3300048915 Ga0496112_0000045 Ga0496112_0000045_41056_42540 458
102 3300053139 Ga0500568_0000173 Ga0500568_0000173_46933_48414 458
103 3300053153 Ga0500616_0006634 Ga0500616_0006634_719_2200 458
104 3300009094 Ga0111539_10170452 Ga0111539_101704521 459
105 3300025303 Ga0209051_1002319 Ga0209051_100231917 459
106 3300037466 Ga0395898_0053683 Ga0395898_0053683_1528_3024 459
107 3300038443 Ga0395901_0063694 Ga0395901_0063694_1518_3014 459
108 3300005445 Ga0070708_100001834 Ga0070708_1000018347 460
109 3300031730 Ga0307516_10000499 Ga0307516_1000049932 460
110 3300035691 Ga0373931_0000600 Ga0373931_0000600_633_2126 460
111 3300053080 Ga0500635_0001455 Ga0500635_0001455_26_1528 460
112 3300046501 Ga0495607_0005906 Ga0495607_0005906_5864_7408 461
113 3300047443 Ga0495687_021267 Ga0495687_021267_1302_2846 461
114 3300005366 Ga0070659_100053754 Ga0070659_1000537544 462
115 3300005563 Ga0068855_100194275 Ga0068855_1001942752 462
116 3300025256 Ga0209759_1000660 Ga0209759_100066028 462
117 3300046507 Ga0495606_0004903 Ga0495606_0004903_9980_11473 462
118 3300047320 Ga0495672_0004036 Ga0495672_0004036_2921_4414 462
119 3300003792 Ga0055540_1002392 Ga0055540_10023925 463
120 3300021384 Ga0213876_10014524 Ga0213876_100145243 463
121 3300025303 Ga0209051_1011188 Ga0209051_10111885 463
122 3300037418 Ga0395900_0281126 Ga0395900_0281126_72_1562 463
123 3300037853 Ga0436364_0400233 Ga0436364_0400233_1560_3068 463
124 3300039437 Ga0436365_0198308 Ga0436365_0198308_4046_5551 463
125 3300005436 Ga0070713_100001422 Ga0070713_1000014228 464
126 3300010159 Ga0099796_10001936 Ga0099796_100019364 464
127 3300025928 Ga0207700_10005161 Ga0207700_100051614 464
128 iso_pu_bacteria 8057568493 8057575066 465
129 iso_pu_bacteria 2889306138 2889308757 466
130 iso_pu_bacteria 2902330777 2902332919 466
131 3300046524 Ga0495648_0003148 Ga0495648_0003148_5519_7063 467
132 iso_pu_bacteria 2508501128 2509151255 467
133 iso_pu_bacteria 2513237141 2513887919 467
134 iso_pu_bacteria 2791355197 2793068036 467
135 3300005536 Ga0070697_100118593 Ga0070697_1001185932 469
136 3300025922 Ga0207646_10101361 Ga0207646_101013612 469
137 3300039437 Ga0436365_1243132 Ga0436365_1243132_22_1563 469
138 3300039450 Ga0436363_0014397 Ga0436363_0014397_8555_10096 469
139 3300046501 Ga0495607_0018198 Ga0495607_0018198_409_1917 469
140 3300046507 Ga0495606_0022036 Ga0495606_0022036_1540_3048 469
141 3300005434 Ga0070709_10004443 Ga0070709_100044431 470
142 3300005435 Ga0070714_100022564 Ga0070714_1000225642 470
143 3300005436 Ga0070713_100110553 Ga0070713_1001105532 470
144 3300005456 Ga0070678_100081238 Ga0070678_1000812383 470
145 3300006847 Ga0075431_100138590 Ga0075431_1001385902 470
146 3300025898 Ga0207692_10009601 Ga0207692_100096014 470
147 3300025906 Ga0207699_10004297 Ga0207699_100042974 470
148 3300025915 Ga0207693_10027124 Ga0207693_100271242 470
149 3300025916 Ga0207663_10005793 Ga0207663_100057933 470
150 3300025928 Ga0207700_10091718 Ga0207700_100917182 470
151 3300025939 Ga0207665_10009797 Ga0207665_100097975 470
152 3300039447 Ga0436361_0531594 Ga0436361_0531594_465_1985 470
153 3300041413 Ga0439465_0005285 Ga0439465_0005285_627_2102 470
154 3300046543 Ga0495645_0075405 Ga0495645_0075405_75_1571 470
155 3300002773 JGI25152J39213_1006627 JGI25152J39213_10066272 471
156 3300003187 JGI25151J46595_10000337 JGI25151J46595_1000033712 471
157 3300003215 JGI25153J46596_10008960 JGI25153J46596_100089601 471
158 3300003771 Ga0055526_1004003 Ga0055526_10040037 471
159 3300003775 Ga0055524_1000875 Ga0055524_100087514 471
160 3300003790 Ga0055528_1008651 Ga0055528_10086512 471
161 3300003792 Ga0055540_1000066 Ga0055540_1000066101 471
162 3300004625 Ga0055543_1002439 Ga0055543_10024394 471
163 3300006177 Ga0075362_10013238 Ga0075362_100132382 471
164 3300006186 Ga0075369_10007883 Ga0075369_100078832 471
165 3300006195 Ga0075366_10007792 Ga0075366_100077923 471
166 3300006353 Ga0075370_10006654 Ga0075370_100066542 471
167 3300009765 Ga0123341_1000005 Ga0123341_100000540 471
168 3300021384 Ga0213876_10004542 Ga0213876_100045423 471
169 3300025258 Ga0209129_1001120 Ga0209129_10011209 471
170 3300025273 Ga0209673_1000433 Ga0209673_100043316 471
171 3300025273 Ga0209673_1001482 Ga0209673_100148210 471
172 3300025294 Ga0209025_1000081 Ga0209025_100008147 471
173 3300025297 Ga0209758_1000076 Ga0209758_100007629 471
174 3300025297 Ga0209758_1020268 Ga0209758_10202682 471
175 3300025298 Ga0209050_1008254 Ga0209050_10082544 471
176 3300025299 Ga0209256_1001407 Ga0209256_10014072 471
177 3300025302 Ga0207426_1000169 Ga0207426_1000169108 471
178 3300025303 Ga0209051_1000038 Ga0209051_100003854 471
179 3300025304 Ga0209257_1010924 Ga0209257_10109242 471
180 3300039437 Ga0436365_1073202 Ga0436365_1073202_140_1639 471
181 3300041491 Ga0451833_0153633 Ga0451833_0153633_409_1884 471
182 3300041501 Ga0451845_0019269 Ga0451845_0019269_430_1905 471
183 3300041509 Ga0451843_0580228 Ga0451843_0580228_661_2136 471
184 3300044656 Ga0466969_0005259 Ga0466969_0005259_1844_3343 471
185 3300044683 Ga0466965_0005846 Ga0466965_0005846_1389_2888 471
186 3300044684 Ga0466966_0003476 Ga0466966_0003476_2923_4422 471
187 3300044693 Ga0466961_0009462 Ga0466961_0009462_1044_2543 471
188 3300044706 Ga0466964_0010655 Ga0466964_0010655_471_1970 471
189 3300044719 Ga0466971_0008094 Ga0466971_0008094_1762_3261 471
190 3300044735 Ga0466968_0012507 Ga0466968_0012507_137_1636 471
191 3300044765 Ga0466970_0046962 Ga0466970_0046962_708_2207 471
192 3300044842 Ga0466957_0013601 Ga0466957_0013601_1557_3056 471
193 3300046507 Ga0495606_0003217 Ga0495606_0003217_11157_12632 471
194 3300046515 Ga0495620_0006672 Ga0495620_0006672_2412_3887 471
195 3300046542 Ga0495597_0005731 Ga0495597_0005731_2640_4115 471
196 3300046558 Ga0495633_0067260 Ga0495633_0067260_14_1489 471
197 3300046810 Ga0495660_0033511 Ga0495660_0033511_942_2417 471
198 3300053134 Ga0500658_0000486 Ga0500658_0000486_295_1770 471
199 3300053153 Ga0500616_0004741 Ga0500616_0004741_5375_6850 471
200 3300061719 Ga0466962_0007810 Ga0466962_0007810_1825_3324 471

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00474

SSF

Sodium:solute symporter family

43

447

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hez-assembly1.cif.gz_A structure of human sglt2-map17 complex with dapagliflozin 0.7677 6 464
8hg7-assembly1.cif.gz_A structure of human sglt2-map17 complex with sotagliflozin 0.7676 6 467
7vsi-assembly1.cif.gz_A structure of human sglt2-map17 complex bound with empagliflozin 0.7547 6 469
8hg7-assembly1.cif.gz_A structure of human sglt2-map17 complex with sotagliflozin 0.7528 6 467
8hdh-assembly1.cif.gz_A structure of human sglt2-map17 complex with canagliflozin 0.7508 6 468
ID Description Score Start End Superfamily
af_F1LWL8_3_419_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8135 115 467 1.20.1730.10
af_Q1EHB4_32_596_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8133 37 466 1.20.1730.10
af_P16256_31_481_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8052 39 471 1.20.1730.10
af_Q9W3R0_60_567_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.7956 42 462 1.20.1730.10
af_P07117_23_496_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.7923 26 467 1.20.1730.10
ID Description Score Start End GO Terms
AF-A0A4Q6DYR5-F1-model_v4 Sodium:solute symporter 0.9446 166 462 GO:0005886
GO:0022857
AF-A0A1Q7T770-F1-model_v4 Sodium:solute symporter 0.9217 106 462 GO:0005886
GO:0022857
AF-A0A535H878-F1-model_v4 Sodium:solute symporter 0.9173 94 462 GO:0005886
GO:0022857
AF-I4EV92-F1-model_v4 Na+:solute symporter 0.9121 6 409 GO:0005886
GO:0022857
AF-A0A7Y3KF74-F1-model_v4 deleted 0.8999 9 471

Feature Viewer

pLDDT pTM Quality
77.76 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map