F306924

General Info

Members Datasets Scaffolds Average Seq Length
200 127 400 206

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_101016889|Ga0068861_1010168891
Length 223
Sequence METPMLTALTGLAAGLFHVLSGPDHLAAVAPLAAADRDRGWFAGWTWGIGHASGVVVVAVIAILLRDVLPQIDAISAWGERLVGAALIAIGFWALRRSLVVAPRPHAHGKVAHDHVHVQRGPAWMRRLGHAHASFYMGILHGVAGSSHFFGVLPALALPSRAAALTYIAAFGAGTVAAMTAFAAVVGSVGVHLHPGTRAHRGMMLTAATLAFAVGGWWLVVGA

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
107 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
108 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
109 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
125 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
126 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
127 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.5
Rhizosphere 99.5
Stem 0
Stem Tuber 0
Unclassified 5.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_101016889 3300005719 Bacteria 792
2 MBSR1b_contig_2446487 2162886012 Bacteria 1056
3 JGI24746J21847_1001404 3300001977 Bacteria 3840
4 Ga0065712_10157458 3300005290 Bacteria 1313
5 Ga0065715_10090199 3300005293 Bacteria 7429
6 Ga0070676_10025464 3300005328 Bacteria 3344
7 Ga0070676_10350534 3300005328 Bacteria 1015
8 Ga0070683_100765282 3300005329 Unclassified 925
9 Ga0070670_100106678 3300005331 Bacteria 2414
10 Ga0070670_100144566 3300005331 Bacteria 2057
11 Ga0070670_100242008 3300005331 Bacteria 1571
12 Ga0068869_100019019 3300005334 Bacteria 4685
13 Ga0068869_100786305 3300005334 Bacteria 817
14 Ga0070660_100242246 3300005339 Bacteria 1469
15 Ga0070660_100604709 3300005339 Bacteria 917
16 Ga0070689_100217045 3300005340 Bacteria 1568
17 Ga0070689_100220267 3300005340 Bacteria 1556
18 Ga0070687_100004466 3300005343 Bacteria 5582
19 Ga0070687_100131352 3300005343 Bacteria 1446
20 Ga0070668_100124970 3300005347 Bacteria 2060
21 Ga0070669_100008866 3300005353 Bacteria 7176
22 Ga0070669_100053661 3300005353 Bacteria 2951
23 Ga0070669_100172195 3300005353 Bacteria 1688
24 Ga0070675_100148411 3300005354 Bacteria 2009
25 Ga0070671_100160886 3300005355 Bacteria 1898
26 Ga0070671_100368247 3300005355 Bacteria 1227
27 Ga0070674_100104107 3300005356 Bacteria 2073
28 Ga0070673_100139179 3300005364 Bacteria 2046
29 Ga0070673_100269753 3300005364 Bacteria 1489
30 Ga0070673_100289625 3300005364 Bacteria 1439
31 Ga0070673_100753293 3300005364 Bacteria 897
32 Ga0070688_100001290 3300005365 Bacteria 12484
33 Ga0070688_100046614 3300005365 Bacteria 2685
34 Ga0070667_100019299 3300005367 Bacteria 5656
35 Ga0070667_100219748 3300005367 Bacteria 1691
36 Ga0070701_10517375 3300005438 Bacteria 777
37 Ga0070700_100149093 3300005441 Bacteria 1598
38 Ga0070700_100333461 3300005441 Bacteria 1119
39 Ga0070694_100091825 3300005444 Bacteria 2132
40 Ga0070678_100018581 3300005456 Bacteria 4507
41 Ga0070678_100034023 3300005456 Bacteria 3545
42 Ga0068867_100167626 3300005459 Bacteria 1737
43 Ga0070685_10006586 3300005466 Bacteria 5924
44 Ga0070698_100264428 3300005471 Bacteria 1652
45 Ga0070699_100020965 3300005518 Bacteria 5635
46 Ga0070672_100011628 3300005543 Bacteria 6142
47 Ga0070672_100026665 3300005543 Unclassified 4304
48 Ga0070686_100003602 3300005544 Bacteria 8497
49 Ga0070686_100806500 3300005544 Bacteria 757
50 Ga0070665_100052359 3300005548 Bacteria 4094
51 Ga0070664_100002655 3300005564 Bacteria 14420
52 Ga0070664_100842652 3300005564 Bacteria 858
53 Ga0068857_100749390 3300005577 Bacteria 930
54 Ga0068854_100149068 3300005578 Bacteria 1802
55 Ga0068859_100048623 3300005617 Bacteria 4260
56 Ga0068859_100244993 3300005617 Bacteria 1882
57 Ga0068861_100015121 3300005719 Bacteria 5431
58 Ga0068870_10024438 3300005840 Bacteria 2990
59 Ga0068863_100010642 3300005841 Bacteria 8930
60 Ga0068863_100068165 3300005841 Bacteria 3366
61 Ga0068858_100016869 3300005842 Bacteria 6857
62 Ga0068862_100123643 3300005844 Bacteria 2283
63 Ga0081539_10002408 3300005985 Bacteria 26503
64 Ga0068871_100968740 3300006358 Bacteria 791
65 Ga0075428_100004294 3300006844 Bacteria 15696
66 Ga0075428_100014045 3300006844 Bacteria 8912
67 Ga0075428_100196356 3300006844 Bacteria 2182
68 Ga0075430_100681840 3300006846 Bacteria 847
69 Ga0075431_100395852 3300006847 Bacteria 1383
70 Ga0075431_100488459 3300006847 Bacteria 1223
71 Ga0075433_10002563 3300006852 Bacteria 13835
72 Ga0075433_10315251 3300006852 Bacteria 1384
73 Ga0075434_100056622 3300006871 Bacteria 3896
74 Ga0075434_100072771 3300006871 Bacteria 3429
75 Ga0075429_100066931 3300006880 Bacteria 3127
76 Ga0097620_100048624 3300006931 Bacteria 4260
77 Ga0097620_100244993 3300006931 Bacteria 1882
78 Ga0111539_10002871 3300009094 Bacteria 22878
79 Ga0111539_10017689 3300009094 Bacteria 8824
80 Ga0111539_10275120 3300009094 Unclassified 1959
81 Ga0114129_10091402 3300009147 Bacteria 4217
82 Ga0114129_10133793 3300009147 Bacteria 3404
83 Ga0114129_10675623 3300009147 Bacteria 1330
84 Ga0105248_10080645 3300009177 Bacteria 3658
85 Ga0105248_10879067 3300009177 Bacteria 1012
86 Ga0157374_10110637 3300013296 Bacteria 2642
87 Ga0163162_10006320 3300013306 Bacteria 11473
88 Ga0163162_10716434 3300013306 Bacteria 1121
89 Ga0157375_10321674 3300013308 Bacteria 1711
90 Ga0157375_10765556 3300013308 Bacteria 1116
91 Ga0157380_10001788 3300014326 Bacteria 14197
92 Ga0157380_10330732 3300014326 Bacteria 1417
93 Ga0157380_10499752 3300014326 Bacteria 1181
94 Ga0157377_10003051 3300014745 Bacteria 7509
95 Ga0157379_10201538 3300014968 Bacteria 1800
96 Ga0157376_10014122 3300014969 Bacteria 5982
97 Ga0157376_10110301 3300014969 Bacteria 2420
98 Ga0163161_10004534 3300017792 Bacteria 9666
99 Ga0163161_10523775 3300017792 Bacteria 968
100 Ga0207697_10000862 3300025315 Bacteria 17181
101 Ga0207682_10001500 3300025893 Bacteria 10777
102 Ga0207680_10022261 3300025903 Bacteria 3443
103 Ga0207647_10132785 3300025904 Bacteria 1462
104 Ga0207645_10001978 3300025907 Bacteria 16464
105 Ga0207643_10003027 3300025908 Bacteria 9044
106 Ga0207662_10023005 3300025918 Bacteria 3576
107 Ga0207657_10498193 3300025919 Bacteria 954
108 Ga0207649_10025161 3300025920 Bacteria 3468
109 Ga0207646_10054050 3300025922 Bacteria 3593
110 Ga0207681_10053984 3300025923 Bacteria 2730
111 Ga0207681_10414002 3300025923 Bacteria 1091
112 Ga0207681_10793737 3300025923 Unclassified 791
113 Ga0207650_10107621 3300025925 Bacteria 2154
114 Ga0207650_10314099 3300025925 Bacteria 1282
115 Ga0207659_10023813 3300025926 Bacteria 4093
116 Ga0207644_10167433 3300025931 Bacteria 1713
117 Ga0207706_10003430 3300025933 Bacteria 15140
118 Ga0207670_10013129 3300025936 Bacteria 4874
119 Ga0207670_10200121 3300025936 Bacteria 1517
120 Ga0207691_10129187 3300025940 Bacteria 2233
121 Ga0207711_10086238 3300025941 Unclassified 2752
122 Ga0207679_10007928 3300025945 Bacteria 6751
123 Ga0207651_10027462 3300025960 Bacteria 3574
124 Ga0207651_10041184 3300025960 Bacteria 3064
125 Ga0207651_10173559 3300025960 Bacteria 1703
126 Ga0207651_10230306 3300025960 Bacteria 1504
127 Ga0207651_10259041 3300025960 Bacteria 1427
128 Ga0207651_10721491 3300025960 Bacteria 879
129 Ga0207712_10413943 3300025961 Unclassified 1136
130 Ga0207640_10228167 3300025981 Bacteria 1430
131 Ga0207677_10389584 3300026023 Bacteria 1178
132 Ga0207708_10086290 3300026075 Bacteria 2415
133 Ga0207641_10005298 3300026088 Bacteria 11019
134 Ga0207641_10042870 3300026088 Bacteria 3798
135 Ga0207648_10421733 3300026089 Bacteria 1212
136 Ga0207675_100030495 3300026118 Bacteria 5023
137 Ga0207675_100417183 3300026118 Bacteria 1325
138 Ga0207683_10002309 3300026121 Bacteria 16723
139 Ga0207683_10068240 3300026121 Bacteria 3138
140 Ga0207683_10358438 3300026121 Bacteria 1339
141 Ga0209998_10051710 3300027717 Bacteria 952
142 Ga0209974_10036426 3300027876 Bacteria 1634
143 Ga0207428_10003038 3300027907 Bacteria 16518
144 Ga0268265_10819639 3300028380 Bacteria 908
145 Ga0307408_100802623 3300031548 Bacteria 854
146 Ga0307405_10076889 3300031731 Bacteria 2167
147 Ga0307413_10053151 3300031824 Bacteria 2451
148 Ga0307410_10036879 3300031852 Bacteria 3188
149 Ga0307410_10041952 3300031852 Bacteria 3020
150 Ga0307410_10044589 3300031852 Bacteria 2947
151 Ga0307410_10211360 3300031852 Bacteria 1487
152 Ga0307410_10690952 3300031852 Bacteria 859
153 Ga0307406_10161725 3300031901 Bacteria 1610
154 Ga0307406_10720212 3300031901 Bacteria 835
155 Ga0307412_10007400 3300031911 Bacteria 6228
156 Ga0307409_100580460 3300031995 Bacteria 1105
157 Ga0307409_100720022 3300031995 Bacteria 999
158 Ga0307409_101005039 3300031995 Bacteria 852
159 Ga0307416_100004324 3300032002 Bacteria 8538
160 Ga0307416_100079489 3300032002 Bacteria 2764
161 Ga0307416_100139933 3300032002 Bacteria 2198
162 Ga0307416_100228237 3300032002 Bacteria 1792
163 Ga0307416_100242110 3300032002 Bacteria 1749
164 Ga0307416_100270160 3300032002 Bacteria 1669
165 Ga0307416_101291041 3300032002 Bacteria 836
166 Ga0307411_10020275 3300032005 Bacteria 3862
167 Ga0307415_100019150 3300032126 Bacteria 4150
168 Ga0316583_10001227 3300032133 Bacteria 8440
169 Ga0373923_0115751 3300035111 Bacteria 1194
170 Ga0373956_0089123 3300035119 Bacteria 1422
171 Ga0373937_0016342 3300036401 Bacteria 6588
172 Ga0439453_0013621 3300041408 Bacteria 1385
173 Ga0450896_004069 3300042133 Bacteria 1970
174 Ga0450908_003817 3300042184 Unclassified 2917
175 Ga0439435_0021114 3300042436 Bacteria 1687
176 Ga0453684_0170233 3300044712 Bacteria 2568
177 Ga0495594_0283868 3300046499 Unclassified 943
178 Ga0495594_0425436 3300046499 Bacteria 755
179 Ga0495643_0004089 3300046522 Bacteria 10393
180 Ga0495621_0117745 3300046539 Bacteria 1024
181 Ga0495623_0108624 3300046679 Bacteria 1684
182 Ga0495636_0000331 3300047318 Bacteria 18132
183 Ga0496114_0831438 3300048917 Unclassified 803
184 nmdc:mga05p37_168552_c1 3300050507 Bacteria 2672
185 nmdc:mga05p37_43394_c1 3300050507 Bacteria 5532
186 nmdc:mga05p37_694743_c1 3300050507 Bacteria 1131
187 nmdc:mga0qj67_625996_c1 3300050509 Bacteria 860
188 nmdc:mga06r32_379256_c1 3300050510 Bacteria 1397
189 nmdc:mga08y16_131804_c1 3300050511 Unclassified 2599
190 nmdc:mga08y16_663560_c1 3300050511 Unclassified 1046
191 nmdc:mga08y16_918_c1 3300050511 Bacteria 28568
192 nmdc:mga0n895_1018379_c1 3300050512 Bacteria 809
193 nmdc:mga0n895_5588_c1 3300050512 Bacteria 10529
194 nmdc:mga0rr50_754074_c1 3300050513 Bacteria 831
195 nmdc:mga0a205_194_c1 3300050515 Bacteria 42199
196 nmdc:mga0a205_44471_c1 3300050515 Bacteria 4280
197 Ga0590071_000094 3300059421 Bacteria 24856
198 Ga0590074_000051 3300059423 Bacteria 11771
199 Ga0590075_000396 3300059424 Bacteria 11945
200 Ga0590077_000050 3300059426 Bacteria 27875
201 Ga0068861_101016889
202 MBSR1b_contig_2446487
203 JGI24746J21847_1001404
204 Ga0065712_10157458
205 Ga0065715_10090199
206 Ga0070676_10025464
207 Ga0070676_10350534
208 Ga0070683_100765282
209 Ga0070670_100106678
210 Ga0070670_100144566
211 Ga0070670_100242008
212 Ga0068869_100019019
213 Ga0068869_100786305
214 Ga0070660_100242246
215 Ga0070660_100604709
216 Ga0070689_100217045
217 Ga0070689_100220267
218 Ga0070687_100004466
219 Ga0070687_100131352
220 Ga0070668_100124970
221 Ga0070669_100008866
222 Ga0070669_100053661
223 Ga0070669_100172195
224 Ga0070675_100148411
225 Ga0070671_100160886
226 Ga0070671_100368247
227 Ga0070674_100104107
228 Ga0070673_100139179
229 Ga0070673_100269753
230 Ga0070673_100289625
231 Ga0070673_100753293
232 Ga0070688_100001290
233 Ga0070688_100046614
234 Ga0070667_100019299
235 Ga0070667_100219748
236 Ga0070701_10517375
237 Ga0070700_100149093
238 Ga0070700_100333461
239 Ga0070694_100091825
240 Ga0070678_100018581
241 Ga0070678_100034023
242 Ga0068867_100167626
243 Ga0070685_10006586
244 Ga0070698_100264428
245 Ga0070699_100020965
246 Ga0070672_100011628
247 Ga0070672_100026665
248 Ga0070686_100003602
249 Ga0070686_100806500
250 Ga0070665_100052359
251 Ga0070664_100002655
252 Ga0070664_100842652
253 Ga0068857_100749390
254 Ga0068854_100149068
255 Ga0068859_100048623
256 Ga0068859_100244993
257 Ga0068861_100015121
258 Ga0068870_10024438
259 Ga0068863_100010642
260 Ga0068863_100068165
261 Ga0068858_100016869
262 Ga0068862_100123643
263 Ga0081539_10002408
264 Ga0068871_100968740
265 Ga0075428_100004294
266 Ga0075428_100014045
267 Ga0075428_100196356
268 Ga0075430_100681840
269 Ga0075431_100395852
270 Ga0075431_100488459
271 Ga0075433_10002563
272 Ga0075433_10315251
273 Ga0075434_100056622
274 Ga0075434_100072771
275 Ga0075429_100066931
276 Ga0097620_100048624
277 Ga0097620_100244993
278 Ga0111539_10002871
279 Ga0111539_10017689
280 Ga0111539_10275120
281 Ga0114129_10091402
282 Ga0114129_10133793
283 Ga0114129_10675623
284 Ga0105248_10080645
285 Ga0105248_10879067
286 Ga0157374_10110637
287 Ga0163162_10006320
288 Ga0163162_10716434
289 Ga0157375_10321674
290 Ga0157375_10765556
291 Ga0157380_10001788
292 Ga0157380_10330732
293 Ga0157380_10499752
294 Ga0157377_10003051
295 Ga0157379_10201538
296 Ga0157376_10014122
297 Ga0157376_10110301
298 Ga0163161_10004534
299 Ga0163161_10523775
300 Ga0207697_10000862
301 Ga0207682_10001500
302 Ga0207680_10022261
303 Ga0207647_10132785
304 Ga0207645_10001978
305 Ga0207643_10003027
306 Ga0207662_10023005
307 Ga0207657_10498193
308 Ga0207649_10025161
309 Ga0207646_10054050
310 Ga0207681_10053984
311 Ga0207681_10414002
312 Ga0207681_10793737
313 Ga0207650_10107621
314 Ga0207650_10314099
315 Ga0207659_10023813
316 Ga0207644_10167433
317 Ga0207706_10003430
318 Ga0207670_10013129
319 Ga0207670_10200121
320 Ga0207691_10129187
321 Ga0207711_10086238
322 Ga0207679_10007928
323 Ga0207651_10027462
324 Ga0207651_10041184
325 Ga0207651_10173559
326 Ga0207651_10230306
327 Ga0207651_10259041
328 Ga0207651_10721491
329 Ga0207712_10413943
330 Ga0207640_10228167
331 Ga0207677_10389584
332 Ga0207708_10086290
333 Ga0207641_10005298
334 Ga0207641_10042870
335 Ga0207648_10421733
336 Ga0207675_100030495
337 Ga0207675_100417183
338 Ga0207683_10002309
339 Ga0207683_10068240
340 Ga0207683_10358438
341 Ga0209998_10051710
342 Ga0209974_10036426
343 Ga0207428_10003038
344 Ga0268265_10819639
345 Ga0307408_100802623
346 Ga0307405_10076889
347 Ga0307413_10053151
348 Ga0307410_10036879
349 Ga0307410_10041952
350 Ga0307410_10044589
351 Ga0307410_10211360
352 Ga0307410_10690952
353 Ga0307406_10161725
354 Ga0307406_10720212
355 Ga0307412_10007400
356 Ga0307409_100580460
357 Ga0307409_100720022
358 Ga0307409_101005039
359 Ga0307416_100004324
360 Ga0307416_100079489
361 Ga0307416_100139933
362 Ga0307416_100228237
363 Ga0307416_100242110
364 Ga0307416_100270160
365 Ga0307416_101291041
366 Ga0307411_10020275
367 Ga0307415_100019150
368 Ga0316583_10001227
369 Ga0373923_0115751
370 Ga0373956_0089123
371 Ga0373937_0016342
372 Ga0439453_0013621
373 Ga0450896_004069
374 Ga0450908_003817
375 Ga0439435_0021114
376 Ga0453684_0170233
377 Ga0495594_0283868
378 Ga0495594_0425436
379 Ga0495643_0004089
380 Ga0495621_0117745
381 Ga0495623_0108624
382 Ga0495636_0000331
383 Ga0496114_0831438
384 nmdc:mga05p37_168552_c1
385 nmdc:mga05p37_43394_c1
386 nmdc:mga05p37_694743_c1
387 nmdc:mga0qj67_625996_c1
388 nmdc:mga06r32_379256_c1
389 nmdc:mga08y16_131804_c1
390 nmdc:mga08y16_663560_c1
391 nmdc:mga08y16_918_c1
392 nmdc:mga0n895_1018379_c1
393 nmdc:mga0n895_5588_c1
394 nmdc:mga0rr50_754074_c1
395 nmdc:mga0a205_194_c1
396 nmdc:mga0a205_44471_c1
397 Ga0590071_000094
398 Ga0590074_000051
399 Ga0590075_000396
400 Ga0590077_000050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map