F306807

General Info

Members Datasets Scaffolds Average Seq Length
200 137 400 230

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100544071|Ga0070714_1005440712
Length 250
Sequence VSFTFLLQLALAVIPAILAITLYEAAHGYAALALGDDTARNAGRLSLNPLRHVDRVGTIILPGFLLITQLLLIGRIIFMFGWAKPVPVAAWKFRNPRRGMAIVATAGPLMNFFLAWIGAVLMPLPTVALPAGVDPLELAVAQHPIVGSFLLYFMLTNLVLGLFNLLPIPPLDGGRIVVGLLPLSLARHWARVERAGILLVVLVVFLLPYILRDFGIHFDPFNDVLETVLPWAFQLLFNLSGHGGTGLVHV

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
62 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
63 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
64 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
136 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
137 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.5
Rhizosphere 82.5
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100544071 3300005435 Bacteria 1111
2 rootH1_10039616 3300003316 Bacteria 7660
3 rootL2_10164847 3300003322 Bacteria 1537
4 Ga0070683_100217587 3300005329 Bacteria 1815
5 Ga0070683_100580633 3300005329 Bacteria 1072
6 Ga0070690_100469397 3300005330 Bacteria 936
7 Ga0068869_100122142 3300005334 Bacteria 1993
8 Ga0070680_100377809 3300005336 Bacteria 1206
9 Ga0070680_100482758 3300005336 Bacteria 1059
10 Ga0070674_100124832 3300005356 Bacteria 1910
11 Ga0070709_10013944 3300005434 Bacteria 4533
12 Ga0070714_100091377 3300005435 Bacteria 2667
13 Ga0070713_100025054 3300005436 Bacteria 4658
14 Ga0070713_100094409 3300005436 Bacteria 2579
15 Ga0070713_100249484 3300005436 Bacteria 1619
16 Ga0070713_100253523 3300005436 Bacteria 1606
17 Ga0070711_100021470 3300005439 Bacteria 4176
18 Ga0070708_100062113 3300005445 Bacteria 3340
19 Ga0070662_100549627 3300005457 Bacteria 967
20 Ga0070681_10043000 3300005458 Bacteria 4527
21 Ga0070681_10077453 3300005458 Bacteria 3283
22 Ga0070706_100089770 3300005467 Bacteria 2850
23 Ga0070679_100032592 3300005530 Bacteria 5155
24 Ga0070696_100666354 3300005546 Bacteria 845
25 Ga0068855_100207122 3300005563 Bacteria 2206
26 Ga0070664_100696721 3300005564 Bacteria 946
27 Ga0068852_100054867 3300005616 Bacteria 3437
28 Ga0081539_10004263 3300005985 Bacteria 16047
29 Ga0070712_100012219 3300006175 Bacteria 5458
30 Ga0075428_100008030 3300006844 Bacteria 11711
31 Ga0075428_100198799 3300006844 Bacteria 2168
32 Ga0075431_100028654 3300006847 Bacteria 5725
33 Ga0075431_100757564 3300006847 Bacteria 946
34 Ga0075433_10000209 3300006852 Bacteria 33034
35 Ga0075434_100009473 3300006871 Bacteria 9081
36 Ga0075429_100365265 3300006880 Bacteria 1264
37 Ga0075436_100009031 3300006914 Bacteria 6819
38 Ga0075435_100001746 3300007076 Bacteria 14148
39 Ga0111539_10181698 3300009094 Bacteria 2456
40 Ga0111539_10228755 3300009094 Bacteria 2166
41 Ga0111539_11269302 3300009094 Bacteria 855
42 Ga0105247_10061493 3300009101 Bacteria 2328
43 Ga0114129_10005093 3300009147 Bacteria 18509
44 Ga0105248_10429485 3300009177 Bacteria 1488
45 Ga0105246_10221063 3300011119 Bacteria 1485
46 Ga0157369_10152049 3300013105 Bacteria 2446
47 Ga0157374_10133615 3300013296 Bacteria 2403
48 Ga0157374_10305241 3300013296 Bacteria 1575
49 Ga0163163_10396828 3300014325 Bacteria 1437
50 Ga0182008_10040491 3300014497 Bacteria 2327
51 Ga0157376_10223048 3300014969 Bacteria 1747
52 Ga0213873_10022945 3300021358 Bacteria 1483
53 Ga0213873_10047342 3300021358 Bacteria 1128
54 Ga0213876_10064644 3300021384 Bacteria 1931
55 Ga0213876_10087710 3300021384 Bacteria 1647
56 Ga0213875_10001289 3300021388 Bacteria 16741
57 Ga0213875_10003386 3300021388 Bacteria 9083
58 Ga0213875_10008196 3300021388 Bacteria 5363
59 Ga0213875_10032149 3300021388 Bacteria 2480
60 Ga0213875_10049967 3300021388 Bacteria 1960
61 Ga0213875_10059785 3300021388 Bacteria 1783
62 Ga0213875_10064952 3300021388 Bacteria 1705
63 Ga0213875_10082070 3300021388 Bacteria 1504
64 Ga0207692_10091901 3300025898 Bacteria 1647
65 Ga0207699_10012256 3300025906 Bacteria 4357
66 Ga0207684_10502575 3300025910 Bacteria 1039
67 Ga0207707_10006331 3300025912 Bacteria 10338
68 Ga0207695_10411389 3300025913 Bacteria 1237
69 Ga0207693_10007606 3300025915 Bacteria 8900
70 Ga0207693_10237790 3300025915 Bacteria 1430
71 Ga0207663_10010846 3300025916 Bacteria 4867
72 Ga0207660_10135587 3300025917 Bacteria 1878
73 Ga0207660_10181593 3300025917 Bacteria 1634
74 Ga0207646_10675542 3300025922 Bacteria 924
75 Ga0207700_10017379 3300025928 Bacteria 4804
76 Ga0207700_10039876 3300025928 Bacteria 3423
77 Ga0207700_10300651 3300025928 Bacteria 1386
78 Ga0207700_10519998 3300025928 Bacteria 1054
79 Ga0207664_10093190 3300025929 Bacteria 2473
80 Ga0207664_10205264 3300025929 Bacteria 1703
81 Ga0207669_10099755 3300025937 Bacteria 1916
82 Ga0207665_10170763 3300025939 Bacteria 1570
83 Ga0207689_10086549 3300025942 Bacteria 2575
84 Ga0207640_10809998 3300025981 Bacteria 812
85 Ga0207702_10276420 3300026078 Bacteria 1586
86 Ga0207698_10077642 3300026142 Bacteria 2664
87 Ga0373923_0021220 3300035111 Bacteria 2533
88 Ga0373923_0024750 3300035111 Bacteria 2372
89 Ga0373953_0027677 3300035117 Bacteria 2180
90 Ga0373956_0057989 3300035119 Bacteria 1750
91 Ga0373943_0028285 3300035170 Bacteria 2641
92 Ga0373955_0334435 3300035172 Bacteria 916
93 Ga0373935_0026965 3300035692 Bacteria 3551
94 Ga0373927_0022073 3300035695 Bacteria 4171
95 Ga0373927_0072511 3300035695 Bacteria 2229
96 Ga0373933_0037349 3300035724 Bacteria 2848
97 Ga0373933_0114179 3300035724 Bacteria 1687
98 Ga0373947_0104528 3300035725 Bacteria 1783
99 Ga0373937_0002766 3300036401 Bacteria 14636
100 Ga0373937_0005434 3300036401 Bacteria 10906
101 Ga0373937_0010278 3300036401 Bacteria 8168
102 Ga0373937_0073969 3300036401 Bacteria 3144
103 Ga0373925_0194783 3300037068 Bacteria 1609
104 Ga0373925_0602790 3300037068 Bacteria 904
105 Ga0436364_0102215 3300037853 Bacteria 4489
106 Ga0436364_0267724 3300037853 Bacteria 14845
107 Ga0436364_0547680 3300037853 Bacteria 821
108 Ga0436364_0600960 3300037853 Bacteria 3714
109 Ga0436364_0797553 3300037853 Bacteria 935
110 Ga0436364_0802973 3300037853 Bacteria 26869
111 Ga0436364_0837120 3300037853 Bacteria 1185
112 Ga0436364_0924898 3300037853 Bacteria 10341
113 Ga0436364_0943136 3300037853 Bacteria 3510
114 Ga0436364_1005101 3300037853 Bacteria 7563
115 Ga0436365_0607354 3300039437 Bacteria 1208
116 Ga0436365_0663610 3300039437 Bacteria 3744
117 Ga0436360_0546177 3300039438 Bacteria 2376
118 Ga0436360_0827941 3300039438 Bacteria 3636
119 Ga0436361_0469179 3300039447 Bacteria 1044
120 Ga0436363_1384218 3300039450 Bacteria 2485
121 Ga0436362_1116412 3300039453 Bacteria 1389
122 Ga0439465_0068222 3300041413 Bacteria 1188
123 Ga0451577_0150822 3300042876 Bacteria 2092
124 Ga0495592_0052984 3300046454 Bacteria 3010
125 Ga0495592_0257348 3300046454 Bacteria 1151
126 Ga0495590_0113553 3300046457 Bacteria 968
127 Ga0495651_0093915 3300046462 Bacteria 2245
128 Ga0495651_0124178 3300046462 Bacteria 1892
129 Ga0495653_0136728 3300046463 Bacteria 1728
130 Ga0495662_0062001 3300046476 Bacteria 1807
131 Ga0495664_0001635 3300046477 Bacteria 11895
132 Ga0495608_0011331 3300046511 Bacteria 6209
133 Ga0495608_0059119 3300046511 Bacteria 2526
134 Ga0495628_0145599 3300046516 Bacteria 1806
135 Ga0495628_0147450 3300046516 Bacteria 1793
136 Ga0495640_0275214 3300046533 Bacteria 1049
137 Ga0495587_0003491 3300046536 Bacteria 10467
138 Ga0495645_0011027 3300046543 Bacteria 6351
139 Ga0495667_0027649 3300046559 Bacteria 3819
140 Ga0495634_0147650 3300046642 Bacteria 1489
141 Ga0495634_0340843 3300046642 Bacteria 899
142 Ga0495635_0014155 3300046663 Bacteria 5582
143 Ga0495635_0220628 3300046663 Bacteria 1282
144 Ga0495657_0039304 3300046675 Bacteria 3252
145 Ga0495599_0007526 3300046678 Bacteria 6604
146 Ga0495599_0035460 3300046678 Bacteria 3132
147 Ga0495623_0015481 3300046679 Bacteria 4931
148 Ga0495646_0104338 3300046680 Bacteria 1621
149 Ga0495646_0109857 3300046680 Bacteria 1571
150 Ga0495604_0124703 3300047317 Bacteria 1859
151 Ga0495674_0074213 3300047319 Bacteria 2930
152 Ga0495674_0101756 3300047319 Bacteria 2444
153 Ga0495680_0043809 3300047322 Bacteria 3541
154 Ga0495675_0218584 3300047444 Bacteria 1154
155 Ga0495675_0323964 3300047444 Bacteria 911
156 Ga0495684_0184927 3300047471 Bacteria 1543
157 Ga0495602_0022139 3300048088 Bacteria 6228
158 Ga0495602_0039242 3300048088 Bacteria 4364
159 Ga0495602_0250958 3300048088 Bacteria 1318
160 Ga0496101_0243035 3300048904 Bacteria 1401
161 Ga0496102_0537897 3300048905 Bacteria 1091
162 Ga0496104_0113679 3300048907 Bacteria 2596
163 Ga0496104_0567770 3300048907 Bacteria 1045
164 Ga0496105_0047530 3300048908 Bacteria 3541
165 Ga0496110_0118820 3300048913 Bacteria 2381
166 Ga0496110_0835741 3300048913 Bacteria 826
167 Ga0496111_0166147 3300048914 Bacteria 1639
168 Ga0496113_0391234 3300048916 Bacteria 1116
169 Ga0501033_0019546 3300049570 Bacteria 5122
170 Ga0501034_0526331 3300049571 Bacteria 1094
171 Ga0501036_0377512 3300049572 Bacteria 1183
172 Ga0501037_0159533 3300049573 Bacteria 1608
173 Ga0501038_0171600 3300049574 Bacteria 1755
174 Ga0501067_0065557 3300049583 Bacteria 2010
175 Ga0501069_0055267 3300049585 Bacteria 2211
176 Ga0501070_0056291 3300049586 Bacteria 3260
177 Ga0501072_0240116 3300049588 Bacteria 1443
178 Ga0501073_0261679 3300049589 Bacteria 1194
179 Ga0501075_0471860 3300049591 Bacteria 957
180 Ga0501077_0304195 3300049593 Bacteria 1016
181 Ga0501079_0037420 3300049741 Bacteria 3740
182 Ga0501035_0220656 3300049822 Bacteria 1619
183 nmdc:mga05p37_143684_c1 3300050507 Bacteria 2923
184 nmdc:mga09592_292064_c1 3300050508 Bacteria 1413
185 nmdc:mga09592_45306_c1 3300050508 Bacteria 3705
186 nmdc:mga06r32_49624_c1 3300050510 Bacteria 4014
187 nmdc:mga08y16_412296_c1 3300050511 Unclassified 1381
188 nmdc:mga08y16_501034_c1 3300050511 Bacteria 1234
189 nmdc:mga0n895_3528_c1 3300050512 Bacteria 12644
190 nmdc:mga0rr50_5869_c1 3300050513 Bacteria 7386
191 nmdc:mga08x19_375244_c1 3300050514 Bacteria 996
192 Ga0495601_0005417 3300053077 Bacteria 7429
193 Ga0495619_0023433 3300053085 Bacteria 3958
194 Ga0495619_0116466 3300053085 Bacteria 1829
195 Ga0495619_0418804 3300053085 Bacteria 924
196 Ga0501084_0005424 3300054114 Bacteria 10458
197 Ga0501082_0143931 3300060353 Bacteria 2069
198 Ga0530510_0009449 3300061734 Bacteria 6836
199 2842776313 2842775625 Bacteria 5587290
200 2883580462 2883577096 Bacteria 4709178
201 Ga0070714_100544071
202 rootH1_10039616
203 rootL2_10164847
204 Ga0070683_100217587
205 Ga0070683_100580633
206 Ga0070690_100469397
207 Ga0068869_100122142
208 Ga0070680_100377809
209 Ga0070680_100482758
210 Ga0070674_100124832
211 Ga0070709_10013944
212 Ga0070714_100091377
213 Ga0070713_100025054
214 Ga0070713_100094409
215 Ga0070713_100249484
216 Ga0070713_100253523
217 Ga0070711_100021470
218 Ga0070708_100062113
219 Ga0070662_100549627
220 Ga0070681_10043000
221 Ga0070681_10077453
222 Ga0070706_100089770
223 Ga0070679_100032592
224 Ga0070696_100666354
225 Ga0068855_100207122
226 Ga0070664_100696721
227 Ga0068852_100054867
228 Ga0081539_10004263
229 Ga0070712_100012219
230 Ga0075428_100008030
231 Ga0075428_100198799
232 Ga0075431_100028654
233 Ga0075431_100757564
234 Ga0075433_10000209
235 Ga0075434_100009473
236 Ga0075429_100365265
237 Ga0075436_100009031
238 Ga0075435_100001746
239 Ga0111539_10181698
240 Ga0111539_10228755
241 Ga0111539_11269302
242 Ga0105247_10061493
243 Ga0114129_10005093
244 Ga0105248_10429485
245 Ga0105246_10221063
246 Ga0157369_10152049
247 Ga0157374_10133615
248 Ga0157374_10305241
249 Ga0163163_10396828
250 Ga0182008_10040491
251 Ga0157376_10223048
252 Ga0213873_10022945
253 Ga0213873_10047342
254 Ga0213876_10064644
255 Ga0213876_10087710
256 Ga0213875_10001289
257 Ga0213875_10003386
258 Ga0213875_10008196
259 Ga0213875_10032149
260 Ga0213875_10049967
261 Ga0213875_10059785
262 Ga0213875_10064952
263 Ga0213875_10082070
264 Ga0207692_10091901
265 Ga0207699_10012256
266 Ga0207684_10502575
267 Ga0207707_10006331
268 Ga0207695_10411389
269 Ga0207693_10007606
270 Ga0207693_10237790
271 Ga0207663_10010846
272 Ga0207660_10135587
273 Ga0207660_10181593
274 Ga0207646_10675542
275 Ga0207700_10017379
276 Ga0207700_10039876
277 Ga0207700_10300651
278 Ga0207700_10519998
279 Ga0207664_10093190
280 Ga0207664_10205264
281 Ga0207669_10099755
282 Ga0207665_10170763
283 Ga0207689_10086549
284 Ga0207640_10809998
285 Ga0207702_10276420
286 Ga0207698_10077642
287 Ga0373923_0021220
288 Ga0373923_0024750
289 Ga0373953_0027677
290 Ga0373956_0057989
291 Ga0373943_0028285
292 Ga0373955_0334435
293 Ga0373935_0026965
294 Ga0373927_0022073
295 Ga0373927_0072511
296 Ga0373933_0037349
297 Ga0373933_0114179
298 Ga0373947_0104528
299 Ga0373937_0002766
300 Ga0373937_0005434
301 Ga0373937_0010278
302 Ga0373937_0073969
303 Ga0373925_0194783
304 Ga0373925_0602790
305 Ga0436364_0102215
306 Ga0436364_0267724
307 Ga0436364_0547680
308 Ga0436364_0600960
309 Ga0436364_0797553
310 Ga0436364_0802973
311 Ga0436364_0837120
312 Ga0436364_0924898
313 Ga0436364_0943136
314 Ga0436364_1005101
315 Ga0436365_0607354
316 Ga0436365_0663610
317 Ga0436360_0546177
318 Ga0436360_0827941
319 Ga0436361_0469179
320 Ga0436363_1384218
321 Ga0436362_1116412
322 Ga0439465_0068222
323 Ga0451577_0150822
324 Ga0495592_0052984
325 Ga0495592_0257348
326 Ga0495590_0113553
327 Ga0495651_0093915
328 Ga0495651_0124178
329 Ga0495653_0136728
330 Ga0495662_0062001
331 Ga0495664_0001635
332 Ga0495608_0011331
333 Ga0495608_0059119
334 Ga0495628_0145599
335 Ga0495628_0147450
336 Ga0495640_0275214
337 Ga0495587_0003491
338 Ga0495645_0011027
339 Ga0495667_0027649
340 Ga0495634_0147650
341 Ga0495634_0340843
342 Ga0495635_0014155
343 Ga0495635_0220628
344 Ga0495657_0039304
345 Ga0495599_0007526
346 Ga0495599_0035460
347 Ga0495623_0015481
348 Ga0495646_0104338
349 Ga0495646_0109857
350 Ga0495604_0124703
351 Ga0495674_0074213
352 Ga0495674_0101756
353 Ga0495680_0043809
354 Ga0495675_0218584
355 Ga0495675_0323964
356 Ga0495684_0184927
357 Ga0495602_0022139
358 Ga0495602_0039242
359 Ga0495602_0250958
360 Ga0496101_0243035
361 Ga0496102_0537897
362 Ga0496104_0113679
363 Ga0496104_0567770
364 Ga0496105_0047530
365 Ga0496110_0118820
366 Ga0496110_0835741
367 Ga0496111_0166147
368 Ga0496113_0391234
369 Ga0501033_0019546
370 Ga0501034_0526331
371 Ga0501036_0377512
372 Ga0501037_0159533
373 Ga0501038_0171600
374 Ga0501067_0065557
375 Ga0501069_0055267
376 Ga0501070_0056291
377 Ga0501072_0240116
378 Ga0501073_0261679
379 Ga0501075_0471860
380 Ga0501077_0304195
381 Ga0501079_0037420
382 Ga0501035_0220656
383 nmdc:mga05p37_143684_c1
384 nmdc:mga09592_292064_c1
385 nmdc:mga09592_45306_c1
386 nmdc:mga06r32_49624_c1
387 nmdc:mga08y16_412296_c1
388 nmdc:mga08y16_501034_c1
389 nmdc:mga0n895_3528_c1
390 nmdc:mga0rr50_5869_c1
391 nmdc:mga08x19_375244_c1
392 Ga0495601_0005417
393 Ga0495619_0023433
394 Ga0495619_0116466
395 Ga0495619_0418804
396 Ga0501084_0005424
397 Ga0501082_0143931
398 Ga0530510_0009449
399 2842776313
400 2883580462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02163

Peptidase_M50

Peptidase family M50

11

208

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b4r-assembly1.cif.gz_B site-2 protease from methanocaldococcus jannaschii 0.6278 12 205
7w6x-assembly1.cif.gz_A crystal structure of e. coli rsep in complex with batimastat 0.5619 10 109
7w6z-assembly1.cif.gz_A crystal structure of kangiella koreensis rsep orthologue in complex with batimastat in space group p21 0.5475 10 108
3b4r-assembly1.cif.gz_B site-2 protease from methanocaldococcus jannaschii 0.498 12 205
5iqj-assembly3.cif.gz_C 1.9 angstrom crystal structure of protein with unknown function from vibrio cholerae. 0.4524 20 143
ID Description Score Start End Superfamily
5jdnA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.6451 87 160 6.10.280.80
5jdnA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.5982 87 160 6.10.280.80
af_I1KLR6_11_546_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4958 84 144 1.25.10.10
af_A0A2R8QGP7_220_371_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.4087 88 212 1.20.1420.10
5ajiF01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4064 89 181 1.10.287.1260
ID Description Score Start End GO Terms
AF-X1SG72-F1-model_v4 Peptidase M50 domain-containing protein 0.9659 10 112 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A6B0Q4M5-F1-model_v4 deleted 0.9636 5 117
AF-A0A2D9HKJ6-F1-model_v4 deleted 0.9634 9 110
AF-A0A1F8TXM2-F1-model_v4 Peptidase M50 domain-containing protein 0.9607 11 162 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A7C4Z0T7-F1-model_v4 Site-2 protease family protein 0.9595 1 108 GO:0005886
GO:0006508
GO:0008237
GO:0046872

Map