F306690

General Info

Members Datasets Scaffolds Average Seq Length
200 151 200 171

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100050686|Ga0070683_1000506863
Length 184
Sequence MWMRLVAIEVVTRSHHGYALAVTDQGRYAPPEERPPLLAYSVAMAIFSSLFAAALLLARRCGRELPERPALGDILLVGVASHKLSRLIGKDKVTSAIRAPFTELEGSGGPGELEEASRGTGARKAIGELLVCPYCLGLWVVAAFSIGLLFAPRLTRFLASVFTALTASDFLQIAYKAAEEKGLG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
146 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
147 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 6.5
Rhizosphere 89.5
Stem 0
Stem Tuber 0
Unclassified 3.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009169 3300001979 Bacteria 3890
2 rootH1_10134666 3300003316 Bacteria 2026
3 Ga0070683_100021855 3300005329 Bacteria 5711
4 Ga0070683_100043299 3300005329 Bacteria 4149
5 Ga0070683_100050686 3300005329 Bacteria 3844
6 Ga0070683_100113142 3300005329 Bacteria 2561
7 Ga0070677_10000016 3300005333 Bacteria 52044
8 Ga0070666_10034230 3300005335 Bacteria 3367
9 Ga0070680_100045228 3300005336 Bacteria 3579
10 Ga0070682_100000026 3300005337 Bacteria 191388
11 Ga0070682_101788007 3300005337 Unclassified 536
12 Ga0068868_100000095 3300005338 Bacteria 54537
13 Ga0068868_100001709 3300005338 Bacteria 15018
14 Ga0070689_100063002 3300005340 Bacteria 2886
15 Ga0070691_10592383 3300005341 Unclassified 653
16 Ga0070661_100000004 3300005344 Bacteria 243876
17 Ga0070692_10057080 3300005345 Bacteria 2046
18 Ga0070668_100030969 3300005347 Bacteria 4070
19 Ga0070675_100000078 3300005354 Bacteria 56469
20 Ga0070673_100045943 3300005364 Bacteria 3390
21 Ga0070688_100000113 3300005365 Bacteria 42091
22 Ga0070688_100041535 3300005365 Unclassified 2824
23 Ga0070667_100473475 3300005367 Bacteria 1146
24 Ga0070713_100000005 3300005436 Bacteria 201526
25 Ga0070700_100024097 3300005441 Bacteria 3569
26 Ga0070663_100000139 3300005455 Bacteria 35134
27 Ga0070681_10063444 3300005458 Bacteria 3667
28 Ga0070685_10009501 3300005466 Bacteria 5028
29 Ga0070679_100000202 3300005530 Bacteria 48732
30 Ga0070679_100002818 3300005530 Bacteria 15805
31 Ga0070684_100003218 3300005535 Bacteria 12217
32 Ga0070684_100034149 3300005535 Bacteria 4347
33 Ga0070684_100163608 3300005535 Bacteria 2019
34 Ga0068853_100004747 3300005539 Bacteria 10563
35 Ga0068853_100267583 3300005539 Unclassified 1573
36 Ga0070693_100028126 3300005547 Bacteria 3054
37 Ga0070665_100000682 3300005548 Bacteria 45471
38 Ga0070665_100003565 3300005548 Bacteria 16504
39 Ga0070665_100010966 3300005548 Bacteria 9165
40 Ga0070665_100058813 3300005548 Bacteria 3853
41 Ga0070664_100525871 3300005564 Bacteria 1092
42 Ga0068854_100000062 3300005578 Bacteria 78159
43 Ga0068856_100013015 3300005614 Bacteria 8056
44 Ga0070702_100011771 3300005615 Bacteria 4362
45 Ga0068852_100000022 3300005616 Bacteria 125196
46 Ga0068852_100007787 3300005616 Bacteria 7843
47 Ga0068852_101252127 3300005616 Bacteria 763
48 Ga0068864_100000262 3300005618 Bacteria 47006
49 Ga0068851_10009690 3300005834 Bacteria 4485
50 Ga0081455_10146125 3300005937 Bacteria 1829
51 Ga0081455_10249311 3300005937 Bacteria 1299
52 Ga0081538_10031115 3300005981 Bacteria 3608
53 Ga0070712_101171320 3300006175 Bacteria 668
54 Ga0068871_100458969 3300006358 Bacteria 1143
55 Ga0068865_100000061 3300006881 Bacteria 57211
56 Ga0105245_10000049 3300009098 Bacteria 128277
57 Ga0105245_10002542 3300009098 Bacteria 16442
58 Ga0105243_10006741 3300009148 Bacteria 8861
59 Ga0105241_10412662 3300009174 Bacteria 1187
60 Ga0105248_10000245 3300009177 Bacteria 62951
61 Ga0105249_10000039 3300009553 Bacteria 196325
62 Ga0105249_10418990 3300009553 Bacteria 1372
63 Ga0157371_10001441 3300013102 Bacteria 24694
64 Ga0157378_10102955 3300013297 Bacteria 2608
65 Ga0157372_10001763 3300013307 Bacteria 23465
66 Ga0157380_10153794 3300014326 Bacteria 1992
67 Ga0157377_10449678 3300014745 Bacteria 889
68 Ga0157379_10019968 3300014968 Bacteria 5920
69 Ga0206352_11352832 3300020078 Unclassified 640
70 Ga0224712_10154143 3300022467 Bacteria 1020
71 Ga0207656_10000111 3300025321 Bacteria 31159
72 Ga0207656_10005421 3300025321 Bacteria 4508
73 Ga0207682_10000409 3300025893 Bacteria 19717
74 Ga0207680_10011017 3300025903 Bacteria 4551
75 Ga0207680_10345108 3300025903 Bacteria 1045
76 Ga0207705_10219745 3300025909 Bacteria 1443
77 Ga0207654_10265026 3300025911 Bacteria 1157
78 Ga0207707_10012862 3300025912 Bacteria 7283
79 Ga0207693_10000955 3300025915 Bacteria 25933
80 Ga0207660_10059986 3300025917 Bacteria 2733
81 Ga0207649_10000003 3300025920 Bacteria 388908
82 Ga0207652_10000283 3300025921 Bacteria 52945
83 Ga0207652_10000735 3300025921 Bacteria 31707
84 Ga0207681_10133701 3300025923 Bacteria 1837
85 Ga0207650_10052086 3300025925 Bacteria 3031
86 Ga0207659_10000018 3300025926 Bacteria 156920
87 Ga0207687_10000189 3300025927 Bacteria 41272
88 Ga0207687_10002068 3300025927 Bacteria 13737
89 Ga0207700_10000003 3300025928 Bacteria 500797
90 Ga0207709_10002766 3300025935 Bacteria 10809
91 Ga0207670_10153590 3300025936 Bacteria 1711
92 Ga0207704_10000026 3300025938 Bacteria 123892
93 Ga0207711_10000192 3300025941 Bacteria 65599
94 Ga0207661_10000235 3300025944 Bacteria 36349
95 Ga0207661_10034488 3300025944 Bacteria 3936
96 Ga0207661_10058618 3300025944 Bacteria 3099
97 Ga0207661_10085078 3300025944 Bacteria 2621
98 Ga0207679_10018830 3300025945 Bacteria 4632
99 Ga0207667_10043242 3300025949 Bacteria 4782
100 Ga0207651_10030239 3300025960 Bacteria 3445
101 Ga0207712_10000003 3300025961 Bacteria 615314
102 Ga0207668_10008839 3300025972 Bacteria 6022
103 Ga0207640_10000074 3300025981 Bacteria 78164
104 Ga0207658_10490097 3300025986 Bacteria 1093
105 Ga0207677_10000246 3300026023 Bacteria 41847
106 Ga0207678_10006624 3300026067 Bacteria 10266
107 Ga0207708_10208133 3300026075 Bacteria 1563
108 Ga0207702_10004785 3300026078 Bacteria 11930
109 Ga0207702_10006648 3300026078 Bacteria 9942
110 Ga0207676_10000038 3300026095 Bacteria 171492
111 Ga0207698_10000043 3300026142 Bacteria 96553
112 Ga0207698_10002054 3300026142 Bacteria 11875
113 Ga0207698_10409718 3300026142 Bacteria 1298
114 Ga0268266_10000982 3300028379 Bacteria 36014
115 Ga0268266_10005107 3300028379 Bacteria 12371
116 Ga0268266_10005575 3300028379 Bacteria 11700
117 Ga0268266_10133352 3300028379 Bacteria 2223
118 Ga0307409_100205081 3300031995 Bacteria 1767
119 Ga0307416_100045545 3300032002 Bacteria 3455
120 Ga0307414_10550014 3300032004 Bacteria 1029
121 Ga0307415_100007127 3300032126 Bacteria 6089
122 Ga0395898_0452903 3300037466 Bacteria 1222
123 Ga0395898_0693527 3300037466 Bacteria 960
124 Ga0395901_0370296 3300038443 Bacteria 1476
125 Ga0436365_1100748 3300039437 Bacteria 5356
126 Ga0451853_0474226 3300041512 Bacteria 1601
127 Ga0451853_0748562 3300041512 Bacteria 812
128 Ga0466967_0000002 3300045976 Bacteria 219994
129 Ga0466967_0268281 3300045976 Bacteria 1635
130 Ga0495606_0000017 3300046507 Bacteria 284549
131 Ga0495630_0000062 3300046517 Bacteria 86140
132 Ga0495613_0000094 3300046689 Bacteria 86601
133 Ga0495624_0227611 3300046690 Bacteria 1130
134 Ga0495604_0013478 3300047317 Bacteria 6513
135 Ga0496104_0260449 3300048907 Bacteria 1647
136 Ga0496105_0000002 3300048908 Bacteria 753215
137 Ga0496108_0014921 3300048911 Bacteria 6342
138 Ga0496108_1386721 3300048911 Bacteria 588
139 Ga0496109_0000066 3300048912 Bacteria 112004
140 Ga0496110_0057956 3300048913 Bacteria 3411
141 Ga0496110_0201387 3300048913 Bacteria 1809
142 Ga0496111_0008351 3300048914 Bacteria 6846
143 Ga0496112_0000006 3300048915 Bacteria 365227
144 Ga0496112_0023564 3300048915 Bacteria 5882
145 Ga0496112_0201427 3300048915 Bacteria 1950
146 Ga0496113_0000001 3300048916 Bacteria 224977
147 Ga0496114_0258681 3300048917 Unclassified 1532
148 Ga0496119_0065791 3300048922 Bacteria 2145
149 Ga0496124_0033052 3300048927 Bacteria 4556
150 Ga0496126_0055097 3300048929 Bacteria 3599
151 Ga0501031_0000830 3300049568 Bacteria 18572
152 Ga0501032_0001456 3300049569 Bacteria 18822
153 Ga0501033_0001789 3300049570 Bacteria 18764
154 Ga0501034_0271826 3300049571 Bacteria 1635
155 Ga0501034_0274130 3300049571 Bacteria 1627
156 Ga0501034_0744416 3300049571 Bacteria 876
157 Ga0501036_0006404 3300049572 Bacteria 9553
158 Ga0501037_0001244 3300049573 Bacteria 18772
159 Ga0501037_0145735 3300049573 Bacteria 1694
160 Ga0501038_0002027 3300049574 Bacteria 18724
161 Ga0501039_0032488 3300049575 Bacteria 4024
162 Ga0501039_0176911 3300049575 Bacteria 1678
163 Ga0501040_0066626 3300049576 Bacteria 2481
164 Ga0501041_0138858 3300049577 Bacteria 1515
165 Ga0501042_0011734 3300049578 Bacteria 5920
166 Ga0501042_0153343 3300049578 Bacteria 1661
167 Ga0501043_0032760 3300049579 Bacteria 4086
168 Ga0501046_0007558 3300049580 Bacteria 9531
169 Ga0501047_0000566 3300049581 Bacteria 39544
170 Ga0501048_0000451 3300049582 Bacteria 28910
171 Ga0501048_0117222 3300049582 Bacteria 1881
172 Ga0501067_0164517 3300049583 Bacteria 1235
173 Ga0501067_0466718 3300049583 Bacteria 705
174 Ga0501068_0002643 3300049584 Bacteria 9495
175 Ga0501070_0002339 3300049586 Bacteria 16642
176 Ga0501071_0032817 3300049587 Bacteria 3689
177 Ga0501072_0090862 3300049588 Bacteria 2424
178 Ga0501073_0164710 3300049589 Bacteria 1535
179 Ga0501074_0202849 3300049590 Bacteria 1413
180 Ga0501074_0234641 3300049590 Bacteria 1306
181 Ga0501074_0267022 3300049590 Bacteria 1216
182 Ga0501075_0002117 3300049591 Bacteria 13132
183 Ga0501079_0005330 3300049741 Bacteria 9571
184 Ga0501080_0047840 3300049742 Bacteria 3981
185 Ga0501083_0025452 3300049744 Bacteria 4097
186 Ga0501035_0000606 3300049822 Bacteria 39544
187 Ga0501044_0003126 3300049823 Bacteria 18766
188 Ga0501044_0381658 3300049823 Unclassified 1324
189 Ga0501045_0302909 3300049824 Bacteria 1189
190 nmdc:mga06r32_712597_c1 3300050510 Bacteria 968
191 nmdc:mga08y16_364414_c1 3300050511 Bacteria 1483
192 Ga0495601_0000017 3300053077 Bacteria 204209
193 Ga0495601_0078601 3300053077 Bacteria 2114
194 Ga0495612_0001491 3300053078 Bacteria 9648
195 Ga0495655_0000004 3300053083 Bacteria 293683
196 Ga0495595_0001427 3300053084 Bacteria 9293
197 Ga0495619_0000054 3300053085 Bacteria 97928
198 Ga0500628_000049 3300053129 Bacteria 41425
199 Ga0501084_1241104 3300054114 Bacteria 625
200 Ga0501082_0039682 3300060353 Bacteria 4061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005441 Ga0070700_100024097 Ga0070700_1000240974 148
2 3300026075 Ga0207708_10208133 Ga0207708_102081332 148
3 3300005329 Ga0070683_100043299 Ga0070683_1000432998 151
4 3300005535 Ga0070684_100034149 Ga0070684_1000341494 151
5 3300025944 Ga0207661_10034488 Ga0207661_100344882 151
6 3300037466 Ga0395898_0693527 Ga0395898_0693527_366_833 155
7 3300038443 Ga0395901_0370296 Ga0395901_0370296_259_726 155
8 3300049578 Ga0501042_0011734 Ga0501042_0011734_1049_1525 158
9 3300049591 Ga0501075_0002117 Ga0501075_0002117_2900_3376 158
10 3300048908 Ga0496105_0000002 Ga0496105_0000002_714553_715035 160
11 3300048922 Ga0496119_0065791 Ga0496119_0065791_958_1440 160
12 3300005548 Ga0070665_100010966 Ga0070665_1000109666 161
13 3300005615 Ga0070702_100011771 Ga0070702_1000117712 161
14 3300005937 Ga0081455_10249311 Ga0081455_102493112 161
15 3300028379 Ga0268266_10005107 Ga0268266_100051077 161
16 3300048911 Ga0496108_1386721 Ga0496108_1386721_69_554 161
17 3300049583 Ga0501067_0164517 Ga0501067_0164517_101_586 161
18 3300031995 Ga0307409_100205081 Ga0307409_1002050812 162
19 3300032004 Ga0307414_10550014 Ga0307414_105500142 162
20 3300045976 Ga0466967_0268281 Ga0466967_0268281_738_1226 162
21 3300048913 Ga0496110_0201387 Ga0496110_0201387_359_856 162
22 3300050510 nmdc:mga06r32_712597_c1 nmdc:mga06r32_712597_c1_454_951 162
23 3300050511 nmdc:mga08y16_364414_c1 nmdc:mga08y16_364414_c1_916_1413 162
24 3300005338 Ga0068868_100000095 Ga0068868_10000009525 163
25 3300005547 Ga0070693_100028126 Ga0070693_1000281264 163
26 3300022467 Ga0224712_10154143 Ga0224712_101541431 163
27 3300026023 Ga0207677_10000246 Ga0207677_1000024624 163
28 3300026142 Ga0207698_10409718 Ga0207698_104097181 163
29 3300049590 Ga0501074_0202849 Ga0501074_0202849_621_1115 163
30 3300005329 Ga0070683_100113142 Ga0070683_1001131422 164
31 3300005337 Ga0070682_101788007 Ga0070682_1017880071 164
32 3300005341 Ga0070691_10592383 Ga0070691_105923831 164
33 3300005981 Ga0081538_10031115 Ga0081538_100311156 164
34 3300014745 Ga0157377_10449678 Ga0157377_104496781 164
35 3300025944 Ga0207661_10085078 Ga0207661_100850784 164
36 3300048907 Ga0496104_0260449 Ga0496104_0260449_214_708 164
37 3300048913 Ga0496110_0057956 Ga0496110_0057956_712_1206 164
38 3300048914 Ga0496111_0008351 Ga0496111_0008351_1767_2261 164
39 3300048915 Ga0496112_0201427 Ga0496112_0201427_1254_1748 164
40 3300003316 rootH1_10134666 rootH1_101346663 165
41 3300005335 Ga0070666_10034230 Ga0070666_100342301 165
42 3300005367 Ga0070667_100473475 Ga0070667_1004734752 165
43 3300005548 Ga0070665_100003565 Ga0070665_10000356516 165
44 3300005548 Ga0070665_100058813 Ga0070665_1000588135 165
45 3300025903 Ga0207680_10011017 Ga0207680_100110174 165
46 3300025986 Ga0207658_10490097 Ga0207658_104900972 165
47 3300028379 Ga0268266_10000982 Ga0268266_1000098222 165
48 3300028379 Ga0268266_10133352 Ga0268266_101333522 165
49 3300048927 Ga0496124_0033052 Ga0496124_0033052_3184_3705 165
50 3300048929 Ga0496126_0055097 Ga0496126_0055097_2995_3516 165
51 3300049568 Ga0501031_0000830 Ga0501031_0000830_9202_9699 165
52 3300049569 Ga0501032_0001456 Ga0501032_0001456_9431_9928 165
53 3300049570 Ga0501033_0001789 Ga0501033_0001789_8885_9382 165
54 3300049571 Ga0501034_0271826 Ga0501034_0271826_964_1461 165
55 3300049571 Ga0501034_0274130 Ga0501034_0274130_168_665 165
56 3300049571 Ga0501034_0744416 Ga0501034_0744416_50_598 165
57 3300049572 Ga0501036_0006404 Ga0501036_0006404_162_659 165
58 3300049573 Ga0501037_0001244 Ga0501037_0001244_8835_9332 165
59 3300049574 Ga0501038_0002027 Ga0501038_0002027_9179_9676 165
60 3300049575 Ga0501039_0032488 Ga0501039_0032488_3364_3861 165
61 3300049578 Ga0501042_0153343 Ga0501042_0153343_1040_1537 165
62 3300049579 Ga0501043_0032760 Ga0501043_0032760_3454_3951 165
63 3300049580 Ga0501046_0007558 Ga0501046_0007558_8870_9367 165
64 3300049581 Ga0501047_0000566 Ga0501047_0000566_30168_30665 165
65 3300049582 Ga0501048_0000451 Ga0501048_0000451_160_657 165
66 3300049583 Ga0501067_0466718 Ga0501067_0466718_39_536 165
67 3300049584 Ga0501068_0002643 Ga0501068_0002643_166_663 165
68 3300049586 Ga0501070_0002339 Ga0501070_0002339_8878_9375 165
69 3300049589 Ga0501073_0164710 Ga0501073_0164710_865_1362 165
70 3300049590 Ga0501074_0267022 Ga0501074_0267022_505_1032 165
71 3300049741 Ga0501079_0005330 Ga0501079_0005330_241_738 165
72 3300049742 Ga0501080_0047840 Ga0501080_0047840_81_578 165
73 3300049744 Ga0501083_0025452 Ga0501083_0025452_166_663 165
74 3300049822 Ga0501035_0000606 Ga0501035_0000606_30168_30665 165
75 3300049823 Ga0501044_0003126 Ga0501044_0003126_8880_9377 165
76 3300049823 Ga0501044_0381658 Ga0501044_0381658_190_687 165
77 3300049824 Ga0501045_0302909 Ga0501045_0302909_531_1028 165
78 3300053078 Ga0495612_0001491 Ga0495612_0001491_8469_8999 165
79 3300060353 Ga0501082_0039682 Ga0501082_0039682_115_612 165
80 3300005333 Ga0070677_10000016 Ga0070677_1000001628 166
81 3300005337 Ga0070682_100000026 Ga0070682_1000000266 166
82 3300005338 Ga0068868_100001709 Ga0068868_10000170910 166
83 3300005344 Ga0070661_100000004 Ga0070661_10000000483 166
84 3300005345 Ga0070692_10057080 Ga0070692_100570803 166
85 3300005347 Ga0070668_100030969 Ga0070668_1000309693 166
86 3300005365 Ga0070688_100000113 Ga0070688_10000011328 166
87 3300005436 Ga0070713_100000005 Ga0070713_100000005137 166
88 3300005466 Ga0070685_10009501 Ga0070685_100095012 166
89 3300005535 Ga0070684_100163608 Ga0070684_1001636084 166
90 3300005539 Ga0068853_100267583 Ga0068853_1002675832 166
91 3300005548 Ga0070665_100000682 Ga0070665_10000068225 166
92 3300005564 Ga0070664_100525871 Ga0070664_1005258713 166
93 3300005578 Ga0068854_100000062 Ga0068854_10000006260 166
94 3300005614 Ga0068856_100013015 Ga0068856_1000130155 166
95 3300005616 Ga0068852_100000022 Ga0068852_10000002276 166
96 3300005616 Ga0068852_100007787 Ga0068852_1000077877 166
97 3300005834 Ga0068851_10009690 Ga0068851_100096904 166
98 3300006175 Ga0070712_101171320 Ga0070712_1011713201 166
99 3300006881 Ga0068865_100000061 Ga0068865_10000006124 166
100 3300009098 Ga0105245_10002542 Ga0105245_100025425 166
101 3300009148 Ga0105243_10006741 Ga0105243_100067418 166
102 3300009174 Ga0105241_10412662 Ga0105241_104126622 166
103 3300009177 Ga0105248_10000245 Ga0105248_1000024523 166
104 3300013102 Ga0157371_10001441 Ga0157371_1000144118 166
105 3300013297 Ga0157378_10102955 Ga0157378_101029553 166
106 3300013307 Ga0157372_10001763 Ga0157372_100017638 166
107 3300014326 Ga0157380_10153794 Ga0157380_101537942 166
108 3300025321 Ga0207656_10000111 Ga0207656_1000011136 166
109 3300025321 Ga0207656_10005421 Ga0207656_100054214 166
110 3300025893 Ga0207682_10000409 Ga0207682_100004093 166
111 3300025903 Ga0207680_10345108 Ga0207680_103451082 166
112 3300025909 Ga0207705_10219745 Ga0207705_102197452 166
113 3300025911 Ga0207654_10265026 Ga0207654_102650261 166
114 3300025920 Ga0207649_10000003 Ga0207649_10000003176 166
115 3300025925 Ga0207650_10052086 Ga0207650_100520864 166
116 3300025927 Ga0207687_10002068 Ga0207687_1000206816 166
117 3300025928 Ga0207700_10000003 Ga0207700_10000003327 166
118 3300025935 Ga0207709_10002766 Ga0207709_100027668 166
119 3300025938 Ga0207704_10000026 Ga0207704_1000002621 166
120 3300025941 Ga0207711_10000192 Ga0207711_1000019223 166
121 3300025945 Ga0207679_10018830 Ga0207679_100188306 166
122 3300025949 Ga0207667_10043242 Ga0207667_100432422 166
123 3300025972 Ga0207668_10008839 Ga0207668_100088393 166
124 3300025981 Ga0207640_10000074 Ga0207640_1000007459 166
125 3300026078 Ga0207702_10004785 Ga0207702_100047859 166
126 3300026142 Ga0207698_10000043 Ga0207698_1000004348 166
127 3300026142 Ga0207698_10002054 Ga0207698_1000205410 166
128 3300028379 Ga0268266_10005575 Ga0268266_100055758 166
129 3300032126 Ga0307415_100007127 Ga0307415_1000071275 166
130 3300039437 Ga0436365_1100748 Ga0436365_1100748_4608_5126 166
131 3300041512 Ga0451853_0474226 Ga0451853_0474226_127_630 166
132 3300045976 Ga0466967_0000002 Ga0466967_0000002_213921_214469 166
133 3300046507 Ga0495606_0000017 Ga0495606_0000017_207857_208381 166
134 3300046689 Ga0495613_0000094 Ga0495613_0000094_1669_2202 166
135 3300046690 Ga0495624_0227611 Ga0495624_0227611_410_943 166
136 3300047317 Ga0495604_0013478 Ga0495604_0013478_10_525 166
137 3300048915 Ga0496112_0023564 Ga0496112_0023564_4543_5076 166
138 3300048916 Ga0496113_0000001 Ga0496113_0000001_89585_90118 166
139 3300048917 Ga0496114_0258681 Ga0496114_0258681_474_998 166
140 3300053077 Ga0495601_0000017 Ga0495601_0000017_134462_134995 166
141 3300053077 Ga0495601_0078601 Ga0495601_0078601_67_606 166
142 3300053084 Ga0495595_0001427 Ga0495595_0001427_4219_4752 166
143 3300053085 Ga0495619_0000054 Ga0495619_0000054_48346_48879 166
144 3300001979 JGI24740J21852_10009169 JGI24740J21852_100091693 167
145 3300005329 Ga0070683_100021855 Ga0070683_1000218557 167
146 3300005329 Ga0070683_100050686 Ga0070683_1000506863 167
147 3300005336 Ga0070680_100045228 Ga0070680_1000452284 167
148 3300005340 Ga0070689_100063002 Ga0070689_1000630023 167
149 3300005354 Ga0070675_100000078 Ga0070675_10000007847 167
150 3300005364 Ga0070673_100045943 Ga0070673_1000459434 167
151 3300005365 Ga0070688_100041535 Ga0070688_1000415352 167
152 3300005455 Ga0070663_100000139 Ga0070663_1000001396 167
153 3300005458 Ga0070681_10063444 Ga0070681_100634446 167
154 3300005530 Ga0070679_100000202 Ga0070679_10000020227 167
155 3300005530 Ga0070679_100002818 Ga0070679_1000028184 167
156 3300005535 Ga0070684_100003218 Ga0070684_1000032189 167
157 3300005539 Ga0068853_100004747 Ga0068853_1000047472 167
158 3300005616 Ga0068852_101252127 Ga0068852_1012521272 167
159 3300005618 Ga0068864_100000262 Ga0068864_10000026248 167
160 3300005937 Ga0081455_10146125 Ga0081455_101461253 167
161 3300006358 Ga0068871_100458969 Ga0068871_1004589692 167
162 3300009098 Ga0105245_10000049 Ga0105245_1000004969 167
163 3300009553 Ga0105249_10000039 Ga0105249_10000039176 167
164 3300009553 Ga0105249_10418990 Ga0105249_104189901 167
165 3300014968 Ga0157379_10019968 Ga0157379_100199686 167
166 3300020078 Ga0206352_11352832 Ga0206352_113528321 167
167 3300025912 Ga0207707_10012862 Ga0207707_100128626 167
168 3300025915 Ga0207693_10000955 Ga0207693_1000095518 167
169 3300025917 Ga0207660_10059986 Ga0207660_100599864 167
170 3300025921 Ga0207652_10000283 Ga0207652_1000028342 167
171 3300025921 Ga0207652_10000735 Ga0207652_1000073530 167
172 3300025923 Ga0207681_10133701 Ga0207681_101337012 167
173 3300025926 Ga0207659_10000018 Ga0207659_1000001891 167
174 3300025927 Ga0207687_10000189 Ga0207687_1000018938 167
175 3300025936 Ga0207670_10153590 Ga0207670_101535903 167
176 3300025944 Ga0207661_10000235 Ga0207661_100002354 167
177 3300025944 Ga0207661_10058618 Ga0207661_100586182 167
178 3300025960 Ga0207651_10030239 Ga0207651_100302393 167
179 3300025961 Ga0207712_10000003 Ga0207712_1000000327 167
180 3300026067 Ga0207678_10006624 Ga0207678_100066244 167
181 3300026078 Ga0207702_10006648 Ga0207702_100066484 167
182 3300026095 Ga0207676_10000038 Ga0207676_1000003848 167
183 3300032002 Ga0307416_100045545 Ga0307416_1000455455 167
184 3300037466 Ga0395898_0452903 Ga0395898_0452903_13_534 167
185 3300041512 Ga0451853_0748562 Ga0451853_0748562_134_673 167
186 3300046517 Ga0495630_0000062 Ga0495630_0000062_28895_29422 167
187 3300048911 Ga0496108_0014921 Ga0496108_0014921_4399_4926 167
188 3300048912 Ga0496109_0000066 Ga0496109_0000066_98883_99410 167
189 3300048915 Ga0496112_0000006 Ga0496112_0000006_215452_216003 167
190 3300049573 Ga0501037_0145735 Ga0501037_0145735_736_1266 167
191 3300049575 Ga0501039_0176911 Ga0501039_0176911_235_765 167
192 3300049576 Ga0501040_0066626 Ga0501040_0066626_556_1086 167
193 3300049577 Ga0501041_0138858 Ga0501041_0138858_758_1288 167
194 3300049582 Ga0501048_0117222 Ga0501048_0117222_949_1479 167
195 3300049587 Ga0501071_0032817 Ga0501071_0032817_2733_3263 167
196 3300049588 Ga0501072_0090862 Ga0501072_0090862_888_1418 167
197 3300049590 Ga0501074_0234641 Ga0501074_0234641_423_953 167
198 3300053083 Ga0495655_0000004 Ga0495655_0000004_28121_28636 167
199 3300053129 Ga0500628_000049 Ga0500628_000049_28061_28576 167
200 3300054114 Ga0501084_1241104 Ga0501084_1241104_32_562 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07098

DUF1360

Protein of unknown function (DUF1360)

76

175

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hh3-assembly1.cif.gz_A solution structure of the third kh domain of ksrp 0.4337 65 122
7r97-assembly1.cif.gz_B crystal structure of postcleavge complex of escherichia coli rnase iii 0.4118 24 151
2hh3-assembly1.cif.gz_A solution structure of the third kh domain of ksrp 0.378 65 122
4nck-assembly1.cif.gz_A crystal structure of pyrococcus furiosis rad50 r797g mutation 0.3444 55 135
4nci-assembly1.cif.gz_A crystal structure of pyrococcus furiosis rad50 r805e mutation 0.3409 55 133
ID Description Score Start End Superfamily
af_A0A0G2JVW3_1637_1709_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.4636 66 114 3.30.1370.10
af_Q9VZE4_271_336_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.4488 74 112 3.30.70.330
af_Q9SU25_565_634_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.4437 76 102 1.10.10.10
af_Q95XD8_1_56_3.30.1490.10 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.4417 64 100 3.30.1490.10
2hh3A00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.4337 65 122 3.30.1370.10
ID Description Score Start End GO Terms
AF-A0A1I5LQW5-F1-model_v4 DUF1360 domain-containing protein 0.9761 18 163
AF-A0A838D8L9-F1-model_v4 DUF1360 domain-containing protein 0.9723 52 162
AF-X8E943-F1-model_v4 DUF1360 domain-containing protein 0.9713 28 133
AF-A0A098BUF4-F1-model_v4 DUF1360 domain-containing protein 0.9699 15 164 GO:0016020
AF-A0A810MEG6-F1-model_v4 deleted 0.9697 19 167

Feature Viewer

pLDDT pTM Quality
87.89 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map