F306401

General Info

Members Datasets Scaffolds Average Seq Length
199 131 179 236

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_701_c1|nmdc:mga0yw44_701_c1_8010_8708
Length 222
Sequence MARSLRLGVAGPVGTGKSSLIATVCRALASELSLGVVTNDIYTDEDARFLRSEGILAEDRIRAVETGACPHTAIRDDVTPNLIAVETLEADYPLDVVLVESGGDNLTATFSPALVDAQLFVLDVAGGGDVARKGGPGIARADLLVVNKTDLGPYVGVDVERMVADATLARDGRPVLALSRTDPASVAALADWVRAMLAAHRSGAHTPVDPGPMAPHTHADGT

Samples

Sample ID Description Type Environment
1 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
2 2643221590 Nocardioides sp. Root682 Isolate Unclassified
3 2643221604 Nocardioides sp. Root190 Isolate Unclassified
4 2643221617 Nocardioides sp. Root79 Isolate Unclassified
5 2643221620 Nocardioides sp. Root240 Isolate Unclassified
6 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
7 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
8 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
9 2738541305 Nocardioides sp. CF167 Isolate Unclassified
10 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
11 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
12 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
13 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
14 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
15 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
16 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
17 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
18 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
19 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
57 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
68 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
69 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
70 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
71 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
72 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
73 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
84 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
107 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
108 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
109 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
122 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
123 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
124 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
125 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
126 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
127 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
128 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
130 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
131 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.45
Metatranscriptomes 0.5
Isolates 10.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.63
Nodule 0
Rhizoplane 15.58
Rhizosphere 37.69
Stem 0
Stem Tuber 0
Unclassified 20.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10080918 3300001979 Bacteria 851
2 JGI24739J22299_10065938 3300001989 Bacteria 1134
3 JGI24735J21928_10058269 3300002067 Bacteria 1111
4 Ga0006562J51391_1149914 3300003578 Bacteria 1154
5 Ga0070682_100104231 3300005337 Bacteria 1878
6 Ga0070678_100061081 3300005456 Bacteria 2777
7 Ga0070678_100410695 3300005456 Bacteria 1178
8 Ga0070684_100312907 3300005535 Bacteria 1442
9 Ga0070672_100100349 3300005543 Bacteria 2347
10 Ga0068861_100186084 3300005719 Bacteria 1732
11 Ga0068860_100026162 3300005843 Bacteria 5628
12 Ga0075365_10000542 3300006038 Bacteria 14523
13 Ga0075365_10001156 3300006038 Bacteria 11573
14 Ga0075365_10001183 3300006038 Bacteria 11479
15 Ga0075365_10058899 3300006038 Bacteria 2558
16 Ga0075365_10072637 3300006038 Bacteria 2318
17 Ga0075365_10131200 3300006038 Bacteria 1734
18 Ga0075365_10216039 3300006038 Bacteria 1345
19 Ga0075365_10304020 3300006038 Bacteria 1123
20 Ga0075365_10493199 3300006038 Bacteria 866
21 Ga0075368_10000441 3300006042 Bacteria 12237
22 Ga0075368_10023467 3300006042 Bacteria 2356
23 Ga0075363_100003339 3300006048 Bacteria 6811
24 Ga0075363_100005326 3300006048 Bacteria 5711
25 Ga0075363_100152054 3300006048 Bacteria 1307
26 Ga0075363_100246634 3300006048 Bacteria 1028
27 Ga0075364_10012965 3300006051 Bacteria 5116
28 Ga0075364_10072795 3300006051 Bacteria 2265
29 Ga0075364_10133527 3300006051 Bacteria 1667
30 Ga0075364_10327638 3300006051 Bacteria 1043
31 Ga0075364_10441022 3300006051 Bacteria 889
32 Ga0075362_10002113 3300006177 Bacteria 6565
33 Ga0075367_10022759 3300006178 Bacteria 3518
34 Ga0075367_10056911 3300006178 Bacteria 2324
35 Ga0075367_10259679 3300006178 Bacteria 1090
36 Ga0075367_10281314 3300006178 Bacteria 1046
37 Ga0075367_10303933 3300006178 Bacteria 1004
38 Ga0075369_10056524 3300006186 Bacteria 1706
39 Ga0075370_10003967 3300006353 Bacteria 7110
40 Ga0075370_10004029 3300006353 Bacteria 7063
41 Ga0075370_10047766 3300006353 Bacteria 2424
42 Ga0105245_10088996 3300009098 Bacteria 2837
43 Ga0105248_10938682 3300009177 Bacteria 977
44 Ga0105249_10678070 3300009553 Bacteria 1090
45 Ga0157371_10202803 3300013102 Bacteria 1422
46 Ga0157375_10257615 3300013308 Bacteria 1906
47 Ga0163161_10289984 3300017792 Bacteria 1286
48 Ga0207647_10047103 3300025904 Bacteria 2683
49 Ga0207687_10140563 3300025927 Bacteria 1831
50 Ga0207709_10341597 3300025935 Bacteria 1127
51 Ga0207661_10519645 3300025944 Bacteria 1089
52 Ga0207712_10337928 3300025961 Bacteria 1248
53 Ga0207658_10008613 3300025986 Bacteria 6939
54 Ga0207676_10321036 3300026095 Bacteria 1422
55 Ga0207683_10068554 3300026121 Bacteria 3132
56 Ga0207683_10099990 3300026121 Bacteria 2589
57 Ga0207698_10533340 3300026142 Bacteria 1147
58 Ga0207698_10683951 3300026142 Bacteria 1019
59 Ga0209813_10049977 3300027866 Bacteria 1303
60 Ga0268264_10000320 3300028381 Bacteria 75931
61 Ga0307515_10327601 3300028794 Bacteria 1193
62 Ga0307512_10171779 3300030522 Bacteria 1241
63 Ga0316181_1261724 3300030744 Bacteria 846
64 Ga0307513_10335039 3300031456 Bacteria 1266
65 Ga0307410_10051933 3300031852 Bacteria 2766
66 Ga0307410_10468698 3300031852 Bacteria 1031
67 Ga0307406_10024725 3300031901 Bacteria 3590
68 Ga0307406_10226727 3300031901 Bacteria 1392
69 Ga0307406_10571033 3300031901 Bacteria 928
70 Ga0307412_10330256 3300031911 Bacteria 1217
71 Ga0307409_100003814 3300031995 Bacteria 8314
72 Ga0307409_100231721 3300031995 Bacteria 1675
73 Ga0307416_100223501 3300032002 Bacteria 1808
74 Ga0307416_100371264 3300032002 Bacteria 1457
75 Ga0307416_100397246 3300032002 Bacteria 1415
76 Ga0307414_10027167 3300032004 Bacteria 3695
77 Ga0307414_10634877 3300032004 Bacteria 961
78 Ga0307415_100071237 3300032126 Bacteria 2444
79 Ga0395905_0333211 3300037471 Bacteria 1408
80 Ga0451789_1279316 3300041443 Bacteria 1404
81 Ga0451793_0250873 3300041452 Bacteria 11336
82 Ga0451797_1417640 3300041453 Bacteria 2019
83 Ga0451802_1633470 3300041460 Bacteria 986
84 Ga0451837_0798171 3300041494 Bacteria 814
85 Ga0451839_1576189 3300041496 Bacteria 1250
86 Ga0451843_1174748 3300041509 Bacteria 1527
87 Ga0451853_3145738 3300041512 Bacteria 1524
88 Ga0439440_0060531 3300042993 Bacteria 966
89 Ga0466965_0151500 3300044683 Bacteria 1212
90 Ga0466961_0090008 3300044693 Bacteria 1938
91 Ga0466964_0218035 3300044706 Bacteria 925
92 Ga0466970_0000017 3300044765 Bacteria 64907
93 Ga0466970_0046639 3300044765 Bacteria 2308
94 Ga0466957_0009709 3300044842 Bacteria 5496
95 Ga0466957_0197027 3300044842 Bacteria 1322
96 Ga0466959_0280759 3300045049 Bacteria 1143
97 Ga0466967_0578794 3300045976 Bacteria 1107
98 Ga0495627_015145 3300046453 Bacteria 2669
99 Ga0495641_0085831 3300046461 Bacteria 1409
100 Ga0495651_0396059 3300046462 Bacteria 903
101 Ga0495608_0054315 3300046511 Bacteria 2648
102 Ga0495645_0026481 3300046543 Bacteria 4209
103 Ga0495657_0187143 3300046675 Bacteria 1267
104 Ga0495581_0112536 3300047315 Bacteria 1583
105 Ga0495581_0114304 3300047315 Bacteria 1570
106 Ga0495674_0069756 3300047319 Bacteria 3039
107 Ga0495676_0235793 3300047321 Bacteria 1255
108 Ga0495680_0206627 3300047322 Bacteria 1407
109 Ga0495686_0053957 3300047472 Bacteria 2518
110 Ga0496100_0075731 3300048903 Bacteria 2258
111 Ga0496100_0098196 3300048903 Bacteria 2013
112 Ga0496100_0196515 3300048903 Bacteria 1467
113 Ga0496100_0342291 3300048903 Bacteria 1128
114 Ga0496100_0453620 3300048903 Bacteria 983
115 Ga0496101_0178244 3300048904 Bacteria 1636
116 Ga0496102_0010874 3300048905 Bacteria 7836
117 Ga0496102_0194011 3300048905 Bacteria 1914
118 Ga0496103_0128277 3300048906 Bacteria 1619
119 Ga0496104_0280534 3300048907 Bacteria 1579
120 Ga0496105_0004507 3300048908 Bacteria 10485
121 Ga0496105_0014116 3300048908 Bacteria 6356
122 Ga0496106_0330048 3300048909 Bacteria 1225
123 Ga0496106_0411650 3300048909 Bacteria 1087
124 Ga0496108_0002674 3300048911 Bacteria 14276
125 Ga0496108_0038244 3300048911 Bacteria 3997
126 Ga0496109_0001189 3300048912 Bacteria 21617
127 Ga0496109_0260296 3300048912 Bacteria 1634
128 Ga0496110_0003192 3300048913 Bacteria 12476
129 Ga0496110_0294559 3300048913 Bacteria 1478
130 Ga0496111_0121184 3300048914 Bacteria 1932
131 Ga0496114_0041125 3300048917 Bacteria 3831
132 Ga0496114_0059986 3300048917 Bacteria 3179
133 Ga0496114_0125151 3300048917 Bacteria 2215
134 Ga0496114_0226221 3300048917 Bacteria 1643
135 Ga0496114_0443986 3300048917 Bacteria 1149
136 Ga0496114_0625606 3300048917 Bacteria 948
137 Ga0496117_0000070 3300048920 Bacteria 245027
138 Ga0496117_0015492 3300048920 Bacteria 6493
139 Ga0496118_0003930 3300048921 Bacteria 18181
140 Ga0496119_0001612 3300048922 Bacteria 26721
141 Ga0496119_0001840 3300048922 Bacteria 24534
142 Ga0496119_0002510 3300048922 Bacteria 20042
143 Ga0496120_0003507 3300048923 Bacteria 14216
144 Ga0496120_0041502 3300048923 Bacteria 2694
145 Ga0496120_0223839 3300048923 Bacteria 897
146 Ga0496122_0000105 3300048925 Bacteria 194509
147 Ga0496123_0000075 3300048926 Bacteria 194499
148 Ga0496123_0010411 3300048926 Bacteria 8221
149 Ga0496124_0005871 3300048927 Bacteria 13593
150 Ga0496124_0011954 3300048927 Bacteria 8637
151 Ga0496124_0056469 3300048927 Bacteria 3311
152 Ga0496125_0009962 3300048928 Bacteria 9658
153 Ga0496126_0006708 3300048929 Bacteria 12785
154 Ga0496126_0020639 3300048929 Bacteria 6453
155 Ga0501039_0270659 3300049575 Bacteria 1335
156 Ga0501067_0087352 3300049583 Bacteria 1730
157 Ga0501070_0000902 3300049586 Bacteria 27057
158 nmdc:mga00v17_266837_c1 3300050491 Bacteria 1111
159 nmdc:mga00v17_783_c1 3300050491 Bacteria 17290
160 nmdc:mga0yw44_11081_c1 3300050492 Bacteria 4635
161 nmdc:mga0yw44_156046_c1 3300050492 Bacteria 1492
162 nmdc:mga0yw44_197500_c1 3300050492 Bacteria 1328
163 nmdc:mga0yw44_3639_c1 3300050492 Bacteria 6890
164 nmdc:mga0yw44_486_c1 3300050492 Bacteria 14148
165 nmdc:mga0yw44_701_c1 3300050492 Bacteria 12279
166 nmdc:mga06z11_114548_c1 3300050494 Bacteria 1497
167 Ga0500643_000325 3300053087 Bacteria 38363
168 Ga0500644_0000011 3300053088 Bacteria 125595
169 Ga0500556_0000041 3300053104 Bacteria 134317
170 Ga0500556_0000064 3300053104 Bacteria 109213
171 Ga0500562_023272 3300053108 Bacteria 1616
172 Ga0500593_000759 3300053117 Bacteria 12108
173 Ga0500655_021916 3300053133 Bacteria 1200
174 Ga0500559_0000968 3300053136 Bacteria 17981
175 Ga0500568_0000003 3300053139 Bacteria 863587
176 Ga0500616_0000090 3300053153 Bacteria 187734
177 Ga0500616_0002328 3300053153 Bacteria 16023
178 Ga0500616_0118394 3300053153 Bacteria 1269
179 Ga0500645_003819 3300053730 Bacteria 5985

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10304020 Ga0075365_103040201 214
2 3300053087 Ga0500643_000325 Ga0500643_000325_4713_5423 214
3 3300048909 Ga0496106_0411650 Ga0496106_0411650_272_1000 215
4 3300005843 Ga0068860_100026162 Ga0068860_1000261624 216
5 3300006038 Ga0075365_10072637 Ga0075365_100726373 216
6 3300006178 Ga0075367_10056911 Ga0075367_100569113 216
7 3300006353 Ga0075370_10004029 Ga0075370_100040296 216
8 3300028381 Ga0268264_10000320 Ga0268264_100003203 216
9 3300050491 nmdc:mga00v17_266837_c1 nmdc:mga00v17_266837_c1_120_839 216
10 3300053088 Ga0500644_0000011 Ga0500644_0000011_1271_1969 216
11 3300006038 Ga0075365_10001156 Ga0075365_1000115610 217
12 3300006038 Ga0075365_10058899 Ga0075365_100588993 217
13 3300006038 Ga0075365_10216039 Ga0075365_102160392 217
14 3300006038 Ga0075365_10493199 Ga0075365_104931991 217
15 3300006048 Ga0075363_100003339 Ga0075363_1000033396 217
16 3300006051 Ga0075364_10133527 Ga0075364_101335272 217
17 3300006178 Ga0075367_10259679 Ga0075367_102596792 217
18 3300046462 Ga0495651_0396059 Ga0495651_0396059_23_694 217
19 3300050492 nmdc:mga0yw44_11081_c1 nmdc:mga0yw44_11081_c1_2481_3176 217
20 3300050492 nmdc:mga0yw44_197500_c1 nmdc:mga0yw44_197500_c1_582_1265 217
21 3300050492 nmdc:mga0yw44_486_c1 nmdc:mga0yw44_486_c1_6179_6859 217
22 3300006051 Ga0075364_10441022 Ga0075364_104410222 218
23 3300048903 Ga0496100_0453620 Ga0496100_0453620_258_938 218
24 3300048928 Ga0496125_0009962 Ga0496125_0009962_4875_5612 218
25 3300053153 Ga0500616_0000090 Ga0500616_0000090_49922_50644 218
26 3300005535 Ga0070684_100312907 Ga0070684_1003129072 219
27 3300005543 Ga0070672_100100349 Ga0070672_1001003492 219
28 3300006042 Ga0075368_10023467 Ga0075368_100234672 219
29 3300006048 Ga0075363_100005326 Ga0075363_1000053265 219
30 3300006178 Ga0075367_10303933 Ga0075367_103039332 219
31 3300009553 Ga0105249_10678070 Ga0105249_106780702 219
32 3300046543 Ga0495645_0026481 Ga0495645_0026481_663_1370 219
33 3300005719 Ga0068861_100186084 Ga0068861_1001860842 220
34 3300009177 Ga0105248_10938682 Ga0105248_109386822 220
35 3300025961 Ga0207712_10337928 Ga0207712_103379282 220
36 3300026095 Ga0207676_10321036 Ga0207676_103210362 220
37 3300026121 Ga0207683_10068554 Ga0207683_100685543 220
38 3300041453 Ga0451797_1417640 Ga0451797_1417640_28_744 220
39 3300041460 Ga0451802_1633470 Ga0451802_1633470_234_950 220
40 3300041494 Ga0451837_0798171 Ga0451837_0798171_62_778 220
41 3300046461 Ga0495641_0085831 Ga0495641_0085831_561_1283 220
42 3300048903 Ga0496100_0098196 Ga0496100_0098196_320_1042 220
43 3300048927 Ga0496124_0056469 Ga0496124_0056469_152_847 220
44 3300053730 Ga0500645_003819 Ga0500645_003819_1648_2358 220
45 3300006038 Ga0075365_10000542 Ga0075365_1000054212 221
46 3300006048 Ga0075363_100152054 Ga0075363_1001520541 221
47 3300006051 Ga0075364_10012965 Ga0075364_100129656 221
48 3300009098 Ga0105245_10088996 Ga0105245_100889962 221
49 3300025986 Ga0207658_10008613 Ga0207658_100086133 221
50 3300030744 Ga0316181_1261724 Ga0316181_12617241 221
51 3300048903 Ga0496100_0342291 Ga0496100_0342291_273_1016 221
52 3300048911 Ga0496108_0038244 Ga0496108_0038244_537_1223 221
53 3300048913 Ga0496110_0294559 Ga0496110_0294559_481_1167 221
54 3300048917 Ga0496114_0041125 Ga0496114_0041125_2683_3369 221
55 3300048923 Ga0496120_0223839 Ga0496120_0223839_33_797 221
56 3300050491 nmdc:mga00v17_783_c1 nmdc:mga00v17_783_c1_194_949 221
57 3300050492 nmdc:mga0yw44_156046_c1 nmdc:mga0yw44_156046_c1_101_766 221
58 3300050492 nmdc:mga0yw44_701_c1 nmdc:mga0yw44_701_c1_8010_8708 221
59 3300006048 Ga0075363_100246634 Ga0075363_1002466342 222
60 3300046511 Ga0495608_0054315 Ga0495608_0054315_909_1703 222
61 3300047315 Ga0495581_0114304 Ga0495581_0114304_534_1325 222
62 3300047319 Ga0495674_0069756 Ga0495674_0069756_304_1098 222
63 3300047322 Ga0495680_0206627 Ga0495680_0206627_478_1272 222
64 3300048920 Ga0496117_0000070 Ga0496117_0000070_22848_23579 222
65 3300048922 Ga0496119_0001612 Ga0496119_0001612_21159_21890 222
66 3300048923 Ga0496120_0003507 Ga0496120_0003507_4838_5569 222
67 3300048927 Ga0496124_0011954 Ga0496124_0011954_4787_5518 222
68 3300025935 Ga0207709_10341597 Ga0207709_103415972 223
69 3300048908 Ga0496105_0004507 Ga0496105_0004507_1380_2213 223
70 3300048912 Ga0496109_0260296 Ga0496109_0260296_782_1474 223
71 3300048914 Ga0496111_0121184 Ga0496111_0121184_86_778 223
72 3300048926 Ga0496123_0010411 Ga0496123_0010411_4874_5599 223
73 3300048929 Ga0496126_0006708 Ga0496126_0006708_8374_9105 223
74 3300046453 Ga0495627_015145 Ga0495627_015145_1508_2206 224
75 3300006038 Ga0075365_10131200 Ga0075365_101312002 225
76 3300006051 Ga0075364_10072795 Ga0075364_100727952 225
77 3300006178 Ga0075367_10281314 Ga0075367_102813142 225
78 3300041496 Ga0451839_1576189 Ga0451839_1576189_316_1032 225
79 3300044765 Ga0466970_0000017 Ga0466970_0000017_58021_58779 225
80 3300044842 Ga0466957_0009709 Ga0466957_0009709_1213_1971 225
81 3300045049 Ga0466959_0280759 Ga0466959_0280759_332_1090 225
82 3300046675 Ga0495657_0187143 Ga0495657_0187143_521_1246 225
83 3300049583 Ga0501067_0087352 Ga0501067_0087352_119_799 225
84 3300050492 nmdc:mga0yw44_3639_c1 nmdc:mga0yw44_3639_c1_3161_3841 225
85 3300053133 Ga0500655_021916 Ga0500655_021916_164_901 225
86 3300053153 Ga0500616_0118394 Ga0500616_0118394_22_756 225
87 3300003578 Ga0006562J51391_1149914 Ga0006562J51391_11499142 226
88 3300031852 Ga0307410_10468698 Ga0307410_104686982 226
89 3300047472 Ga0495686_0053957 Ga0495686_0053957_581_1327 226
90 3300048929 Ga0496126_0020639 Ga0496126_0020639_5407_6216 226
91 3300053104 Ga0500556_0000041 Ga0500556_0000041_85860_86606 226
92 3300053139 Ga0500568_0000003 Ga0500568_0000003_364956_365702 226
93 iso_pu_bacteria 2919446982 2919449207 226
94 3300041443 Ga0451789_1279316 Ga0451789_1279316_45_842 227
95 3300041452 Ga0451793_0250873 Ga0451793_0250873_8302_9099 227
96 3300041509 Ga0451843_1174748 Ga0451843_1174748_256_1053 227
97 iso_pu_bacteria 2643221567 2643851281 227
98 iso_pu_bacteria 2643221624 2644138152 227
99 iso_pu_bacteria 2738541305 2738868381 227
100 3300032002 Ga0307416_100371264 Ga0307416_1003712642 228
101 iso_pu_bacteria 2643221617 2644101766 228
102 iso_pu_bacteria 2643221620 2644115828 228
103 iso_pu_bacteria 2848551377 2848551450 228
104 3300001989 JGI24739J22299_10065938 JGI24739J22299_100659382 229
105 3300002067 JGI24735J21928_10058269 JGI24735J21928_100582692 229
106 3300013308 Ga0157375_10257615 Ga0157375_102576152 229
107 3300047315 Ga0495581_0112536 Ga0495581_0112536_837_1568 229
108 3300048903 Ga0496100_0075731 Ga0496100_0075731_1334_2044 229
109 3300048905 Ga0496102_0010874 Ga0496102_0010874_844_1575 229
110 3300048906 Ga0496103_0128277 Ga0496103_0128277_710_1441 229
111 3300048917 Ga0496114_0059986 Ga0496114_0059986_955_1791 229
112 3300048917 Ga0496114_0125151 Ga0496114_0125151_1080_1811 229
113 3300048917 Ga0496114_0625606 Ga0496114_0625606_158_868 229
114 iso_pu_bacteria 2728369276 2729907831 229
115 3300006038 Ga0075365_10001183 Ga0075365_100011836 230
116 3300006042 Ga0075368_10000441 Ga0075368_1000044110 230
117 3300006177 Ga0075362_10002113 Ga0075362_100021133 230
118 3300006353 Ga0075370_10003967 Ga0075370_100039678 230
119 3300048904 Ga0496101_0178244 Ga0496101_0178244_288_1163 230
120 3300048907 Ga0496104_0280534 Ga0496104_0280534_611_1486 230
121 3300048911 Ga0496108_0002674 Ga0496108_0002674_1223_2224 230
122 3300048912 Ga0496109_0001189 Ga0496109_0001189_1174_2175 230
123 3300048913 Ga0496110_0003192 Ga0496110_0003192_10294_11253 230
124 3300048917 Ga0496114_0226221 Ga0496114_0226221_295_1143 230
125 3300048917 Ga0496114_0443986 Ga0496114_0443986_343_1071 230
126 iso_pu_bacteria 2827628540 2827632800 230
127 3300005337 Ga0070682_100104231 Ga0070682_1001042312 231
128 3300005456 Ga0070678_100410695 Ga0070678_1004106951 231
129 3300025904 Ga0207647_10047103 Ga0207647_100471032 231
130 3300025927 Ga0207687_10140563 Ga0207687_101405632 231
131 3300025944 Ga0207661_10519645 Ga0207661_105196451 231
132 3300026142 Ga0207698_10533340 Ga0207698_105333402 231
133 3300026142 Ga0207698_10683951 Ga0207698_106839512 231
134 3300037471 Ga0395905_0333211 Ga0395905_0333211_372_1082 231
135 3300042993 Ga0439440_0060531 Ga0439440_0060531_69_788 231
136 3300044683 Ga0466965_0151500 Ga0466965_0151500_451_1161 231
137 3300044693 Ga0466961_0090008 Ga0466961_0090008_701_1411 231
138 3300044706 Ga0466964_0218035 Ga0466964_0218035_139_849 231
139 3300044765 Ga0466970_0046639 Ga0466970_0046639_1361_2071 231
140 3300044842 Ga0466957_0197027 Ga0466957_0197027_42_752 231
141 3300045976 Ga0466967_0578794 Ga0466967_0578794_278_988 231
142 3300048903 Ga0496100_0196515 Ga0496100_0196515_552_1319 231
143 3300048905 Ga0496102_0194011 Ga0496102_0194011_602_1369 231
144 3300048908 Ga0496105_0014116 Ga0496105_0014116_247_1014 231
145 3300048909 Ga0496106_0330048 Ga0496106_0330048_235_1002 231
146 iso_pu_bacteria 2643221590 2643962580 231
147 iso_pu_bacteria 2643221604 2644035527 231
148 iso_pu_bacteria 2852643534 2852643733 231
149 iso_pu_bacteria 2887443736 2887444713 231
150 3300032002 Ga0307416_100397246 Ga0307416_1003972461 232
151 iso_pu_bacteria 2738541272 2738692644 232
152 iso_pu_bacteria 2738543027 2739323721 232
153 iso_pu_bacteria 2773857763 2774399457 232
154 iso_pu_bacteria 2784132109 2784471018 232
155 iso_pu_bacteria 2946041624 2946042836 232
156 iso_pu_bacteria 2974324384 2974325150 232
157 iso_pu_bacteria 8045830549 8045834061 232
158 3300031901 Ga0307406_10226727 Ga0307406_102267272 233
159 3300048925 Ga0496122_0000105 Ga0496122_0000105_88426_89202 233
160 3300048926 Ga0496123_0000075 Ga0496123_0000075_105315_106091 233
161 3300048927 Ga0496124_0005871 Ga0496124_0005871_7973_8749 233
162 3300053108 Ga0500562_023272 Ga0500562_023272_73_846 233
163 3300006051 Ga0075364_10327638 Ga0075364_103276382 234
164 3300006178 Ga0075367_10022759 Ga0075367_100227595 234
165 3300006186 Ga0075369_10056524 Ga0075369_100565242 234
166 3300006353 Ga0075370_10047766 Ga0075370_100477663 234
167 3300027866 Ga0209813_10049977 Ga0209813_100499772 234
168 3300031852 Ga0307410_10051933 Ga0307410_100519333 234
169 3300031995 Ga0307409_100003814 Ga0307409_1000038147 234
170 3300032002 Ga0307416_100223501 Ga0307416_1002235012 234
171 3300032004 Ga0307414_10027167 Ga0307414_100271674 234
172 3300050494 nmdc:mga06z11_114548_c1 nmdc:mga06z11_114548_c1_618_1388 234
173 3300001979 JGI24740J21852_10080918 JGI24740J21852_100809182 235
174 3300005456 Ga0070678_100061081 Ga0070678_1000610812 235
175 3300013102 Ga0157371_10202803 Ga0157371_102028032 235
176 3300017792 Ga0163161_10289984 Ga0163161_102899841 235
177 3300026121 Ga0207683_10099990 Ga0207683_100999903 235
178 3300028794 Ga0307515_10327601 Ga0307515_103276011 235
179 3300030522 Ga0307512_10171779 Ga0307512_101717792 235
180 3300031456 Ga0307513_10335039 Ga0307513_103350392 235
181 3300031901 Ga0307406_10024725 Ga0307406_100247252 235
182 3300031901 Ga0307406_10571033 Ga0307406_105710331 235
183 3300031911 Ga0307412_10330256 Ga0307412_103302562 235
184 3300031995 Ga0307409_100231721 Ga0307409_1002317212 235
185 3300032004 Ga0307414_10634877 Ga0307414_106348771 235
186 3300032126 Ga0307415_100071237 Ga0307415_1000712372 235
187 3300041512 Ga0451853_3145738 Ga0451853_3145738_83_898 235
188 3300047321 Ga0495676_0235793 Ga0495676_0235793_23_973 235
189 3300048920 Ga0496117_0015492 Ga0496117_0015492_4661_5437 235
190 3300048921 Ga0496118_0003930 Ga0496118_0003930_4450_5226 235
191 3300048922 Ga0496119_0001840 Ga0496119_0001840_13608_14384 235
192 3300048922 Ga0496119_0002510 Ga0496119_0002510_4295_5050 235
193 3300048923 Ga0496120_0041502 Ga0496120_0041502_269_1045 235
194 3300049575 Ga0501039_0270659 Ga0501039_0270659_399_1181 235
195 3300049586 Ga0501070_0000902 Ga0501070_0000902_26191_26973 235
196 3300053104 Ga0500556_0000064 Ga0500556_0000064_13171_13950 235
197 3300053117 Ga0500593_000759 Ga0500593_000759_11078_11857 235
198 3300053136 Ga0500559_0000968 Ga0500559_0000968_421_1203 235
199 3300053153 Ga0500616_0002328 Ga0500616_0002328_12603_13379 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

5

177

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xkt-assembly1.cif.gz_B klebsiella pneumoniae ureg in complex with gmppnp and nickel 0.9537 5 201
5xkt-assembly1.cif.gz_B klebsiella pneumoniae ureg in complex with gmppnp and nickel 0.9398 5 201
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.9368 7 197
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.9095 7 197
2hf9-assembly1.cif.gz_A crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form 0.8668 6 201
ID Description Score Start End Superfamily
af_O64700_71_266_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9474 5 198 3.40.50.300
af_O64700_71_266_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9289 5 198 3.40.50.300
af_A0A2R8Q8M0_77_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8861 6 33 3.40.50.300
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8426 6 200 3.40.50.300
2wsmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.83 6 200 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y0M8X9-F1-model_v4 Urease accessory protein UreG 0.9708 2 233 GO:0003924
GO:0005525
GO:0005737
GO:0016151
GO:0043419
AF-A0A6G6WL88-F1-model_v4 Urease accessory protein UreG 0.9693 4 221 GO:0003924
GO:0005525
GO:0005737
GO:0016151
GO:0043419
AF-A0A101N5X6-F1-model_v4 Urease accessory protein UreG 0.969 5 204 GO:0003924
GO:0005525
GO:0005737
GO:0016151
GO:0043419
AF-A0A1Q7WAC8-F1-model_v4 Urease accessory protein UreG 0.9687 5 151 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A652LST5-F1-model_v4 deleted 0.9657 7 221

Feature Viewer

pLDDT pTM Quality
88.14 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map