F306363

General Info

Members Datasets Scaffolds Average Seq Length
199 149 398 299

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0109388|Ga0501068_0109388_608_1636
Length 342
Sequence MQLGMIGLGRMGANMVRRLARDGHECVVYDVDPSVSAALAEEADGITAAASLEELAAGLSAPRHVWMMVPAGLVDEVIIDVLQHLDVDDTVIDGGNSNHKDDIRRAVELIDKGFHYVDVGVSGGVWGLENGYALMIGGEDEPVGRLEPIFRSLAPGSGTVLARTVGREGPPTTAEEGFLHCGPAGAGHFVKMVHNGIEYGLMAAYAEGINILASAGIGLSEHEHNAETAPMRNPEEYQYQFDLAEVVEVWRRGTVIRSWLVDLTANALFADPTLEGFEGRVSDSGEGRWTCEAAIETGVPAPVLTSALFERFSSRGRDDFAGRVLSAQRKQFGGHSELPGVS

Samples

Sample ID Description Type Environment
1 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
59 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
60 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
64 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
65 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
75 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
76 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
77 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
131 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
132 2643221576 Nocardioides sp. Root614 Isolate Unclassified
133 2643221590 Nocardioides sp. Root682 Isolate Unclassified
134 2643221604 Nocardioides sp. Root190 Isolate Unclassified
135 2643221617 Nocardioides sp. Root79 Isolate Unclassified
136 2643221620 Nocardioides sp. Root240 Isolate Unclassified
137 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
138 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
139 2738541305 Nocardioides sp. CF167 Isolate Unclassified
140 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
141 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
142 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
143 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
144 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
145 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
146 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
147 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
148 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
149 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.45
Metatranscriptomes 0.5
Isolates 9.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 0
Rhizoplane 7.54
Rhizosphere 74.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501068_0109388 3300049584 Bacteria 1717
2 JGI24739J22299_10028527 3300001989 Bacteria 1946
3 JGI24735J21928_10012489 3300002067 Bacteria 2684
4 JGI25406J46586_10032150 3300003203 Bacteria 1953
5 JGI25407J50210_10000225 3300003373 Bacteria 9774
6 Ga0006562J51391_1050105 3300003578 Bacteria 3230
7 Ga0070666_10005279 3300005335 Bacteria 7917
8 Ga0068868_100099950 3300005338 Bacteria 2347
9 Ga0070660_100043467 3300005339 Bacteria 3434
10 Ga0070669_100360478 3300005353 Bacteria 1182
11 Ga0070671_100019954 3300005355 Bacteria 5460
12 Ga0070674_100009759 3300005356 Bacteria 5768
13 Ga0070659_100057327 3300005366 Bacteria 3072
14 Ga0070667_100007173 3300005367 Bacteria 9261
15 Ga0070667_100441219 3300005367 Bacteria 1189
16 Ga0070708_100154412 3300005445 Bacteria 2136
17 Ga0070678_100003624 3300005456 Bacteria 8612
18 Ga0068867_100124339 3300005459 Bacteria 1997
19 Ga0068867_100492833 3300005459 Bacteria 1052
20 Ga0070686_100141176 3300005544 Bacteria 1677
21 Ga0070665_100010909 3300005548 Bacteria 9191
22 Ga0068856_100092410 3300005614 Bacteria 3011
23 Ga0068862_100050044 3300005844 Bacteria 3570
24 Ga0081538_10000330 3300005981 Bacteria 54129
25 Ga0081538_10001228 3300005981 Bacteria 26896
26 Ga0081538_10063670 3300005981 Bacteria 2092
27 Ga0081539_10000699 3300005985 Bacteria 67274
28 Ga0081539_10055950 3300005985 Bacteria 2192
29 Ga0075365_10142088 3300006038 Bacteria 1666
30 Ga0075364_10003653 3300006051 Bacteria 8776
31 Ga0075367_10007794 3300006178 Bacteria 5507
32 Ga0075366_10040220 3300006195 Bacteria 2765
33 Ga0068871_100082728 3300006358 Bacteria 2662
34 Ga0075428_100012587 3300006844 Bacteria 9405
35 Ga0075430_100024517 3300006846 Bacteria 5131
36 Ga0111539_10000263 3300009094 Bacteria 62668
37 Ga0114129_10449710 3300009147 Bacteria 1690
38 Ga0105243_10301694 3300009148 Bacteria 1452
39 Ga0105238_10113004 3300009551 Bacteria 2696
40 Ga0105239_10040949 3300010375 Bacteria 5077
41 Ga0105246_10016478 3300011119 Bacteria 4681
42 Ga0163162_10036679 3300013306 Bacteria 4888
43 Ga0157372_10036668 3300013307 Bacteria 5405
44 Ga0157372_10245157 3300013307 Bacteria 2079
45 Ga0157375_10119169 3300013308 Bacteria 2747
46 Ga0157375_10313903 3300013308 Bacteria 1732
47 Ga0163163_10663525 3300014325 Bacteria 1106
48 Ga0157376_10008952 3300014969 Bacteria 7250
49 Ga0207688_10152812 3300025901 Bacteria 1364
50 Ga0207647_10062331 3300025904 Bacteria 2272
51 Ga0207647_10064902 3300025904 Bacteria 2217
52 Ga0207657_10011820 3300025919 Bacteria 8644
53 Ga0207694_10135015 3300025924 Bacteria 1981
54 Ga0207690_10022680 3300025932 Bacteria 3907
55 Ga0207690_10033049 3300025932 Bacteria 3324
56 Ga0207709_10016379 3300025935 Bacteria 4119
57 Ga0207668_10004388 3300025972 Bacteria 8288
58 Ga0207658_10037196 3300025986 Bacteria 3495
59 Ga0207658_10048869 3300025986 Bacteria 3105
60 Ga0207658_10346836 3300025986 Bacteria 1292
61 Ga0207708_10374872 3300026075 Bacteria 1172
62 Ga0207648_10155252 3300026089 Bacteria 2020
63 Ga0207675_100257648 3300026118 Bacteria 1690
64 Ga0207683_10003558 3300026121 Bacteria 13588
65 Ga0207683_10061891 3300026121 Bacteria 3295
66 Ga0207683_10265772 3300026121 Bacteria 1567
67 Ga0207428_10001598 3300027907 Bacteria 23562
68 Ga0268266_10059222 3300028379 Bacteria 3299
69 Ga0268265_10049048 3300028380 Bacteria 3174
70 Ga0307515_10252548 3300028794 Bacteria 1513
71 Ga0307512_10061952 3300030522 Bacteria 2875
72 Ga0316181_1117254 3300030744 Bacteria 1194
73 Ga0316182_1097510 3300030745 Bacteria 1244
74 Ga0307513_10079289 3300031456 Bacteria 3393
75 Ga0307513_10105870 3300031456 Bacteria 2820
76 Ga0307408_100381843 3300031548 Bacteria 1204
77 Ga0307508_10027749 3300031616 Bacteria 5124
78 Ga0307508_10219133 3300031616 Bacteria 1503
79 Ga0307514_10093252 3300031649 Bacteria 2187
80 Ga0307516_10200932 3300031730 Bacteria 1713
81 Ga0307413_10263255 3300031824 Bacteria 1287
82 Ga0307410_10128061 3300031852 Bacteria 1861
83 Ga0307412_10142535 3300031911 Bacteria 1757
84 Ga0307409_100185907 3300031995 Bacteria 1844
85 Ga0307416_100163467 3300032002 Bacteria 2061
86 Ga0307416_100549222 3300032002 Bacteria 1228
87 Ga0373931_0073400 3300035691 Bacteria 1872
88 Ga0373937_0156229 3300036401 Bacteria 2138
89 Ga0395900_0011224 3300037418 Bacteria 9163
90 Ga0400484_25938 3300038725 Bacteria 1766
91 Ga0400484_44864 3300038725 Bacteria 7842
92 Ga0439440_0062393 3300042993 Bacteria 954
93 Ga0466972_0008429 3300044658 Bacteria 5168
94 Ga0466972_0055398 3300044658 Bacteria 1907
95 Ga0466965_0028724 3300044683 Bacteria 2703
96 Ga0466965_0029127 3300044683 Bacteria 2686
97 Ga0466965_0203660 3300044683 Bacteria 1050
98 Ga0466961_0081423 3300044693 Bacteria 2048
99 Ga0466961_0198229 3300044693 Bacteria 1242
100 Ga0466964_0066257 3300044706 Bacteria 1515
101 Ga0466971_0046883 3300044719 Bacteria 1942
102 Ga0466970_0002254 3300044765 Bacteria 9309
103 Ga0466970_0002325 3300044765 Bacteria 9197
104 Ga0466970_0006121 3300044765 Bacteria 5994
105 Ga0466957_0057722 3300044842 Bacteria 2376
106 Ga0466957_0077865 3300044842 Bacteria 2061
107 Ga0466957_0115315 3300044842 Bacteria 1708
108 Ga0466960_0019942 3300044901 Bacteria 2962
109 Ga0466960_0094008 3300044901 Bacteria 1533
110 Ga0466959_0143927 3300045049 Bacteria 1683
111 Ga0466959_0394427 3300045049 Bacteria 941
112 Ga0466958_0076642 3300045836 Bacteria 2053
113 Ga0466967_0041905 3300045976 Bacteria 3952
114 Ga0466967_0200519 3300045976 Bacteria 1890
115 Ga0466967_0358291 3300045976 Bacteria 1413
116 Ga0495592_0004823 3300046454 Bacteria 9914
117 Ga0495582_0165387 3300046473 Bacteria 1259
118 Ga0495585_0044474 3300046492 Bacteria 2481
119 Ga0495596_0080442 3300046500 Bacteria 1265
120 Ga0495625_0102048 3300046660 Bacteria 1969
121 Ga0495672_0027508 3300047320 Bacteria 3613
122 Ga0496101_0231801 3300048904 Bacteria 1435
123 Ga0496102_0019720 3300048905 Bacteria 5943
124 Ga0496102_0070059 3300048905 Bacteria 3220
125 Ga0496103_0157103 3300048906 Bacteria 1458
126 Ga0496104_0007844 3300048907 Bacteria 9461
127 Ga0496107_0024829 3300048910 Bacteria 4241
128 Ga0496108_0313196 3300048911 Bacteria 1368
129 Ga0496109_0171883 3300048912 Bacteria 2033
130 Ga0496110_0020063 3300048913 Bacteria 5637
131 Ga0496111_0044886 3300048914 Bacteria 3177
132 Ga0496111_0187484 3300048914 Bacteria 1538
133 Ga0496113_0010415 3300048916 Bacteria 6147
134 Ga0496113_0272743 3300048916 Bacteria 1352
135 Ga0496114_0011613 3300048917 Bacteria 7042
136 Ga0496115_0004989 3300048918 Bacteria 9637
137 Ga0501031_0013758 3300049568 Bacteria 5275
138 Ga0501032_0007849 3300049569 Bacteria 7773
139 Ga0501032_0027442 3300049569 Bacteria 3912
140 Ga0501033_0041654 3300049570 Bacteria 3425
141 Ga0501034_0002750 3300049571 Bacteria 20681
142 Ga0501034_0018273 3300049571 Bacteria 7191
143 Ga0501034_0026056 3300049571 Bacteria 5956
144 Ga0501034_0029574 3300049571 Bacteria 5570
145 Ga0501034_0235419 3300049571 Bacteria 1779
146 Ga0501036_0007232 3300049572 Bacteria 9040
147 Ga0501036_0011389 3300049572 Bacteria 7361
148 Ga0501036_0163167 3300049572 Bacteria 1878
149 Ga0501037_0002261 3300049573 Bacteria 13916
150 Ga0501038_0001929 3300049574 Bacteria 19155
151 Ga0501038_0023173 3300049574 Bacteria 5554
152 Ga0501039_0034997 3300049575 Bacteria 3876
153 Ga0501042_0063686 3300049578 Bacteria 2635
154 Ga0501043_0006882 3300049579 Bacteria 9074
155 Ga0501043_0160380 3300049579 Bacteria 1757
156 Ga0501046_0015083 3300049580 Bacteria 6498
157 Ga0501046_0051917 3300049580 Bacteria 3233
158 Ga0501046_0140213 3300049580 Bacteria 1830
159 Ga0501047_0009741 3300049581 Bacteria 9083
160 Ga0501047_0201823 3300049581 Bacteria 1849
161 Ga0501048_0005697 3300049582 Bacteria 9468
162 Ga0501048_0080379 3300049582 Bacteria 2300
163 Ga0501067_0117797 3300049583 Bacteria 1477
164 Ga0501070_0004389 3300049586 Bacteria 12117
165 Ga0501070_0035912 3300049586 Bacteria 4139
166 Ga0501075_0495840 3300049591 Bacteria 932
167 Ga0501080_0023405 3300049742 Bacteria 5726
168 Ga0501035_0021590 3300049822 Bacteria 5920
169 Ga0501035_0295721 3300049822 Bacteria 1365
170 Ga0501044_0008898 3300049823 Bacteria 10973
171 Ga0501044_0030805 3300049823 Bacteria 5650
172 Ga0501044_0094902 3300049823 Bacteria 3006
173 Ga0501045_0197371 3300049824 Bacteria 1499
174 nmdc:mga03n38_188653_c1 3300050490 Bacteria 1061
175 nmdc:mga00v17_1107_c1 3300050491 Bacteria 14172
176 nmdc:mga0yw44_21907_c1 3300050492 Bacteria 3573
177 nmdc:mga05p37_738030_c1 3300050507 Bacteria 1087
178 nmdc:mga08y16_1112_c1 3300050511 Bacteria 26504
179 Ga0500641_0069216 3300053096 Bacteria 1483
180 Ga0466962_0072307 3300061719 Bacteria 1648
181 Ga0466962_0209179 3300061719 Bacteria 954
182 2643891060 2643221576 Bacteria 5214352
183 2643960116 2643221590 Bacteria 5214697
184 2644035058 2643221604 Bacteria 5014917
185 2644101266 2643221617 Bacteria 5139111
186 2644119328 2643221620 Bacteria 5134593
187 2645721493 2643221961 Bacteria 3919167
188 2645724534 2643221962 Bacteria 3874254
189 2738868802 2738541305 Bacteria 4910150
190 2774395444 2773857762 Bacteria 5971770
191 2785372803 2784746768 Bacteria 10036182
192 2809193724 2808606439 Bacteria 5952208
193 2812348451 2811994878 Bacteria 5992952
194 2816422281 2816332119 Bacteria 8120218
195 2862709107 2862705112 Bacteria 6563286
196 2891973812 2891968417 Bacteria 5821697
197 2990049901 2990044586 Bacteria 6603797
198 8008486022 8008485437 Bacteria 7198341
199 8025525338 8025524527 Bacteria 7197316
200 Ga0501068_0109388
201 JGI24739J22299_10028527
202 JGI24735J21928_10012489
203 JGI25406J46586_10032150
204 JGI25407J50210_10000225
205 Ga0006562J51391_1050105
206 Ga0070666_10005279
207 Ga0068868_100099950
208 Ga0070660_100043467
209 Ga0070669_100360478
210 Ga0070671_100019954
211 Ga0070674_100009759
212 Ga0070659_100057327
213 Ga0070667_100007173
214 Ga0070667_100441219
215 Ga0070708_100154412
216 Ga0070678_100003624
217 Ga0068867_100124339
218 Ga0068867_100492833
219 Ga0070686_100141176
220 Ga0070665_100010909
221 Ga0068856_100092410
222 Ga0068862_100050044
223 Ga0081538_10000330
224 Ga0081538_10001228
225 Ga0081538_10063670
226 Ga0081539_10000699
227 Ga0081539_10055950
228 Ga0075365_10142088
229 Ga0075364_10003653
230 Ga0075367_10007794
231 Ga0075366_10040220
232 Ga0068871_100082728
233 Ga0075428_100012587
234 Ga0075430_100024517
235 Ga0111539_10000263
236 Ga0114129_10449710
237 Ga0105243_10301694
238 Ga0105238_10113004
239 Ga0105239_10040949
240 Ga0105246_10016478
241 Ga0163162_10036679
242 Ga0157372_10036668
243 Ga0157372_10245157
244 Ga0157375_10119169
245 Ga0157375_10313903
246 Ga0163163_10663525
247 Ga0157376_10008952
248 Ga0207688_10152812
249 Ga0207647_10062331
250 Ga0207647_10064902
251 Ga0207657_10011820
252 Ga0207694_10135015
253 Ga0207690_10022680
254 Ga0207690_10033049
255 Ga0207709_10016379
256 Ga0207668_10004388
257 Ga0207658_10037196
258 Ga0207658_10048869
259 Ga0207658_10346836
260 Ga0207708_10374872
261 Ga0207648_10155252
262 Ga0207675_100257648
263 Ga0207683_10003558
264 Ga0207683_10061891
265 Ga0207683_10265772
266 Ga0207428_10001598
267 Ga0268266_10059222
268 Ga0268265_10049048
269 Ga0307515_10252548
270 Ga0307512_10061952
271 Ga0316181_1117254
272 Ga0316182_1097510
273 Ga0307513_10079289
274 Ga0307513_10105870
275 Ga0307408_100381843
276 Ga0307508_10027749
277 Ga0307508_10219133
278 Ga0307514_10093252
279 Ga0307516_10200932
280 Ga0307413_10263255
281 Ga0307410_10128061
282 Ga0307412_10142535
283 Ga0307409_100185907
284 Ga0307416_100163467
285 Ga0307416_100549222
286 Ga0373931_0073400
287 Ga0373937_0156229
288 Ga0395900_0011224
289 Ga0400484_25938
290 Ga0400484_44864
291 Ga0439440_0062393
292 Ga0466972_0008429
293 Ga0466972_0055398
294 Ga0466965_0028724
295 Ga0466965_0029127
296 Ga0466965_0203660
297 Ga0466961_0081423
298 Ga0466961_0198229
299 Ga0466964_0066257
300 Ga0466971_0046883
301 Ga0466970_0002254
302 Ga0466970_0002325
303 Ga0466970_0006121
304 Ga0466957_0057722
305 Ga0466957_0077865
306 Ga0466957_0115315
307 Ga0466960_0019942
308 Ga0466960_0094008
309 Ga0466959_0143927
310 Ga0466959_0394427
311 Ga0466958_0076642
312 Ga0466967_0041905
313 Ga0466967_0200519
314 Ga0466967_0358291
315 Ga0495592_0004823
316 Ga0495582_0165387
317 Ga0495585_0044474
318 Ga0495596_0080442
319 Ga0495625_0102048
320 Ga0495672_0027508
321 Ga0496101_0231801
322 Ga0496102_0019720
323 Ga0496102_0070059
324 Ga0496103_0157103
325 Ga0496104_0007844
326 Ga0496107_0024829
327 Ga0496108_0313196
328 Ga0496109_0171883
329 Ga0496110_0020063
330 Ga0496111_0044886
331 Ga0496111_0187484
332 Ga0496113_0010415
333 Ga0496113_0272743
334 Ga0496114_0011613
335 Ga0496115_0004989
336 Ga0501031_0013758
337 Ga0501032_0007849
338 Ga0501032_0027442
339 Ga0501033_0041654
340 Ga0501034_0002750
341 Ga0501034_0018273
342 Ga0501034_0026056
343 Ga0501034_0029574
344 Ga0501034_0235419
345 Ga0501036_0007232
346 Ga0501036_0011389
347 Ga0501036_0163167
348 Ga0501037_0002261
349 Ga0501038_0001929
350 Ga0501038_0023173
351 Ga0501039_0034997
352 Ga0501042_0063686
353 Ga0501043_0006882
354 Ga0501043_0160380
355 Ga0501046_0015083
356 Ga0501046_0051917
357 Ga0501046_0140213
358 Ga0501047_0009741
359 Ga0501047_0201823
360 Ga0501048_0005697
361 Ga0501048_0080379
362 Ga0501067_0117797
363 Ga0501070_0004389
364 Ga0501070_0035912
365 Ga0501075_0495840
366 Ga0501080_0023405
367 Ga0501035_0021590
368 Ga0501035_0295721
369 Ga0501044_0008898
370 Ga0501044_0030805
371 Ga0501044_0094902
372 Ga0501045_0197371
373 nmdc:mga03n38_188653_c1
374 nmdc:mga00v17_1107_c1
375 nmdc:mga0yw44_21907_c1
376 nmdc:mga05p37_738030_c1
377 nmdc:mga08y16_1112_c1
378 Ga0500641_0069216
379 Ga0466962_0072307
380 Ga0466962_0209179
381 2643891060
382 2643960116
383 2644035058
384 2644101266
385 2644119328
386 2645721493
387 2645724534
388 2738868802
389 2774395444
390 2785372803
391 2809193724
392 2812348451
393 2816422281
394 2862709107
395 2891973812
396 2990049901
397 8008486022
398 8025525338

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

2

165

0.96

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

187

228

0.84

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

2

97

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.9706 2 28
6fph-assembly1.cif.gz_A the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1h 0.9552 1 31
3v3o-assembly1.cif.gz_A crystal structure of tetx2 t280a: an adaptive mutant in complex with tigecycline 0.9532 2 31
3p9u-assembly2.cif.gz_B crystal structure of tetx2 from bacteroides thetaiotaomicron with substrate analogue 0.9428 2 31
3p9u-assembly1.cif.gz_A crystal structure of tetx2 from bacteroides thetaiotaomicron with substrate analogue 0.9426 2 31
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9218 2 34 3.50.50.60
4e21A02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9049 163 284 1.10.1040.10
2vouC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9046 2 31 3.50.50.60
af_A0A1D6HVP3_65_283_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9018 2 33 3.50.50.60
af_Q4D0X5_1_185_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8981 1 170 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6I5GT67-F1-model_v4 NADP-dependent phosphogluconate dehydrogenase 0.9871 1 259 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661
AF-A0A5J5K627-F1-model_v4 Decarboxylating 6-phosphogluconate dehydrogenase 0.9845 1 296 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661
AF-A0A6I5GT67-F1-model_v4 NADP-dependent phosphogluconate dehydrogenase 0.9833 1 259 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661
AF-A0A6B1KQ78-F1-model_v4 6-phosphogluconate dehydrogenase 0.9823 1 184 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661
AF-A0A7Z0TM36-F1-model_v4 NADP-dependent phosphogluconate dehydrogenase 0.9808 82 293 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661

Map