F306309
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 199 | 158 | 188 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0010831|Ga0496126_0010831_6499_7380 |
| Length | 293 |
| Sequence | LLTVCRNVNASKPHSRIHKGRNTGGQQVSTAIELRRKWARGETVFGGWAALPCAFAAELMCVPGVGYVCIDQQHGLVDYADMVGMLRAIEGRGVVPLTRVPANENWIIGKALDAGAQGVVVPMVNNRAEAAAAVAACRYAPSGTRSFGPVRASMVLDSRDVAVVGDSMLCFVMVETRDAVQHIDEIASTPGLDGIYVGPADLALGLGLPPNLDKEEPEHVAAVARVLEACREHGIVAGIQCGSGRAARKFADKGFRFVTFAKDSSLIPSAMDKEVAAAFGDAAVPGTQQRGYA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 2 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 3 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 4 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 5 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 6 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 7 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 8 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 9 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 34 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 35 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 89 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 90 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 91 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 92 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 93 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 94 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 95 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 96 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 97 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 98 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 99 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 101 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 102 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 103 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 104 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 105 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 106 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 107 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 110 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 111 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 112 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 113 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 130 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 133 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 134 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 135 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 136 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 153 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 157 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 158 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.47 |
| Metatranscriptomes | 0 |
| Isolates | 5.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.5 |
| Nodule | 1.01 |
| Rhizoplane | 3.02 |
| Rhizosphere | 85.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068869_100421343 | 3300005334 | Bacteria | 1101 |
| 2 | Ga0068868_100050296 | 3300005338 | Bacteria | 3272 |
| 3 | Ga0070687_100006278 | 3300005343 | Bacteria | 4866 |
| 4 | Ga0070692_10075924 | 3300005345 | Bacteria | 1800 |
| 5 | Ga0070659_100000316 | 3300005366 | Bacteria | 37463 |
| 6 | Ga0070659_100025594 | 3300005366 | Bacteria | 4534 |
| 7 | Ga0070667_100230247 | 3300005367 | Bacteria | 1652 |
| 8 | Ga0070678_100044183 | 3300005456 | Bacteria | 3180 |
| 9 | Ga0070678_100130730 | 3300005456 | Bacteria | 1994 |
| 10 | Ga0070681_10069328 | 3300005458 | Bacteria | 3492 |
| 11 | Ga0068867_100037737 | 3300005459 | Bacteria | 3513 |
| 12 | Ga0070699_100387403 | 3300005518 | Unclassified | 1263 |
| 13 | Ga0070679_100020321 | 3300005530 | Bacteria | 6472 |
| 14 | Ga0070679_100112276 | 3300005530 | Bacteria | 2711 |
| 15 | Ga0070679_100268832 | 3300005530 | Unclassified | 1659 |
| 16 | Ga0068853_100058431 | 3300005539 | Bacteria | 3329 |
| 17 | Ga0070665_100000221 | 3300005548 | Bacteria | 95402 |
| 18 | Ga0068855_100154275 | 3300005563 | Unclassified | 2610 |
| 19 | Ga0068855_100201320 | 3300005563 | Bacteria | 2241 |
| 20 | Ga0070664_100080414 | 3300005564 | Bacteria | 2807 |
| 21 | Ga0070664_100249271 | 3300005564 | Bacteria | 1596 |
| 22 | Ga0068854_100146718 | 3300005578 | Bacteria | 1816 |
| 23 | Ga0068856_100777834 | 3300005614 | Bacteria | 977 |
| 24 | Ga0070702_100024528 | 3300005615 | Bacteria | 3219 |
| 25 | Ga0068852_100035086 | 3300005616 | Bacteria | 4179 |
| 26 | Ga0068852_100226614 | 3300005616 | Bacteria | 1780 |
| 27 | Ga0068864_100051874 | 3300005618 | Bacteria | 3535 |
| 28 | Ga0068864_100261179 | 3300005618 | Bacteria | 1611 |
| 29 | Ga0068861_100214392 | 3300005719 | Bacteria | 1623 |
| 30 | Ga0068863_100034714 | 3300005841 | Bacteria | 4803 |
| 31 | Ga0068858_100207680 | 3300005842 | Bacteria | 1853 |
| 32 | Ga0075431_100007234 | 3300006847 | Bacteria | 11044 |
| 33 | Ga0068865_100443346 | 3300006881 | Bacteria | 1072 |
| 34 | Ga0105251_10000002 | 3300009011 | Bacteria | 350843 |
| 35 | Ga0105244_10000605 | 3300009036 | Bacteria | 31926 |
| 36 | Ga0105240_10015451 | 3300009093 | Bacteria | 10380 |
| 37 | Ga0105240_10053674 | 3300009093 | Bacteria | 5058 |
| 38 | Ga0105240_10103491 | 3300009093 | Bacteria | 3459 |
| 39 | Ga0105240_10221250 | 3300009093 | Bacteria | 2205 |
| 40 | Ga0105245_10016980 | 3300009098 | Bacteria | 6353 |
| 41 | Ga0114129_10037209 | 3300009147 | Bacteria | 6872 |
| 42 | Ga0105243_10515268 | 3300009148 | Bacteria | 1136 |
| 43 | Ga0105241_10000002 | 3300009174 | Bacteria | 869480 |
| 44 | Ga0105242_10460830 | 3300009176 | Bacteria | 1200 |
| 45 | Ga0105248_10000097 | 3300009177 | Bacteria | 97424 |
| 46 | Ga0105238_10116361 | 3300009551 | Bacteria | 2653 |
| 47 | Ga0105238_10180416 | 3300009551 | Bacteria | 2088 |
| 48 | Ga0105249_10842462 | 3300009553 | Bacteria | 982 |
| 49 | Ga0157373_10005363 | 3300013100 | Bacteria | 9632 |
| 50 | Ga0157370_10187281 | 3300013104 | Bacteria | 1921 |
| 51 | Ga0157375_10031136 | 3300013308 | Bacteria | 5037 |
| 52 | Ga0157375_10377138 | 3300013308 | Bacteria | 1585 |
| 53 | Ga0163163_10016029 | 3300014325 | Bacteria | 6949 |
| 54 | Ga0163163_10098132 | 3300014325 | Bacteria | 2951 |
| 55 | Ga0157380_10247201 | 3300014326 | Bacteria | 1612 |
| 56 | Ga0157377_10016234 | 3300014745 | Bacteria | 3826 |
| 57 | Ga0207655_1003492 | 3300025728 | Bacteria | 11663 |
| 58 | Ga0207713_1000008 | 3300025735 | Bacteria | 553952 |
| 59 | Ga0207647_10119753 | 3300025904 | Bacteria | 1552 |
| 60 | Ga0207643_10185515 | 3300025908 | Bacteria | 1261 |
| 61 | Ga0207705_10025307 | 3300025909 | Bacteria | 4238 |
| 62 | Ga0207654_10000005 | 3300025911 | Bacteria | 869492 |
| 63 | Ga0207707_10054728 | 3300025912 | Bacteria | 3473 |
| 64 | Ga0207695_10005331 | 3300025913 | Bacteria | 17113 |
| 65 | Ga0207695_10010228 | 3300025913 | Bacteria | 11503 |
| 66 | Ga0207695_10028648 | 3300025913 | Bacteria | 6167 |
| 67 | Ga0207695_10116418 | 3300025913 | Bacteria | 2646 |
| 68 | Ga0207660_10042693 | 3300025917 | Bacteria | 3184 |
| 69 | Ga0207660_10161917 | 3300025917 | Bacteria | 1727 |
| 70 | Ga0207662_10086886 | 3300025918 | Bacteria | 1917 |
| 71 | Ga0207657_10023525 | 3300025919 | Bacteria | 5736 |
| 72 | Ga0207657_10044587 | 3300025919 | Bacteria | 3897 |
| 73 | Ga0207649_10152599 | 3300025920 | Bacteria | 1593 |
| 74 | Ga0207652_10045577 | 3300025921 | Bacteria | 3739 |
| 75 | Ga0207694_10022864 | 3300025924 | Bacteria | 4742 |
| 76 | Ga0207644_10037883 | 3300025931 | Bacteria | 3394 |
| 77 | Ga0207690_10000077 | 3300025932 | Bacteria | 85018 |
| 78 | Ga0207690_10026992 | 3300025932 | Bacteria | 3624 |
| 79 | Ga0207706_10117550 | 3300025933 | Bacteria | 2338 |
| 80 | Ga0207704_10296039 | 3300025938 | Bacteria | 1237 |
| 81 | Ga0207704_10427049 | 3300025938 | Bacteria | 1052 |
| 82 | Ga0207711_10013167 | 3300025941 | Bacteria | 6870 |
| 83 | Ga0207689_10072324 | 3300025942 | Bacteria | 2833 |
| 84 | Ga0207679_10327363 | 3300025945 | Bacteria | 1329 |
| 85 | Ga0207667_10027307 | 3300025949 | Bacteria | 6215 |
| 86 | Ga0207667_10055516 | 3300025949 | Bacteria | 4163 |
| 87 | Ga0207667_10138183 | 3300025949 | Unclassified | 2509 |
| 88 | Ga0207651_10041176 | 3300025960 | Bacteria | 3064 |
| 89 | Ga0207712_10526367 | 3300025961 | Bacteria | 1014 |
| 90 | Ga0207640_10241760 | 3300025981 | Bacteria | 1395 |
| 91 | Ga0207639_10078075 | 3300026041 | Bacteria | 2612 |
| 92 | Ga0207678_10101694 | 3300026067 | Bacteria | 2454 |
| 93 | Ga0207708_10021762 | 3300026075 | Bacteria | 4839 |
| 94 | Ga0207641_10035643 | 3300026088 | Bacteria | 4147 |
| 95 | Ga0207648_10067596 | 3300026089 | Bacteria | 3115 |
| 96 | Ga0207648_10404778 | 3300026089 | Bacteria | 1237 |
| 97 | Ga0207675_100059631 | 3300026118 | Bacteria | 3561 |
| 98 | Ga0207683_10033281 | 3300026121 | Bacteria | 4477 |
| 99 | Ga0207683_10319199 | 3300026121 | Bacteria | 1423 |
| 100 | Ga0207698_10197360 | 3300026142 | Bacteria | 1799 |
| 101 | Ga0207698_10469467 | 3300026142 | Bacteria | 1218 |
| 102 | Ga0209281_1000003 | 3300027111 | Bacteria | 1260089 |
| 103 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 104 | Ga0265332_10183264 | 3300031238 | Bacteria | 872 |
| 105 | Ga0265327_10184965 | 3300031251 | Bacteria | 951 |
| 106 | Ga0307513_10024547 | 3300031456 | Bacteria | 7014 |
| 107 | Ga0307513_10098964 | 3300031456 | Bacteria | 2945 |
| 108 | Ga0307413_10334660 | 3300031824 | Unclassified | 1162 |
| 109 | Ga0307410_10448968 | 3300031852 | Bacteria | 1051 |
| 110 | Ga0307407_10038312 | 3300031903 | Bacteria | 2656 |
| 111 | Ga0307416_100204530 | 3300032002 | Bacteria | 1877 |
| 112 | Ga0307414_10127242 | 3300032004 | Bacteria | 1971 |
| 113 | Ga0307415_100075268 | 3300032126 | Bacteria | 2389 |
| 114 | Ga0307510_10014441 | 3300033180 | Bacteria | 9345 |
| 115 | Ga0373936_0015554 | 3300035113 | Bacteria | 2916 |
| 116 | Ga0373933_0192107 | 3300035724 | Unclassified | 1304 |
| 117 | Ga0373937_0204390 | 3300036401 | Unclassified | 1857 |
| 118 | Ga0395899_0000223 | 3300037312 | Bacteria | 77606 |
| 119 | Ga0395899_0372862 | 3300037312 | Bacteria | 950 |
| 120 | Ga0395900_0000008 | 3300037418 | Bacteria | 480459 |
| 121 | Ga0395898_0009387 | 3300037466 | Bacteria | 10274 |
| 122 | Ga0395898_0010174 | 3300037466 | Bacteria | 9846 |
| 123 | Ga0395905_0030934 | 3300037471 | Bacteria | 5041 |
| 124 | Ga0395905_0060131 | 3300037471 | Bacteria | 3553 |
| 125 | Ga0395901_0000008 | 3300038443 | Bacteria | 495962 |
| 126 | Ga0395901_0022267 | 3300038443 | Bacteria | 6493 |
| 127 | Ga0400483_029008 | 3300039062 | Bacteria | 9573 |
| 128 | Ga0400483_077288 | 3300039062 | Bacteria | 30506 |
| 129 | Ga0400483_078586 | 3300039062 | Bacteria | 3382 |
| 130 | Ga0400483_078637 | 3300039062 | Bacteria | 4474 |
| 131 | Ga0400483_167502 | 3300039062 | Bacteria | 6915 |
| 132 | Ga0400483_225758 | 3300039062 | Bacteria | 1049 |
| 133 | Ga0400483_253362 | 3300039062 | Bacteria | 4330 |
| 134 | Ga0400483_290402 | 3300039062 | Bacteria | 9375 |
| 135 | Ga0436360_0166350 | 3300039438 | Unclassified | 1536 |
| 136 | Ga0466966_0234081 | 3300044684 | Bacteria | 1108 |
| 137 | Ga0466963_0035605 | 3300044694 | Bacteria | 3244 |
| 138 | Ga0466960_0064221 | 3300044901 | Bacteria | 1810 |
| 139 | Ga0466959_0069291 | 3300045049 | Bacteria | 2556 |
| 140 | Ga0451576_0006015 | 3300045051 | Bacteria | 15001 |
| 141 | Ga0466958_0017833 | 3300045836 | Bacteria | 4112 |
| 142 | Ga0495591_000406 | 3300046458 | Bacteria | 35999 |
| 143 | Ga0495584_0002300 | 3300046491 | Bacteria | 10901 |
| 144 | Ga0495607_0096058 | 3300046501 | Unclassified | 1596 |
| 145 | Ga0495583_0033013 | 3300046506 | Bacteria | 2493 |
| 146 | Ga0495606_0006630 | 3300046507 | Bacteria | 10618 |
| 147 | Ga0495630_0085403 | 3300046517 | Unclassified | 2383 |
| 148 | Ga0495648_0003300 | 3300046524 | Bacteria | 14247 |
| 149 | Ga0495648_0003435 | 3300046524 | Bacteria | 13930 |
| 150 | Ga0495654_0000583 | 3300046530 | Bacteria | 29309 |
| 151 | Ga0495621_0053481 | 3300046539 | Bacteria | 1450 |
| 152 | Ga0495668_0088530 | 3300046616 | Bacteria | 1697 |
| 153 | Ga0495669_0027784 | 3300046684 | Bacteria | 2475 |
| 154 | Ga0495671_0000836 | 3300046692 | Bacteria | 22004 |
| 155 | Ga0495649_0060628 | 3300046694 | Unclassified | 2035 |
| 156 | Ga0495672_0029643 | 3300047320 | Bacteria | 3443 |
| 157 | Ga0495683_0000608 | 3300047323 | Bacteria | 26784 |
| 158 | Ga0495673_0000081 | 3300047469 | Bacteria | 199943 |
| 159 | Ga0496102_0166230 | 3300048905 | Bacteria | 2076 |
| 160 | Ga0496108_0052061 | 3300048911 | Bacteria | 3430 |
| 161 | Ga0496109_0048431 | 3300048912 | Bacteria | 3867 |
| 162 | Ga0496113_0298983 | 3300048916 | Bacteria | 1289 |
| 163 | Ga0496113_0360865 | 3300048916 | Bacteria | 1166 |
| 164 | Ga0496115_0000831 | 3300048918 | Bacteria | 22564 |
| 165 | Ga0496124_0013023 | 3300048927 | Bacteria | 8151 |
| 166 | Ga0496126_0010016 | 3300048929 | Bacteria | 10003 |
| 167 | Ga0496126_0010831 | 3300048929 | Bacteria | 9508 |
| 168 | Ga0501033_0118664 | 3300049570 | Bacteria | 1921 |
| 169 | Ga0501040_0041027 | 3300049576 | Unclassified | 3151 |
| 170 | Ga0501041_0067026 | 3300049577 | Bacteria | 2200 |
| 171 | Ga0501042_0039783 | 3300049578 | Bacteria | 3343 |
| 172 | Ga0501043_0057119 | 3300049579 | Bacteria | 3065 |
| 173 | Ga0501046_0082129 | 3300049580 | Bacteria | 2489 |
| 174 | Ga0501047_0095544 | 3300049581 | Bacteria | 2851 |
| 175 | Ga0501073_0094217 | 3300049589 | Bacteria | 2080 |
| 176 | Ga0501075_0011258 | 3300049591 | Bacteria | 6328 |
| 177 | Ga0501076_0010591 | 3300049592 | Bacteria | 6847 |
| 178 | Ga0501077_0002481 | 3300049593 | Bacteria | 11056 |
| 179 | Ga0501079_0005702 | 3300049741 | Bacteria | 9301 |
| 180 | Ga0501081_0005440 | 3300049743 | Bacteria | 8218 |
| 181 | Ga0501083_0057361 | 3300049744 | Unclassified | 2607 |
| 182 | Ga0501035_0316154 | 3300049822 | Bacteria | 1313 |
| 183 | Ga0501045_0091545 | 3300049824 | Bacteria | 2248 |
| 184 | nmdc:mga0k408_245416_c1 | 3300050493 | Bacteria | 1069 |
| 185 | nmdc:mga06r32_771192_c1 | 3300050510 | Unclassified | 924 |
| 186 | Ga0501084_0001541 | 3300054114 | Bacteria | 18335 |
| 187 | Ga0501082_0049265 | 3300060353 | Bacteria | 3632 |
| 188 | Ga0530510_0005465 | 3300061734 | Bacteria | 8795 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0118664 | Ga0501033_0118664_834_1499 | 212 |
| 2 | 3300049576 | Ga0501040_0041027 | Ga0501040_0041027_1818_2483 | 212 |
| 3 | 3300049577 | Ga0501041_0067026 | Ga0501041_0067026_535_1200 | 212 |
| 4 | 3300049578 | Ga0501042_0039783 | Ga0501042_0039783_831_1496 | 212 |
| 5 | 3300049579 | Ga0501043_0057119 | Ga0501043_0057119_438_1103 | 212 |
| 6 | 3300049580 | Ga0501046_0082129 | Ga0501046_0082129_1685_2350 | 212 |
| 7 | 3300049589 | Ga0501073_0094217 | Ga0501073_0094217_574_1239 | 212 |
| 8 | 3300049591 | Ga0501075_0011258 | Ga0501075_0011258_1996_2661 | 212 |
| 9 | 3300049592 | Ga0501076_0010591 | Ga0501076_0010591_5246_5911 | 212 |
| 10 | 3300049593 | Ga0501077_0002481 | Ga0501077_0002481_6900_7565 | 212 |
| 11 | 3300049741 | Ga0501079_0005702 | Ga0501079_0005702_6771_7436 | 212 |
| 12 | 3300049743 | Ga0501081_0005440 | Ga0501081_0005440_6509_7174 | 212 |
| 13 | 3300049744 | Ga0501083_0057361 | Ga0501083_0057361_1079_1744 | 212 |
| 14 | 3300049824 | Ga0501045_0091545 | Ga0501045_0091545_721_1386 | 212 |
| 15 | 3300054114 | Ga0501084_0001541 | Ga0501084_0001541_12980_13645 | 212 |
| 16 | 3300060353 | Ga0501082_0049265 | Ga0501082_0049265_926_1591 | 212 |
| 17 | 3300061734 | Ga0530510_0005465 | Ga0530510_0005465_2898_3563 | 212 |
| 18 | 3300046616 | Ga0495668_0088530 | Ga0495668_0088530_12_689 | 215 |
| 19 | 3300025904 | Ga0207647_10119753 | Ga0207647_101197532 | 220 |
| 20 | 3300037312 | Ga0395899_0372862 | Ga0395899_0372862_13_717 | 224 |
| 21 | 3300039062 | Ga0400483_077288 | Ga0400483_077288_9161_9913 | 226 |
| 22 | 3300044694 | Ga0466963_0035605 | Ga0466963_0035605_1153_1911 | 229 |
| 23 | 3300045049 | Ga0466959_0069291 | Ga0466959_0069291_1545_2303 | 229 |
| 24 | 3300039062 | Ga0400483_078637 | Ga0400483_078637_1705_2454 | 238 |
| 25 | 3300039062 | Ga0400483_029008 | Ga0400483_029008_7267_8019 | 242 |
| 26 | iso_pu_bacteria | 2791354901 | 2791914277 | 242 |
| 27 | 3300006847 | Ga0075431_100007234 | Ga0075431_1000072346 | 243 |
| 28 | 3300009147 | Ga0114129_10037209 | Ga0114129_100372096 | 243 |
| 29 | 3300050510 | nmdc:mga06r32_771192_c1 | nmdc:mga06r32_771192_c1_53_811 | 243 |
| 30 | iso_pu_bacteria | 2721755823 | 2724113447 | 243 |
| 31 | iso_pu_bacteria | 2842922631 | 2842926695 | 243 |
| 32 | iso_pu_bacteria | 2857531043 | 2857537457 | 243 |
| 33 | iso_pu_bacteria | 2884693830 | 2884700998 | 243 |
| 34 | iso_pu_bacteria | 2895442618 | 2895452284 | 243 |
| 35 | iso_pu_bacteria | 2908669403 | 2908669877 | 243 |
| 36 | iso_pu_bacteria | 8048127548 | 8048133202 | 243 |
| 37 | iso_pu_bacteria | 8056207758 | 8056211660 | 243 |
| 38 | 3300005518 | Ga0070699_100387403 | Ga0070699_1003874031 | 244 |
| 39 | 3300005530 | Ga0070679_100268832 | Ga0070679_1002688322 | 244 |
| 40 | 3300005563 | Ga0068855_100154275 | Ga0068855_1001542753 | 244 |
| 41 | 3300025908 | Ga0207643_10185515 | Ga0207643_101855152 | 244 |
| 42 | 3300025949 | Ga0207667_10138183 | Ga0207667_101381832 | 244 |
| 43 | 3300035724 | Ga0373933_0192107 | Ga0373933_0192107_73_846 | 244 |
| 44 | 3300036401 | Ga0373937_0204390 | Ga0373937_0204390_1017_1790 | 244 |
| 45 | 3300039062 | Ga0400483_253362 | Ga0400483_253362_1254_2024 | 244 |
| 46 | 3300045836 | Ga0466958_0017833 | Ga0466958_0017833_3149_3937 | 244 |
| 47 | 3300046517 | Ga0495630_0085403 | Ga0495630_0085403_512_1285 | 244 |
| 48 | iso_pu_bacteria | 2791355137 | 2792839095 | 244 |
| 49 | 3300006881 | Ga0068865_100443346 | Ga0068865_1004433462 | 245 |
| 50 | 3300009148 | Ga0105243_10515268 | Ga0105243_105152682 | 245 |
| 51 | 3300025920 | Ga0207649_10152599 | Ga0207649_101525992 | 245 |
| 52 | 3300025933 | Ga0207706_10117550 | Ga0207706_101175502 | 245 |
| 53 | 3300025938 | Ga0207704_10427049 | Ga0207704_104270491 | 245 |
| 54 | 3300025945 | Ga0207679_10327363 | Ga0207679_103273632 | 245 |
| 55 | 3300026067 | Ga0207678_10101694 | Ga0207678_101016942 | 245 |
| 56 | 3300026089 | Ga0207648_10404778 | Ga0207648_104047782 | 245 |
| 57 | 3300045051 | Ga0451576_0006015 | Ga0451576_0006015_8268_9071 | 245 |
| 58 | 3300005366 | Ga0070659_100000316 | Ga0070659_10000031624 | 246 |
| 59 | 3300005366 | Ga0070659_100025594 | Ga0070659_1000255942 | 246 |
| 60 | 3300005367 | Ga0070667_100230247 | Ga0070667_1002302472 | 246 |
| 61 | 3300005456 | Ga0070678_100044183 | Ga0070678_1000441831 | 246 |
| 62 | 3300005458 | Ga0070681_10069328 | Ga0070681_100693282 | 246 |
| 63 | 3300005530 | Ga0070679_100020321 | Ga0070679_1000203218 | 246 |
| 64 | 3300005530 | Ga0070679_100112276 | Ga0070679_1001122762 | 246 |
| 65 | 3300005539 | Ga0068853_100058431 | Ga0068853_1000584313 | 246 |
| 66 | 3300005548 | Ga0070665_100000221 | Ga0070665_10000022168 | 246 |
| 67 | 3300005563 | Ga0068855_100201320 | Ga0068855_1002013203 | 246 |
| 68 | 3300005564 | Ga0070664_100080414 | Ga0070664_1000804144 | 246 |
| 69 | 3300005614 | Ga0068856_100777834 | Ga0068856_1007778342 | 246 |
| 70 | 3300005616 | Ga0068852_100035086 | Ga0068852_1000350863 | 246 |
| 71 | 3300005616 | Ga0068852_100226614 | Ga0068852_1002266143 | 246 |
| 72 | 3300005618 | Ga0068864_100261179 | Ga0068864_1002611792 | 246 |
| 73 | 3300005841 | Ga0068863_100034714 | Ga0068863_1000347144 | 246 |
| 74 | 3300005842 | Ga0068858_100207680 | Ga0068858_1002076802 | 246 |
| 75 | 3300009093 | Ga0105240_10015451 | Ga0105240_100154514 | 246 |
| 76 | 3300009093 | Ga0105240_10053674 | Ga0105240_100536746 | 246 |
| 77 | 3300009093 | Ga0105240_10103491 | Ga0105240_101034912 | 246 |
| 78 | 3300009093 | Ga0105240_10221250 | Ga0105240_102212502 | 246 |
| 79 | 3300009176 | Ga0105242_10460830 | Ga0105242_104608302 | 246 |
| 80 | 3300009177 | Ga0105248_10000097 | Ga0105248_1000009716 | 246 |
| 81 | 3300009551 | Ga0105238_10180416 | Ga0105238_101804161 | 246 |
| 82 | 3300009553 | Ga0105249_10842462 | Ga0105249_108424621 | 246 |
| 83 | 3300013104 | Ga0157370_10187281 | Ga0157370_101872813 | 246 |
| 84 | 3300013308 | Ga0157375_10031136 | Ga0157375_100311362 | 246 |
| 85 | 3300014325 | Ga0163163_10016029 | Ga0163163_100160296 | 246 |
| 86 | 3300014325 | Ga0163163_10098132 | Ga0163163_100981322 | 246 |
| 87 | 3300025909 | Ga0207705_10025307 | Ga0207705_100253072 | 246 |
| 88 | 3300025912 | Ga0207707_10054728 | Ga0207707_100547282 | 246 |
| 89 | 3300025913 | Ga0207695_10005331 | Ga0207695_1000533115 | 246 |
| 90 | 3300025913 | Ga0207695_10010228 | Ga0207695_100102287 | 246 |
| 91 | 3300025913 | Ga0207695_10028648 | Ga0207695_100286486 | 246 |
| 92 | 3300025913 | Ga0207695_10116418 | Ga0207695_101164183 | 246 |
| 93 | 3300025917 | Ga0207660_10042693 | Ga0207660_100426933 | 246 |
| 94 | 3300025917 | Ga0207660_10161917 | Ga0207660_101619173 | 246 |
| 95 | 3300025919 | Ga0207657_10023525 | Ga0207657_100235255 | 246 |
| 96 | 3300025919 | Ga0207657_10044587 | Ga0207657_100445874 | 246 |
| 97 | 3300025921 | Ga0207652_10045577 | Ga0207652_100455771 | 246 |
| 98 | 3300025924 | Ga0207694_10022864 | Ga0207694_100228643 | 246 |
| 99 | 3300025931 | Ga0207644_10037883 | Ga0207644_100378833 | 246 |
| 100 | 3300025932 | Ga0207690_10000077 | Ga0207690_1000007778 | 246 |
| 101 | 3300025932 | Ga0207690_10026992 | Ga0207690_100269923 | 246 |
| 102 | 3300025941 | Ga0207711_10013167 | Ga0207711_100131676 | 246 |
| 103 | 3300025949 | Ga0207667_10027307 | Ga0207667_100273073 | 246 |
| 104 | 3300025949 | Ga0207667_10055516 | Ga0207667_100555164 | 246 |
| 105 | 3300025960 | Ga0207651_10041176 | Ga0207651_100411765 | 246 |
| 106 | 3300025961 | Ga0207712_10526367 | Ga0207712_105263671 | 246 |
| 107 | 3300026041 | Ga0207639_10078075 | Ga0207639_100780753 | 246 |
| 108 | 3300026088 | Ga0207641_10035643 | Ga0207641_100356434 | 246 |
| 109 | 3300026121 | Ga0207683_10033281 | Ga0207683_100332812 | 246 |
| 110 | 3300026142 | Ga0207698_10197360 | Ga0207698_101973602 | 246 |
| 111 | 3300026142 | Ga0207698_10469467 | Ga0207698_104694672 | 246 |
| 112 | 3300028379 | Ga0268266_10000005 | Ga0268266_1000000567 | 246 |
| 113 | 3300031456 | Ga0307513_10024547 | Ga0307513_100245475 | 246 |
| 114 | 3300031456 | Ga0307513_10098964 | Ga0307513_100989643 | 246 |
| 115 | 3300033180 | Ga0307510_10014441 | Ga0307510_1001444110 | 246 |
| 116 | 3300035113 | Ga0373936_0015554 | Ga0373936_0015554_1058_1828 | 246 |
| 117 | 3300037312 | Ga0395899_0000223 | Ga0395899_0000223_12859_13629 | 246 |
| 118 | 3300037418 | Ga0395900_0000008 | Ga0395900_0000008_183333_184103 | 246 |
| 119 | 3300037466 | Ga0395898_0010174 | Ga0395898_0010174_5114_5884 | 246 |
| 120 | 3300037471 | Ga0395905_0030934 | Ga0395905_0030934_33_803 | 246 |
| 121 | 3300037471 | Ga0395905_0060131 | Ga0395905_0060131_1046_1840 | 246 |
| 122 | 3300038443 | Ga0395901_0000008 | Ga0395901_0000008_296363_297133 | 246 |
| 123 | 3300039062 | Ga0400483_078586 | Ga0400483_078586_36_824 | 246 |
| 124 | 3300039062 | Ga0400483_167502 | Ga0400483_167502_182_970 | 246 |
| 125 | 3300039062 | Ga0400483_225758 | Ga0400483_225758_100_885 | 246 |
| 126 | 3300039062 | Ga0400483_290402 | Ga0400483_290402_7403_8188 | 246 |
| 127 | 3300044684 | Ga0466966_0234081 | Ga0466966_0234081_124_894 | 246 |
| 128 | 3300046506 | Ga0495583_0033013 | Ga0495583_0033013_649_1419 | 246 |
| 129 | 3300046539 | Ga0495621_0053481 | Ga0495621_0053481_641_1423 | 246 |
| 130 | 3300046684 | Ga0495669_0027784 | Ga0495669_0027784_1263_2033 | 246 |
| 131 | 3300047320 | Ga0495672_0029643 | Ga0495672_0029643_75_845 | 246 |
| 132 | 3300048905 | Ga0496102_0166230 | Ga0496102_0166230_293_1063 | 246 |
| 133 | 3300048911 | Ga0496108_0052061 | Ga0496108_0052061_2476_3246 | 246 |
| 134 | 3300048912 | Ga0496109_0048431 | Ga0496109_0048431_2995_3765 | 246 |
| 135 | 3300048916 | Ga0496113_0298983 | Ga0496113_0298983_389_1162 | 246 |
| 136 | 3300048916 | Ga0496113_0360865 | Ga0496113_0360865_110_880 | 246 |
| 137 | 3300048918 | Ga0496115_0000831 | Ga0496115_0000831_3421_4191 | 246 |
| 138 | 3300049581 | Ga0501047_0095544 | Ga0501047_0095544_661_1464 | 246 |
| 139 | 3300049822 | Ga0501035_0316154 | Ga0501035_0316154_370_1173 | 246 |
| 140 | 3300009011 | Ga0105251_10000002 | Ga0105251_1000000228 | 247 |
| 141 | 3300009036 | Ga0105244_10000605 | Ga0105244_1000060519 | 247 |
| 142 | 3300009174 | Ga0105241_10000002 | Ga0105241_10000002214 | 247 |
| 143 | 3300009551 | Ga0105238_10116361 | Ga0105238_101163613 | 247 |
| 144 | 3300013100 | Ga0157373_10005363 | Ga0157373_100053633 | 247 |
| 145 | 3300025728 | Ga0207655_1003492 | Ga0207655_10034929 | 247 |
| 146 | 3300025735 | Ga0207713_1000008 | Ga0207713_1000008317 | 247 |
| 147 | 3300025911 | Ga0207654_10000005 | Ga0207654_10000005214 | 247 |
| 148 | 3300027111 | Ga0209281_1000003 | Ga0209281_1000003492 | 247 |
| 149 | 3300031238 | Ga0265332_10183264 | Ga0265332_101832641 | 247 |
| 150 | 3300031251 | Ga0265327_10184965 | Ga0265327_101849651 | 247 |
| 151 | 3300031824 | Ga0307413_10334660 | Ga0307413_103346601 | 247 |
| 152 | 3300031852 | Ga0307410_10448968 | Ga0307410_104489681 | 247 |
| 153 | 3300031903 | Ga0307407_10038312 | Ga0307407_100383122 | 247 |
| 154 | 3300032002 | Ga0307416_100204530 | Ga0307416_1002045302 | 247 |
| 155 | 3300032004 | Ga0307414_10127242 | Ga0307414_101272422 | 247 |
| 156 | 3300032126 | Ga0307415_100075268 | Ga0307415_1000752682 | 247 |
| 157 | 3300037466 | Ga0395898_0009387 | Ga0395898_0009387_239_1003 | 247 |
| 158 | 3300038443 | Ga0395901_0022267 | Ga0395901_0022267_5080_5844 | 247 |
| 159 | 3300039438 | Ga0436360_0166350 | Ga0436360_0166350_480_1304 | 247 |
| 160 | 3300046458 | Ga0495591_000406 | Ga0495591_000406_31081_31899 | 247 |
| 161 | 3300046491 | Ga0495584_0002300 | Ga0495584_0002300_1823_2641 | 247 |
| 162 | 3300046501 | Ga0495607_0096058 | Ga0495607_0096058_577_1395 | 247 |
| 163 | 3300046507 | Ga0495606_0006630 | Ga0495606_0006630_18_836 | 247 |
| 164 | 3300046524 | Ga0495648_0003300 | Ga0495648_0003300_6006_6824 | 247 |
| 165 | 3300046530 | Ga0495654_0000583 | Ga0495654_0000583_13657_14475 | 247 |
| 166 | 3300046692 | Ga0495671_0000836 | Ga0495671_0000836_11690_12508 | 247 |
| 167 | 3300046694 | Ga0495649_0060628 | Ga0495649_0060628_387_1205 | 247 |
| 168 | 3300047323 | Ga0495683_0000608 | Ga0495683_0000608_13800_14618 | 247 |
| 169 | 3300047469 | Ga0495673_0000081 | Ga0495673_0000081_187293_188111 | 247 |
| 170 | 3300048927 | Ga0496124_0013023 | Ga0496124_0013023_441_1256 | 247 |
| 171 | 3300048929 | Ga0496126_0010016 | Ga0496126_0010016_3243_4061 | 247 |
| 172 | 3300046524 | Ga0495648_0003435 | Ga0495648_0003435_1276_2076 | 248 |
| 173 | 3300048929 | Ga0496126_0010831 | Ga0496126_0010831_6499_7380 | 248 |
| 174 | 3300050493 | nmdc:mga0k408_245416_c1 | nmdc:mga0k408_245416_c1_11_817 | 248 |
| 175 | iso_pu_bacteria | 2939631187 | 2939631980 | 248 |
| 176 | 3300005334 | Ga0068869_100421343 | Ga0068869_1004213431 | 249 |
| 177 | 3300005338 | Ga0068868_100050296 | Ga0068868_1000502965 | 249 |
| 178 | 3300005343 | Ga0070687_100006278 | Ga0070687_1000062786 | 249 |
| 179 | 3300005345 | Ga0070692_10075924 | Ga0070692_100759242 | 249 |
| 180 | 3300005456 | Ga0070678_100130730 | Ga0070678_1001307304 | 249 |
| 181 | 3300005459 | Ga0068867_100037737 | Ga0068867_1000377372 | 249 |
| 182 | 3300005564 | Ga0070664_100249271 | Ga0070664_1002492712 | 249 |
| 183 | 3300005578 | Ga0068854_100146718 | Ga0068854_1001467183 | 249 |
| 184 | 3300005615 | Ga0070702_100024528 | Ga0070702_1000245282 | 249 |
| 185 | 3300005618 | Ga0068864_100051874 | Ga0068864_1000518743 | 249 |
| 186 | 3300005719 | Ga0068861_100214392 | Ga0068861_1002143923 | 249 |
| 187 | 3300009098 | Ga0105245_10016980 | Ga0105245_100169804 | 249 |
| 188 | 3300013308 | Ga0157375_10377138 | Ga0157375_103771382 | 249 |
| 189 | 3300014326 | Ga0157380_10247201 | Ga0157380_102472012 | 249 |
| 190 | 3300014745 | Ga0157377_10016234 | Ga0157377_100162342 | 249 |
| 191 | 3300025918 | Ga0207662_10086886 | Ga0207662_100868862 | 249 |
| 192 | 3300025938 | Ga0207704_10296039 | Ga0207704_102960392 | 249 |
| 193 | 3300025942 | Ga0207689_10072324 | Ga0207689_100723243 | 249 |
| 194 | 3300025981 | Ga0207640_10241760 | Ga0207640_102417601 | 249 |
| 195 | 3300026075 | Ga0207708_10021762 | Ga0207708_100217623 | 249 |
| 196 | 3300026089 | Ga0207648_10067596 | Ga0207648_100675962 | 249 |
| 197 | 3300026118 | Ga0207675_100059631 | Ga0207675_1000596314 | 249 |
| 198 | 3300026121 | Ga0207683_10319199 | Ga0207683_103191992 | 249 |
| 199 | 3300044901 | Ga0466960_0064221 | Ga0466960_0064221_741_1490 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nr1-assembly1.cif.gz_A | crystal structure of holo-s116a mutant of hydroxy ketone aldolase (swhka) from sphingomonas wittichii rw1 | 0.9422 | 6 | 249 |
| 7nnk-assembly1.cif.gz_B | crystal structure of s116a mutant of hydroxy ketone aldolase (swhka) from sphingomonas wittichii rw1 in complex with hydroxypyruvate | 0.9399 | 6 | 247 |
| 7o9r-assembly1.cif.gz_BBB | crystal structure of holo-h44a mutant of hydroxy ketone aldolase (swhka) from sphingomonas wittichii rw1 | 0.9396 | 6 | 247 |
| 7o5w-assembly1.cif.gz_BBB | crystal structure of holo-f210w mutant of hydroxy ketone aldolase (swhka)from sphingomonas wittichii rw1 | 0.9382 | 6 | 247 |
| 7o5i-assembly1.cif.gz_A | crystal structure of apo-swhka (hydroxy ketone aldolase) from sphingomonas wittichii rw1 | 0.9362 | 2 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6r62A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9444 | 6 | 247 | 3.20.20.60 |
| 6r62A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9152 | 6 | 247 | 3.20.20.60 |
| 1dxfA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9078 | 6 | 247 | 3.20.20.60 |
| af_Q4CQY1_6_194_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9066 | 6 | 175 | 3.20.20.60 |
| af_P76469_1_267_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9041 | 1 | 245 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3P4AZD7-F1-model_v4 | 5-keto-4-deoxy-D-glucarate aldolase (EC 4.1.2.20) | 0.948 | 19 | 246 |
GO:0005737
GO:0008672 |
| AF-A0A6L5F5I9-F1-model_v4 | Aldolase | 0.9451 | 16 | 248 |
GO:0005737
GO:0016832 |
| AF-A0A382QLI2-F1-model_v4 | HpcH/HpaI aldolase/citrate lyase domain-containing protein | 0.9384 | 26 | 166 |
GO:0005737
GO:0016832 |
| AF-A0A2H6H6G9-F1-model_v4 | 2-keto-3-deoxy-L-rhamnonate aldolase (EC 4.1.2.53) | 0.938 | 7 | 248 |
GO:0005737
GO:0106099 |
| AF-A0A3S2VNH1-F1-model_v4 | 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase | 0.9377 | 6 | 247 |
GO:0005737
GO:0016832 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar