F306309

General Info

Members Datasets Scaffolds Average Seq Length
199 158 188 254

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0010831|Ga0496126_0010831_6499_7380
Length 293
Sequence LLTVCRNVNASKPHSRIHKGRNTGGQQVSTAIELRRKWARGETVFGGWAALPCAFAAELMCVPGVGYVCIDQQHGLVDYADMVGMLRAIEGRGVVPLTRVPANENWIIGKALDAGAQGVVVPMVNNRAEAAAAVAACRYAPSGTRSFGPVRASMVLDSRDVAVVGDSMLCFVMVETRDAVQHIDEIASTPGLDGIYVGPADLALGLGLPPNLDKEEPEHVAAVARVLEACREHGIVAGIQCGSGRAARKFADKGFRFVTFAKDSSLIPSAMDKEVAAAFGDAAVPGTQQRGYA

Samples

Sample ID Description Type Environment
1 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
2 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
3 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
4 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
5 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
6 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
7 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
8 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
9 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
158 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.47
Metatranscriptomes 0
Isolates 5.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 1.01
Rhizoplane 3.02
Rhizosphere 85.93
Stem 0
Stem Tuber 0
Unclassified 9.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100421343 3300005334 Bacteria 1101
2 Ga0068868_100050296 3300005338 Bacteria 3272
3 Ga0070687_100006278 3300005343 Bacteria 4866
4 Ga0070692_10075924 3300005345 Bacteria 1800
5 Ga0070659_100000316 3300005366 Bacteria 37463
6 Ga0070659_100025594 3300005366 Bacteria 4534
7 Ga0070667_100230247 3300005367 Bacteria 1652
8 Ga0070678_100044183 3300005456 Bacteria 3180
9 Ga0070678_100130730 3300005456 Bacteria 1994
10 Ga0070681_10069328 3300005458 Bacteria 3492
11 Ga0068867_100037737 3300005459 Bacteria 3513
12 Ga0070699_100387403 3300005518 Unclassified 1263
13 Ga0070679_100020321 3300005530 Bacteria 6472
14 Ga0070679_100112276 3300005530 Bacteria 2711
15 Ga0070679_100268832 3300005530 Unclassified 1659
16 Ga0068853_100058431 3300005539 Bacteria 3329
17 Ga0070665_100000221 3300005548 Bacteria 95402
18 Ga0068855_100154275 3300005563 Unclassified 2610
19 Ga0068855_100201320 3300005563 Bacteria 2241
20 Ga0070664_100080414 3300005564 Bacteria 2807
21 Ga0070664_100249271 3300005564 Bacteria 1596
22 Ga0068854_100146718 3300005578 Bacteria 1816
23 Ga0068856_100777834 3300005614 Bacteria 977
24 Ga0070702_100024528 3300005615 Bacteria 3219
25 Ga0068852_100035086 3300005616 Bacteria 4179
26 Ga0068852_100226614 3300005616 Bacteria 1780
27 Ga0068864_100051874 3300005618 Bacteria 3535
28 Ga0068864_100261179 3300005618 Bacteria 1611
29 Ga0068861_100214392 3300005719 Bacteria 1623
30 Ga0068863_100034714 3300005841 Bacteria 4803
31 Ga0068858_100207680 3300005842 Bacteria 1853
32 Ga0075431_100007234 3300006847 Bacteria 11044
33 Ga0068865_100443346 3300006881 Bacteria 1072
34 Ga0105251_10000002 3300009011 Bacteria 350843
35 Ga0105244_10000605 3300009036 Bacteria 31926
36 Ga0105240_10015451 3300009093 Bacteria 10380
37 Ga0105240_10053674 3300009093 Bacteria 5058
38 Ga0105240_10103491 3300009093 Bacteria 3459
39 Ga0105240_10221250 3300009093 Bacteria 2205
40 Ga0105245_10016980 3300009098 Bacteria 6353
41 Ga0114129_10037209 3300009147 Bacteria 6872
42 Ga0105243_10515268 3300009148 Bacteria 1136
43 Ga0105241_10000002 3300009174 Bacteria 869480
44 Ga0105242_10460830 3300009176 Bacteria 1200
45 Ga0105248_10000097 3300009177 Bacteria 97424
46 Ga0105238_10116361 3300009551 Bacteria 2653
47 Ga0105238_10180416 3300009551 Bacteria 2088
48 Ga0105249_10842462 3300009553 Bacteria 982
49 Ga0157373_10005363 3300013100 Bacteria 9632
50 Ga0157370_10187281 3300013104 Bacteria 1921
51 Ga0157375_10031136 3300013308 Bacteria 5037
52 Ga0157375_10377138 3300013308 Bacteria 1585
53 Ga0163163_10016029 3300014325 Bacteria 6949
54 Ga0163163_10098132 3300014325 Bacteria 2951
55 Ga0157380_10247201 3300014326 Bacteria 1612
56 Ga0157377_10016234 3300014745 Bacteria 3826
57 Ga0207655_1003492 3300025728 Bacteria 11663
58 Ga0207713_1000008 3300025735 Bacteria 553952
59 Ga0207647_10119753 3300025904 Bacteria 1552
60 Ga0207643_10185515 3300025908 Bacteria 1261
61 Ga0207705_10025307 3300025909 Bacteria 4238
62 Ga0207654_10000005 3300025911 Bacteria 869492
63 Ga0207707_10054728 3300025912 Bacteria 3473
64 Ga0207695_10005331 3300025913 Bacteria 17113
65 Ga0207695_10010228 3300025913 Bacteria 11503
66 Ga0207695_10028648 3300025913 Bacteria 6167
67 Ga0207695_10116418 3300025913 Bacteria 2646
68 Ga0207660_10042693 3300025917 Bacteria 3184
69 Ga0207660_10161917 3300025917 Bacteria 1727
70 Ga0207662_10086886 3300025918 Bacteria 1917
71 Ga0207657_10023525 3300025919 Bacteria 5736
72 Ga0207657_10044587 3300025919 Bacteria 3897
73 Ga0207649_10152599 3300025920 Bacteria 1593
74 Ga0207652_10045577 3300025921 Bacteria 3739
75 Ga0207694_10022864 3300025924 Bacteria 4742
76 Ga0207644_10037883 3300025931 Bacteria 3394
77 Ga0207690_10000077 3300025932 Bacteria 85018
78 Ga0207690_10026992 3300025932 Bacteria 3624
79 Ga0207706_10117550 3300025933 Bacteria 2338
80 Ga0207704_10296039 3300025938 Bacteria 1237
81 Ga0207704_10427049 3300025938 Bacteria 1052
82 Ga0207711_10013167 3300025941 Bacteria 6870
83 Ga0207689_10072324 3300025942 Bacteria 2833
84 Ga0207679_10327363 3300025945 Bacteria 1329
85 Ga0207667_10027307 3300025949 Bacteria 6215
86 Ga0207667_10055516 3300025949 Bacteria 4163
87 Ga0207667_10138183 3300025949 Unclassified 2509
88 Ga0207651_10041176 3300025960 Bacteria 3064
89 Ga0207712_10526367 3300025961 Bacteria 1014
90 Ga0207640_10241760 3300025981 Bacteria 1395
91 Ga0207639_10078075 3300026041 Bacteria 2612
92 Ga0207678_10101694 3300026067 Bacteria 2454
93 Ga0207708_10021762 3300026075 Bacteria 4839
94 Ga0207641_10035643 3300026088 Bacteria 4147
95 Ga0207648_10067596 3300026089 Bacteria 3115
96 Ga0207648_10404778 3300026089 Bacteria 1237
97 Ga0207675_100059631 3300026118 Bacteria 3561
98 Ga0207683_10033281 3300026121 Bacteria 4477
99 Ga0207683_10319199 3300026121 Bacteria 1423
100 Ga0207698_10197360 3300026142 Bacteria 1799
101 Ga0207698_10469467 3300026142 Bacteria 1218
102 Ga0209281_1000003 3300027111 Bacteria 1260089
103 Ga0268266_10000005 3300028379 Bacteria 1448194
104 Ga0265332_10183264 3300031238 Bacteria 872
105 Ga0265327_10184965 3300031251 Bacteria 951
106 Ga0307513_10024547 3300031456 Bacteria 7014
107 Ga0307513_10098964 3300031456 Bacteria 2945
108 Ga0307413_10334660 3300031824 Unclassified 1162
109 Ga0307410_10448968 3300031852 Bacteria 1051
110 Ga0307407_10038312 3300031903 Bacteria 2656
111 Ga0307416_100204530 3300032002 Bacteria 1877
112 Ga0307414_10127242 3300032004 Bacteria 1971
113 Ga0307415_100075268 3300032126 Bacteria 2389
114 Ga0307510_10014441 3300033180 Bacteria 9345
115 Ga0373936_0015554 3300035113 Bacteria 2916
116 Ga0373933_0192107 3300035724 Unclassified 1304
117 Ga0373937_0204390 3300036401 Unclassified 1857
118 Ga0395899_0000223 3300037312 Bacteria 77606
119 Ga0395899_0372862 3300037312 Bacteria 950
120 Ga0395900_0000008 3300037418 Bacteria 480459
121 Ga0395898_0009387 3300037466 Bacteria 10274
122 Ga0395898_0010174 3300037466 Bacteria 9846
123 Ga0395905_0030934 3300037471 Bacteria 5041
124 Ga0395905_0060131 3300037471 Bacteria 3553
125 Ga0395901_0000008 3300038443 Bacteria 495962
126 Ga0395901_0022267 3300038443 Bacteria 6493
127 Ga0400483_029008 3300039062 Bacteria 9573
128 Ga0400483_077288 3300039062 Bacteria 30506
129 Ga0400483_078586 3300039062 Bacteria 3382
130 Ga0400483_078637 3300039062 Bacteria 4474
131 Ga0400483_167502 3300039062 Bacteria 6915
132 Ga0400483_225758 3300039062 Bacteria 1049
133 Ga0400483_253362 3300039062 Bacteria 4330
134 Ga0400483_290402 3300039062 Bacteria 9375
135 Ga0436360_0166350 3300039438 Unclassified 1536
136 Ga0466966_0234081 3300044684 Bacteria 1108
137 Ga0466963_0035605 3300044694 Bacteria 3244
138 Ga0466960_0064221 3300044901 Bacteria 1810
139 Ga0466959_0069291 3300045049 Bacteria 2556
140 Ga0451576_0006015 3300045051 Bacteria 15001
141 Ga0466958_0017833 3300045836 Bacteria 4112
142 Ga0495591_000406 3300046458 Bacteria 35999
143 Ga0495584_0002300 3300046491 Bacteria 10901
144 Ga0495607_0096058 3300046501 Unclassified 1596
145 Ga0495583_0033013 3300046506 Bacteria 2493
146 Ga0495606_0006630 3300046507 Bacteria 10618
147 Ga0495630_0085403 3300046517 Unclassified 2383
148 Ga0495648_0003300 3300046524 Bacteria 14247
149 Ga0495648_0003435 3300046524 Bacteria 13930
150 Ga0495654_0000583 3300046530 Bacteria 29309
151 Ga0495621_0053481 3300046539 Bacteria 1450
152 Ga0495668_0088530 3300046616 Bacteria 1697
153 Ga0495669_0027784 3300046684 Bacteria 2475
154 Ga0495671_0000836 3300046692 Bacteria 22004
155 Ga0495649_0060628 3300046694 Unclassified 2035
156 Ga0495672_0029643 3300047320 Bacteria 3443
157 Ga0495683_0000608 3300047323 Bacteria 26784
158 Ga0495673_0000081 3300047469 Bacteria 199943
159 Ga0496102_0166230 3300048905 Bacteria 2076
160 Ga0496108_0052061 3300048911 Bacteria 3430
161 Ga0496109_0048431 3300048912 Bacteria 3867
162 Ga0496113_0298983 3300048916 Bacteria 1289
163 Ga0496113_0360865 3300048916 Bacteria 1166
164 Ga0496115_0000831 3300048918 Bacteria 22564
165 Ga0496124_0013023 3300048927 Bacteria 8151
166 Ga0496126_0010016 3300048929 Bacteria 10003
167 Ga0496126_0010831 3300048929 Bacteria 9508
168 Ga0501033_0118664 3300049570 Bacteria 1921
169 Ga0501040_0041027 3300049576 Unclassified 3151
170 Ga0501041_0067026 3300049577 Bacteria 2200
171 Ga0501042_0039783 3300049578 Bacteria 3343
172 Ga0501043_0057119 3300049579 Bacteria 3065
173 Ga0501046_0082129 3300049580 Bacteria 2489
174 Ga0501047_0095544 3300049581 Bacteria 2851
175 Ga0501073_0094217 3300049589 Bacteria 2080
176 Ga0501075_0011258 3300049591 Bacteria 6328
177 Ga0501076_0010591 3300049592 Bacteria 6847
178 Ga0501077_0002481 3300049593 Bacteria 11056
179 Ga0501079_0005702 3300049741 Bacteria 9301
180 Ga0501081_0005440 3300049743 Bacteria 8218
181 Ga0501083_0057361 3300049744 Unclassified 2607
182 Ga0501035_0316154 3300049822 Bacteria 1313
183 Ga0501045_0091545 3300049824 Bacteria 2248
184 nmdc:mga0k408_245416_c1 3300050493 Bacteria 1069
185 nmdc:mga06r32_771192_c1 3300050510 Unclassified 924
186 Ga0501084_0001541 3300054114 Bacteria 18335
187 Ga0501082_0049265 3300060353 Bacteria 3632
188 Ga0530510_0005465 3300061734 Bacteria 8795

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0118664 Ga0501033_0118664_834_1499 212
2 3300049576 Ga0501040_0041027 Ga0501040_0041027_1818_2483 212
3 3300049577 Ga0501041_0067026 Ga0501041_0067026_535_1200 212
4 3300049578 Ga0501042_0039783 Ga0501042_0039783_831_1496 212
5 3300049579 Ga0501043_0057119 Ga0501043_0057119_438_1103 212
6 3300049580 Ga0501046_0082129 Ga0501046_0082129_1685_2350 212
7 3300049589 Ga0501073_0094217 Ga0501073_0094217_574_1239 212
8 3300049591 Ga0501075_0011258 Ga0501075_0011258_1996_2661 212
9 3300049592 Ga0501076_0010591 Ga0501076_0010591_5246_5911 212
10 3300049593 Ga0501077_0002481 Ga0501077_0002481_6900_7565 212
11 3300049741 Ga0501079_0005702 Ga0501079_0005702_6771_7436 212
12 3300049743 Ga0501081_0005440 Ga0501081_0005440_6509_7174 212
13 3300049744 Ga0501083_0057361 Ga0501083_0057361_1079_1744 212
14 3300049824 Ga0501045_0091545 Ga0501045_0091545_721_1386 212
15 3300054114 Ga0501084_0001541 Ga0501084_0001541_12980_13645 212
16 3300060353 Ga0501082_0049265 Ga0501082_0049265_926_1591 212
17 3300061734 Ga0530510_0005465 Ga0530510_0005465_2898_3563 212
18 3300046616 Ga0495668_0088530 Ga0495668_0088530_12_689 215
19 3300025904 Ga0207647_10119753 Ga0207647_101197532 220
20 3300037312 Ga0395899_0372862 Ga0395899_0372862_13_717 224
21 3300039062 Ga0400483_077288 Ga0400483_077288_9161_9913 226
22 3300044694 Ga0466963_0035605 Ga0466963_0035605_1153_1911 229
23 3300045049 Ga0466959_0069291 Ga0466959_0069291_1545_2303 229
24 3300039062 Ga0400483_078637 Ga0400483_078637_1705_2454 238
25 3300039062 Ga0400483_029008 Ga0400483_029008_7267_8019 242
26 iso_pu_bacteria 2791354901 2791914277 242
27 3300006847 Ga0075431_100007234 Ga0075431_1000072346 243
28 3300009147 Ga0114129_10037209 Ga0114129_100372096 243
29 3300050510 nmdc:mga06r32_771192_c1 nmdc:mga06r32_771192_c1_53_811 243
30 iso_pu_bacteria 2721755823 2724113447 243
31 iso_pu_bacteria 2842922631 2842926695 243
32 iso_pu_bacteria 2857531043 2857537457 243
33 iso_pu_bacteria 2884693830 2884700998 243
34 iso_pu_bacteria 2895442618 2895452284 243
35 iso_pu_bacteria 2908669403 2908669877 243
36 iso_pu_bacteria 8048127548 8048133202 243
37 iso_pu_bacteria 8056207758 8056211660 243
38 3300005518 Ga0070699_100387403 Ga0070699_1003874031 244
39 3300005530 Ga0070679_100268832 Ga0070679_1002688322 244
40 3300005563 Ga0068855_100154275 Ga0068855_1001542753 244
41 3300025908 Ga0207643_10185515 Ga0207643_101855152 244
42 3300025949 Ga0207667_10138183 Ga0207667_101381832 244
43 3300035724 Ga0373933_0192107 Ga0373933_0192107_73_846 244
44 3300036401 Ga0373937_0204390 Ga0373937_0204390_1017_1790 244
45 3300039062 Ga0400483_253362 Ga0400483_253362_1254_2024 244
46 3300045836 Ga0466958_0017833 Ga0466958_0017833_3149_3937 244
47 3300046517 Ga0495630_0085403 Ga0495630_0085403_512_1285 244
48 iso_pu_bacteria 2791355137 2792839095 244
49 3300006881 Ga0068865_100443346 Ga0068865_1004433462 245
50 3300009148 Ga0105243_10515268 Ga0105243_105152682 245
51 3300025920 Ga0207649_10152599 Ga0207649_101525992 245
52 3300025933 Ga0207706_10117550 Ga0207706_101175502 245
53 3300025938 Ga0207704_10427049 Ga0207704_104270491 245
54 3300025945 Ga0207679_10327363 Ga0207679_103273632 245
55 3300026067 Ga0207678_10101694 Ga0207678_101016942 245
56 3300026089 Ga0207648_10404778 Ga0207648_104047782 245
57 3300045051 Ga0451576_0006015 Ga0451576_0006015_8268_9071 245
58 3300005366 Ga0070659_100000316 Ga0070659_10000031624 246
59 3300005366 Ga0070659_100025594 Ga0070659_1000255942 246
60 3300005367 Ga0070667_100230247 Ga0070667_1002302472 246
61 3300005456 Ga0070678_100044183 Ga0070678_1000441831 246
62 3300005458 Ga0070681_10069328 Ga0070681_100693282 246
63 3300005530 Ga0070679_100020321 Ga0070679_1000203218 246
64 3300005530 Ga0070679_100112276 Ga0070679_1001122762 246
65 3300005539 Ga0068853_100058431 Ga0068853_1000584313 246
66 3300005548 Ga0070665_100000221 Ga0070665_10000022168 246
67 3300005563 Ga0068855_100201320 Ga0068855_1002013203 246
68 3300005564 Ga0070664_100080414 Ga0070664_1000804144 246
69 3300005614 Ga0068856_100777834 Ga0068856_1007778342 246
70 3300005616 Ga0068852_100035086 Ga0068852_1000350863 246
71 3300005616 Ga0068852_100226614 Ga0068852_1002266143 246
72 3300005618 Ga0068864_100261179 Ga0068864_1002611792 246
73 3300005841 Ga0068863_100034714 Ga0068863_1000347144 246
74 3300005842 Ga0068858_100207680 Ga0068858_1002076802 246
75 3300009093 Ga0105240_10015451 Ga0105240_100154514 246
76 3300009093 Ga0105240_10053674 Ga0105240_100536746 246
77 3300009093 Ga0105240_10103491 Ga0105240_101034912 246
78 3300009093 Ga0105240_10221250 Ga0105240_102212502 246
79 3300009176 Ga0105242_10460830 Ga0105242_104608302 246
80 3300009177 Ga0105248_10000097 Ga0105248_1000009716 246
81 3300009551 Ga0105238_10180416 Ga0105238_101804161 246
82 3300009553 Ga0105249_10842462 Ga0105249_108424621 246
83 3300013104 Ga0157370_10187281 Ga0157370_101872813 246
84 3300013308 Ga0157375_10031136 Ga0157375_100311362 246
85 3300014325 Ga0163163_10016029 Ga0163163_100160296 246
86 3300014325 Ga0163163_10098132 Ga0163163_100981322 246
87 3300025909 Ga0207705_10025307 Ga0207705_100253072 246
88 3300025912 Ga0207707_10054728 Ga0207707_100547282 246
89 3300025913 Ga0207695_10005331 Ga0207695_1000533115 246
90 3300025913 Ga0207695_10010228 Ga0207695_100102287 246
91 3300025913 Ga0207695_10028648 Ga0207695_100286486 246
92 3300025913 Ga0207695_10116418 Ga0207695_101164183 246
93 3300025917 Ga0207660_10042693 Ga0207660_100426933 246
94 3300025917 Ga0207660_10161917 Ga0207660_101619173 246
95 3300025919 Ga0207657_10023525 Ga0207657_100235255 246
96 3300025919 Ga0207657_10044587 Ga0207657_100445874 246
97 3300025921 Ga0207652_10045577 Ga0207652_100455771 246
98 3300025924 Ga0207694_10022864 Ga0207694_100228643 246
99 3300025931 Ga0207644_10037883 Ga0207644_100378833 246
100 3300025932 Ga0207690_10000077 Ga0207690_1000007778 246
101 3300025932 Ga0207690_10026992 Ga0207690_100269923 246
102 3300025941 Ga0207711_10013167 Ga0207711_100131676 246
103 3300025949 Ga0207667_10027307 Ga0207667_100273073 246
104 3300025949 Ga0207667_10055516 Ga0207667_100555164 246
105 3300025960 Ga0207651_10041176 Ga0207651_100411765 246
106 3300025961 Ga0207712_10526367 Ga0207712_105263671 246
107 3300026041 Ga0207639_10078075 Ga0207639_100780753 246
108 3300026088 Ga0207641_10035643 Ga0207641_100356434 246
109 3300026121 Ga0207683_10033281 Ga0207683_100332812 246
110 3300026142 Ga0207698_10197360 Ga0207698_101973602 246
111 3300026142 Ga0207698_10469467 Ga0207698_104694672 246
112 3300028379 Ga0268266_10000005 Ga0268266_1000000567 246
113 3300031456 Ga0307513_10024547 Ga0307513_100245475 246
114 3300031456 Ga0307513_10098964 Ga0307513_100989643 246
115 3300033180 Ga0307510_10014441 Ga0307510_1001444110 246
116 3300035113 Ga0373936_0015554 Ga0373936_0015554_1058_1828 246
117 3300037312 Ga0395899_0000223 Ga0395899_0000223_12859_13629 246
118 3300037418 Ga0395900_0000008 Ga0395900_0000008_183333_184103 246
119 3300037466 Ga0395898_0010174 Ga0395898_0010174_5114_5884 246
120 3300037471 Ga0395905_0030934 Ga0395905_0030934_33_803 246
121 3300037471 Ga0395905_0060131 Ga0395905_0060131_1046_1840 246
122 3300038443 Ga0395901_0000008 Ga0395901_0000008_296363_297133 246
123 3300039062 Ga0400483_078586 Ga0400483_078586_36_824 246
124 3300039062 Ga0400483_167502 Ga0400483_167502_182_970 246
125 3300039062 Ga0400483_225758 Ga0400483_225758_100_885 246
126 3300039062 Ga0400483_290402 Ga0400483_290402_7403_8188 246
127 3300044684 Ga0466966_0234081 Ga0466966_0234081_124_894 246
128 3300046506 Ga0495583_0033013 Ga0495583_0033013_649_1419 246
129 3300046539 Ga0495621_0053481 Ga0495621_0053481_641_1423 246
130 3300046684 Ga0495669_0027784 Ga0495669_0027784_1263_2033 246
131 3300047320 Ga0495672_0029643 Ga0495672_0029643_75_845 246
132 3300048905 Ga0496102_0166230 Ga0496102_0166230_293_1063 246
133 3300048911 Ga0496108_0052061 Ga0496108_0052061_2476_3246 246
134 3300048912 Ga0496109_0048431 Ga0496109_0048431_2995_3765 246
135 3300048916 Ga0496113_0298983 Ga0496113_0298983_389_1162 246
136 3300048916 Ga0496113_0360865 Ga0496113_0360865_110_880 246
137 3300048918 Ga0496115_0000831 Ga0496115_0000831_3421_4191 246
138 3300049581 Ga0501047_0095544 Ga0501047_0095544_661_1464 246
139 3300049822 Ga0501035_0316154 Ga0501035_0316154_370_1173 246
140 3300009011 Ga0105251_10000002 Ga0105251_1000000228 247
141 3300009036 Ga0105244_10000605 Ga0105244_1000060519 247
142 3300009174 Ga0105241_10000002 Ga0105241_10000002214 247
143 3300009551 Ga0105238_10116361 Ga0105238_101163613 247
144 3300013100 Ga0157373_10005363 Ga0157373_100053633 247
145 3300025728 Ga0207655_1003492 Ga0207655_10034929 247
146 3300025735 Ga0207713_1000008 Ga0207713_1000008317 247
147 3300025911 Ga0207654_10000005 Ga0207654_10000005214 247
148 3300027111 Ga0209281_1000003 Ga0209281_1000003492 247
149 3300031238 Ga0265332_10183264 Ga0265332_101832641 247
150 3300031251 Ga0265327_10184965 Ga0265327_101849651 247
151 3300031824 Ga0307413_10334660 Ga0307413_103346601 247
152 3300031852 Ga0307410_10448968 Ga0307410_104489681 247
153 3300031903 Ga0307407_10038312 Ga0307407_100383122 247
154 3300032002 Ga0307416_100204530 Ga0307416_1002045302 247
155 3300032004 Ga0307414_10127242 Ga0307414_101272422 247
156 3300032126 Ga0307415_100075268 Ga0307415_1000752682 247
157 3300037466 Ga0395898_0009387 Ga0395898_0009387_239_1003 247
158 3300038443 Ga0395901_0022267 Ga0395901_0022267_5080_5844 247
159 3300039438 Ga0436360_0166350 Ga0436360_0166350_480_1304 247
160 3300046458 Ga0495591_000406 Ga0495591_000406_31081_31899 247
161 3300046491 Ga0495584_0002300 Ga0495584_0002300_1823_2641 247
162 3300046501 Ga0495607_0096058 Ga0495607_0096058_577_1395 247
163 3300046507 Ga0495606_0006630 Ga0495606_0006630_18_836 247
164 3300046524 Ga0495648_0003300 Ga0495648_0003300_6006_6824 247
165 3300046530 Ga0495654_0000583 Ga0495654_0000583_13657_14475 247
166 3300046692 Ga0495671_0000836 Ga0495671_0000836_11690_12508 247
167 3300046694 Ga0495649_0060628 Ga0495649_0060628_387_1205 247
168 3300047323 Ga0495683_0000608 Ga0495683_0000608_13800_14618 247
169 3300047469 Ga0495673_0000081 Ga0495673_0000081_187293_188111 247
170 3300048927 Ga0496124_0013023 Ga0496124_0013023_441_1256 247
171 3300048929 Ga0496126_0010016 Ga0496126_0010016_3243_4061 247
172 3300046524 Ga0495648_0003435 Ga0495648_0003435_1276_2076 248
173 3300048929 Ga0496126_0010831 Ga0496126_0010831_6499_7380 248
174 3300050493 nmdc:mga0k408_245416_c1 nmdc:mga0k408_245416_c1_11_817 248
175 iso_pu_bacteria 2939631187 2939631980 248
176 3300005334 Ga0068869_100421343 Ga0068869_1004213431 249
177 3300005338 Ga0068868_100050296 Ga0068868_1000502965 249
178 3300005343 Ga0070687_100006278 Ga0070687_1000062786 249
179 3300005345 Ga0070692_10075924 Ga0070692_100759242 249
180 3300005456 Ga0070678_100130730 Ga0070678_1001307304 249
181 3300005459 Ga0068867_100037737 Ga0068867_1000377372 249
182 3300005564 Ga0070664_100249271 Ga0070664_1002492712 249
183 3300005578 Ga0068854_100146718 Ga0068854_1001467183 249
184 3300005615 Ga0070702_100024528 Ga0070702_1000245282 249
185 3300005618 Ga0068864_100051874 Ga0068864_1000518743 249
186 3300005719 Ga0068861_100214392 Ga0068861_1002143923 249
187 3300009098 Ga0105245_10016980 Ga0105245_100169804 249
188 3300013308 Ga0157375_10377138 Ga0157375_103771382 249
189 3300014326 Ga0157380_10247201 Ga0157380_102472012 249
190 3300014745 Ga0157377_10016234 Ga0157377_100162342 249
191 3300025918 Ga0207662_10086886 Ga0207662_100868862 249
192 3300025938 Ga0207704_10296039 Ga0207704_102960392 249
193 3300025942 Ga0207689_10072324 Ga0207689_100723243 249
194 3300025981 Ga0207640_10241760 Ga0207640_102417601 249
195 3300026075 Ga0207708_10021762 Ga0207708_100217623 249
196 3300026089 Ga0207648_10067596 Ga0207648_100675962 249
197 3300026118 Ga0207675_100059631 Ga0207675_1000596314 249
198 3300026121 Ga0207683_10319199 Ga0207683_103191992 249
199 3300044901 Ga0466960_0064221 Ga0466960_0064221_741_1490 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

45

270

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nr1-assembly1.cif.gz_A crystal structure of holo-s116a mutant of hydroxy ketone aldolase (swhka) from sphingomonas wittichii rw1 0.9422 6 249
7nnk-assembly1.cif.gz_B crystal structure of s116a mutant of hydroxy ketone aldolase (swhka) from sphingomonas wittichii rw1 in complex with hydroxypyruvate 0.9399 6 247
7o9r-assembly1.cif.gz_BBB crystal structure of holo-h44a mutant of hydroxy ketone aldolase (swhka) from sphingomonas wittichii rw1 0.9396 6 247
7o5w-assembly1.cif.gz_BBB crystal structure of holo-f210w mutant of hydroxy ketone aldolase (swhka)from sphingomonas wittichii rw1 0.9382 6 247
7o5i-assembly1.cif.gz_A crystal structure of apo-swhka (hydroxy ketone aldolase) from sphingomonas wittichii rw1 0.9362 2 247
ID Description Score Start End Superfamily
6r62A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9444 6 247 3.20.20.60
6r62A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9152 6 247 3.20.20.60
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9078 6 247 3.20.20.60
af_Q4CQY1_6_194_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9066 6 175 3.20.20.60
af_P76469_1_267_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9041 1 245 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A3P4AZD7-F1-model_v4 5-keto-4-deoxy-D-glucarate aldolase (EC 4.1.2.20) 0.948 19 246 GO:0005737
GO:0008672
AF-A0A6L5F5I9-F1-model_v4 Aldolase 0.9451 16 248 GO:0005737
GO:0016832
AF-A0A382QLI2-F1-model_v4 HpcH/HpaI aldolase/citrate lyase domain-containing protein 0.9384 26 166 GO:0005737
GO:0016832
AF-A0A2H6H6G9-F1-model_v4 2-keto-3-deoxy-L-rhamnonate aldolase (EC 4.1.2.53) 0.938 7 248 GO:0005737
GO:0106099
AF-A0A3S2VNH1-F1-model_v4 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase 0.9377 6 247 GO:0005737
GO:0016832

Feature Viewer

pLDDT pTM Quality
89 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map