F305796

General Info

Members Datasets Scaffolds Average Seq Length
199 151 196 148

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_11327288|Ga0157369_113272882
Length 166
Sequence MSAFLKHRDAYPAVAAARFIKMDKPLVLVLCTGNSCRSHLAEGILRAAVGDHLRVASAGSKPAGYVHPLAVKVMAEIDIDISSHRSKYLGEFLNEKVETVITVCGNADQACPMFPGQVNRHHWGFDDPAHATGSEDEQLAVFRRVRDEIKRVFDAYAAGRIDEAKR

Samples

Sample ID Description Type Environment
1 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
2 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
3 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
81 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
112 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
113 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
114 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
115 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
116 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
117 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
140 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
141 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0.5
Isolates 1.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 0
Rhizoplane 1.51
Rhizosphere 88.44
Stem 0
Stem Tuber 0
Unclassified 6.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000073 3300001977 Bacteria 10717
2 JGI24742J22300_10011617 3300002244 Bacteria 1464
3 rootH2_10000605 3300003320 Bacteria 27930
4 rootH2_10106787 3300003320 Bacteria 9047
5 rootH2_10242479 3300003320 Bacteria 3577
6 rootL2_10151003 3300003322 Bacteria 11599
7 rootH1_10001729 3300003323 Bacteria 67609
8 rootH1_10060585 3300003323 Bacteria 1034
9 Ga0055530_10017940 3300003791 Bacteria 2200
10 Ga0065712_10095100 3300005290 Bacteria 2230
11 Ga0070658_10000638 3300005327 Bacteria 30268
12 Ga0070658_10345973 3300005327 Bacteria 1272
13 Ga0070676_10102159 3300005328 Bacteria 1773
14 Ga0070683_101271599 3300005329 Bacteria 707
15 Ga0070670_100290484 3300005331 Bacteria 1429
16 Ga0068869_100125489 3300005334 Bacteria 1968
17 Ga0070660_100086174 3300005339 Bacteria 2471
18 Ga0070689_100111283 3300005340 Bacteria 2178
19 Ga0070661_100331680 3300005344 Bacteria 1190
20 Ga0070713_100107838 3300005436 Bacteria 2424
21 Ga0070705_100169936 3300005440 Bacteria 1466
22 Ga0068867_100000064 3300005459 Bacteria 64233
23 Ga0070685_10053697 3300005466 Bacteria 2335
24 Ga0070686_100005002 3300005544 Bacteria 7317
25 Ga0070665_100000064 3300005548 Bacteria 216416
26 Ga0070665_100296689 3300005548 Unclassified 1619
27 Ga0070664_100005725 3300005564 Bacteria 10015
28 Ga0068857_100316593 3300005577 Bacteria 1440
29 Ga0068854_100561997 3300005578 Bacteria 969
30 Ga0068856_100013105 3300005614 Bacteria 8030
31 Ga0068856_100369105 3300005614 Bacteria 1454
32 Ga0068866_10488701 3300005718 Bacteria 812
33 Ga0068870_10956120 3300005840 Bacteria 608
34 Ga0068863_100005634 3300005841 Bacteria 12303
35 Ga0068858_100121441 3300005842 Unclassified 2443
36 Ga0068858_100209959 3300005842 Bacteria 1842
37 Ga0068860_100727265 3300005843 Unclassified 1003
38 Ga0068862_100314599 3300005844 Bacteria 1444
39 Ga0068862_100857686 3300005844 Unclassified 890
40 Ga0070712_100169909 3300006175 Bacteria 1691
41 Ga0075369_10097026 3300006186 Bacteria 1320
42 Ga0097621_100015773 3300006237 Bacteria 5695
43 Ga0068871_101154488 3300006358 Unclassified 725
44 Ga0075428_100264889 3300006844 Bacteria 1850
45 Ga0075431_101087801 3300006847 Bacteria 764
46 Ga0075436_100212274 3300006914 Bacteria 1372
47 Ga0105240_10002174 3300009093 Bacteria 31975
48 Ga0105240_10010853 3300009093 Bacteria 12759
49 Ga0105240_10049717 3300009093 Bacteria 5290
50 Ga0105240_10676419 3300009093 Unclassified 1129
51 Ga0105245_12284477 3300009098 Bacteria 595
52 Ga0105243_10000088 3300009148 Bacteria 103915
53 Ga0105242_10671034 3300009176 Bacteria 1010
54 Ga0105238_10130829 3300009551 Bacteria 2488
55 Ga0105238_10784327 3300009551 Unclassified 968
56 Ga0105239_10555739 3300010375 Bacteria 1307
57 Ga0157373_10014748 3300013100 Bacteria 5724
58 Ga0157373_10398257 3300013100 Bacteria 986
59 Ga0157369_11327288 3300013105 Bacteria 733
60 Ga0157374_10000499 3300013296 Bacteria 35595
61 Ga0157372_10387014 3300013307 Bacteria 1629
62 Ga0157375_10339250 3300013308 Bacteria 1668
63 Ga0157376_10000965 3300014969 Bacteria 18744
64 Ga0157376_10025349 3300014969 Bacteria 4670
65 Ga0157376_10845963 3300014969 Unclassified 930
66 Ga0209050_1000602 3300025298 Bacteria 57277
67 Ga0207645_10043719 3300025907 Bacteria 2867
68 Ga0207705_10023564 3300025909 Bacteria 4391
69 Ga0207695_10000022 3300025913 Bacteria 659090
70 Ga0207695_10035685 3300025913 Bacteria 5387
71 Ga0207695_10037482 3300025913 Bacteria 5231
72 Ga0207649_10361373 3300025920 Bacteria 1077
73 Ga0207646_10767234 3300025922 Bacteria 860
74 Ga0207690_11160324 3300025932 Bacteria 644
75 Ga0207686_10113948 3300025934 Bacteria 1829
76 Ga0207709_10000270 3300025935 Bacteria 61008
77 Ga0207670_10003228 3300025936 Bacteria 8639
78 Ga0207670_10213847 3300025936 Bacteria 1472
79 Ga0207704_10097641 3300025938 Bacteria 1949
80 Ga0207689_10059836 3300025942 Bacteria 3133
81 Ga0207667_10531641 3300025949 Bacteria 1190
82 Ga0207668_10082506 3300025972 Bacteria 2336
83 Ga0207640_10210806 3300025981 Bacteria 1480
84 Ga0207703_10063339 3300026035 Bacteria 3032
85 Ga0207703_10219857 3300026035 Bacteria 1698
86 Ga0207702_10000221 3300026078 Bacteria 66273
87 Ga0207702_10329560 3300026078 Bacteria 1456
88 Ga0207641_10004336 3300026088 Bacteria 12316
89 Ga0207648_10000192 3300026089 Bacteria 64301
90 Ga0207674_10369867 3300026116 Bacteria 1386
91 Ga0268266_10000035 3300028379 Bacteria 351632
92 Ga0268265_10824421 3300028380 Unclassified 906
93 Ga0265337_1013292 3300028556 Bacteria 2768
94 Ga0265337_1074107 3300028556 Bacteria 934
95 Ga0265334_10017818 3300028573 Bacteria 2930
96 Ga0265334_10055912 3300028573 Bacteria 1500
97 Ga0265323_10003071 3300028653 Bacteria 7435
98 Ga0265323_10011780 3300028653 Bacteria 3519
99 Ga0265323_10012328 3300028653 Bacteria 3430
100 Ga0265338_10024080 3300028800 Bacteria 6231
101 Ga0265338_10062423 3300028800 Bacteria 3256
102 Ga0265338_10077125 3300028800 Bacteria 2818
103 Ga0307511_10404488 3300030521 Unclassified 559
104 Ga0265771_1001535 3300031010 Unclassified 1108
105 Ga0265320_10011547 3300031240 Bacteria 5190
106 Ga0265340_10362493 3300031247 Bacteria 640
107 Ga0265331_10014288 3300031250 Viruses 4234
108 Ga0265331_10075168 3300031250 Unclassified 1576
109 Ga0265327_10012185 3300031251 Bacteria 5830
110 Ga0265327_10021020 3300031251 Bacteria 3953
111 Ga0265316_10004069 3300031344 Bacteria 14626
112 Ga0265316_10390643 3300031344 Bacteria 1003
113 Ga0265316_10396532 3300031344 Bacteria 994
114 Ga0265316_11124604 3300031344 Bacteria 544
115 Ga0307408_100000031 3300031548 Bacteria 214210
116 Ga0307408_100005958 3300031548 Bacteria 8118
117 Ga0265342_10085433 3300031712 Bacteria 1816
118 Ga0265342_10248734 3300031712 Bacteria 949
119 Ga0265342_10329663 3300031712 Bacteria 798
120 Ga0307406_10014244 3300031901 Bacteria 4571
121 Ga0307407_10008359 3300031903 Unclassified 4744
122 Ga0307407_11234228 3300031903 Bacteria 585
123 Ga0307412_10000048 3300031911 Bacteria 155055
124 Ga0307412_10247296 3300031911 Bacteria 1383
125 Ga0307409_100008864 3300031995 Bacteria 6137
126 Ga0307416_100071565 3300032002 Bacteria 2881
127 Ga0307414_10519698 3300032004 Bacteria 1056
128 Ga0307411_11116364 3300032005 Unclassified 711
129 Ga0373926_0105643 3300035083 Unclassified 1055
130 Ga0373945_0056325 3300035116 Unclassified 1458
131 Ga0373954_0050490 3300035118 Bacteria 1951
132 Ga0373954_0196861 3300035118 Bacteria 990
133 Ga0373935_0986583 3300035692 Unclassified 625
134 Ga0373927_0249229 3300035695 Unclassified 1167
135 Ga0373947_0252081 3300035725 Unclassified 1167
136 Ga0373925_0004566 3300037068 Bacteria 10462
137 Ga0395899_0000015 3300037312 Bacteria 470061
138 Ga0395900_0216229 3300037418 Unclassified 1934
139 Ga0395898_0000047 3300037466 Bacteria 294005
140 Ga0395905_0031533 3300037471 Bacteria 4990
141 Ga0395905_0236069 3300037471 Bacteria 1709
142 Ga0395901_0079199 3300038443 Bacteria 3431
143 Ga0436365_0893219 3300039437 Unclassified 1293
144 Ga0451798_0293186 3300041458 Bacteria 524
145 Ga0451807_1950312 3300041486 Bacteria 560
146 Ga0451849_0582930 3300041505 Bacteria 714
147 Ga0450888_065914 3300042126 Bacteria 538
148 Ga0450890_000024 3300042127 Bacteria 42783
149 Ga0450891_002469 3300042129 Bacteria 1863
150 Ga0450892_000311 3300042130 Bacteria 5731
151 Ga0450889_010491 3300042144 Bacteria 956
152 Ga0450893_0000839 3300042532 Bacteria 4551
153 Ga0450893_0009065 3300042532 Bacteria 1624
154 Ga0450893_0122076 3300042532 Bacteria 544
155 Ga0451577_0014824 3300042876 Bacteria 7262
156 Ga0451576_0000807 3300045051 Bacteria 61371
157 Ga0451576_0002243 3300045051 Bacteria 29638
158 Ga0451576_0023563 3300045051 Bacteria 6664
159 Ga0451576_0275569 3300045051 Bacteria 1759
160 Ga0466967_0932007 3300045976 Bacteria 864
161 Ga0495618_0162254 3300046514 Bacteria 1424
162 Ga0495630_0155702 3300046517 Bacteria 1739
163 Ga0495630_0738796 3300046517 Bacteria 752
164 Ga0495643_0000997 3300046522 Bacteria 28895
165 Ga0495634_0013903 3300046642 Bacteria 5817
166 Ga0495658_0005667 3300046683 Bacteria 6137
167 Ga0495675_0101286 3300047444 Bacteria 1802
168 Ga0495684_0427654 3300047471 Bacteria 924
169 Ga0495686_0584417 3300047472 Bacteria 580
170 Ga0496123_0195764 3300048926 Bacteria 1041
171 Ga0501032_0032209 3300049569 Bacteria 3592
172 Ga0501032_0802813 3300049569 Unclassified 594
173 Ga0501036_0303249 3300049572 Bacteria 1336
174 Ga0501037_1137342 3300049573 Bacteria 505
175 Ga0501038_0002296 3300049574 Bacteria 17782
176 Ga0501038_0626318 3300049574 Bacteria 812
177 Ga0501038_0766038 3300049574 Unclassified 719
178 Ga0501039_0419315 3300049575 Bacteria 1051
179 Ga0501046_0009500 3300049580 Bacteria 8404
180 Ga0501067_0313317 3300049583 Bacteria 874
181 Ga0501070_0507588 3300049586 Bacteria 968
182 Ga0501073_0131037 3300049589 Bacteria 1738
183 Ga0501227_006598 3300049665 Bacteria 2492
184 Ga0501257_032820 3300049686 Bacteria 1257
185 Ga0501257_118952 3300049686 Bacteria 706
186 Ga0501259_007329 3300049688 Bacteria 1766
187 Ga0501080_0635872 3300049742 Bacteria 945
188 Ga0501044_0333949 3300049823 Unclassified 1438
189 nmdc:mga07m45_312725_c1 3300050496 Bacteria 913
190 nmdc:mga08y16_466949_c1 3300050511 Unclassified 1285
191 nmdc:mga08x19_456190_c1 3300050514 Bacteria 900
192 nmdc:mga0sz30_80521_c1 3300050516 Bacteria 1409
193 Ga0500643_052273 3300053087 Bacteria 1165
194 Ga0500559_0125153 3300053136 Bacteria 1197
195 Ga0500616_0019154 3300053153 Bacteria 3859
196 Ga0466962_0000007 3300061719 Bacteria 157857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041458 Ga0451798_0293186 Ga0451798_0293186_21_473 135
2 3300005578 Ga0068854_100561997 Ga0068854_1005619972 138
3 iso_pu_bacteria 2786546548 2787506107 139
4 iso_pu_bacteria 2786546940 2788435827 140
5 3300005548 Ga0070665_100000064 Ga0070665_100000064171 142
6 3300009093 Ga0105240_10002174 Ga0105240_100021744 142
7 3300009551 Ga0105238_10784327 Ga0105238_107843272 142
8 3300025913 Ga0207695_10035685 Ga0207695_100356854 142
9 3300028379 Ga0268266_10000035 Ga0268266_10000035227 142
10 3300031247 Ga0265340_10362493 Ga0265340_103624932 142
11 3300031344 Ga0265316_10390643 Ga0265316_103906432 142
12 3300031712 Ga0265342_10329663 Ga0265342_103296632 142
13 3300049686 Ga0501257_118952 Ga0501257_118952_113_541 142
14 3300003322 rootL2_10151003 rootL2_101510036 143
15 3300005331 Ga0070670_100290484 Ga0070670_1002904842 143
16 3300005577 Ga0068857_100316593 Ga0068857_1003165932 143
17 3300005614 Ga0068856_100013105 Ga0068856_1000131056 143
18 3300005844 Ga0068862_100314599 Ga0068862_1003145992 143
19 3300009551 Ga0105238_10130829 Ga0105238_101308293 143
20 3300026116 Ga0207674_10369867 Ga0207674_103698672 143
21 3300028556 Ga0265337_1074107 Ga0265337_10741072 143
22 3300028800 Ga0265338_10077125 Ga0265338_100771252 143
23 3300042126 Ga0450888_065914 Ga0450888_065914_77_508 143
24 3300042144 Ga0450889_010491 Ga0450889_010491_48_491 143
25 3300042532 Ga0450893_0122076 Ga0450893_0122076_28_471 143
26 iso_pu_bacteria 2786546517 2787438656 143
27 3300009093 Ga0105240_10049717 Ga0105240_100497176 144
28 3300035118 Ga0373954_0196861 Ga0373954_0196861_277_711 144
29 3300039437 Ga0436365_0893219 Ga0436365_0893219_825_1259 144
30 3300046642 Ga0495634_0013903 Ga0495634_0013903_4978_5412 144
31 3300049686 Ga0501257_032820 Ga0501257_032820_50_484 144
32 3300003323 rootH1_10001729 rootH1_1000172952 145
33 3300005327 Ga0070658_10345973 Ga0070658_103459731 145
34 3300005544 Ga0070686_100005002 Ga0070686_1000050025 145
35 3300005841 Ga0068863_100005634 Ga0068863_1000056343 145
36 3300005842 Ga0068858_100121441 Ga0068858_1001214412 145
37 3300005843 Ga0068860_100727265 Ga0068860_1007272652 145
38 3300006237 Ga0097621_100015773 Ga0097621_1000157732 145
39 3300009098 Ga0105245_12284477 Ga0105245_122844771 145
40 3300013100 Ga0157373_10014748 Ga0157373_100147485 145
41 3300013100 Ga0157373_10398257 Ga0157373_103982572 145
42 3300013105 Ga0157369_11327288 Ga0157369_113272882 145
43 3300013296 Ga0157374_10000499 Ga0157374_100004996 145
44 3300013307 Ga0157372_10387014 Ga0157372_103870142 145
45 3300014969 Ga0157376_10000965 Ga0157376_100009656 145
46 3300025932 Ga0207690_11160324 Ga0207690_111603241 145
47 3300025949 Ga0207667_10531641 Ga0207667_105316412 145
48 3300025972 Ga0207668_10082506 Ga0207668_100825061 145
49 3300026035 Ga0207703_10063339 Ga0207703_100633394 145
50 3300026078 Ga0207702_10000221 Ga0207702_1000022134 145
51 3300026088 Ga0207641_10004336 Ga0207641_1000433610 145
52 3300028556 Ga0265337_1013292 Ga0265337_10132924 145
53 3300028800 Ga0265338_10062423 Ga0265338_100624234 145
54 3300031548 Ga0307408_100000031 Ga0307408_100000031159 145
55 3300031548 Ga0307408_100005958 Ga0307408_1000059585 145
56 3300031901 Ga0307406_10014244 Ga0307406_100142445 145
57 3300031903 Ga0307407_10008359 Ga0307407_100083594 145
58 3300031911 Ga0307412_10247296 Ga0307412_102472962 145
59 3300031995 Ga0307409_100008864 Ga0307409_1000088643 145
60 3300032002 Ga0307416_100071565 Ga0307416_1000715652 145
61 3300032005 Ga0307411_11116364 Ga0307411_111163642 145
62 3300037312 Ga0395899_0000015 Ga0395899_0000015_228113_228568 145
63 3300037466 Ga0395898_0000047 Ga0395898_0000047_4124_4561 145
64 3300045976 Ga0466967_0932007 Ga0466967_0932007_137_574 145
65 3300046514 Ga0495618_0162254 Ga0495618_0162254_448_894 145
66 3300046683 Ga0495658_0005667 Ga0495658_0005667_4274_4711 145
67 3300048926 Ga0496123_0195764 Ga0496123_0195764_57_494 145
68 3300049572 Ga0501036_0303249 Ga0501036_0303249_307_762 145
69 3300049574 Ga0501038_0766038 Ga0501038_0766038_249_695 145
70 3300053087 Ga0500643_052273 Ga0500643_052273_39_476 145
71 3300061719 Ga0466962_0000007 Ga0466962_0000007_155063_155500 145
72 3300003320 rootH2_10000605 rootH2_100006055 146
73 3300003320 rootH2_10242479 rootH2_102424795 146
74 3300005329 Ga0070683_101271599 Ga0070683_1012715991 146
75 3300005340 Ga0070689_100111283 Ga0070689_1001112831 146
76 3300005614 Ga0068856_100369105 Ga0068856_1003691053 146
77 3300006186 Ga0075369_10097026 Ga0075369_100970262 146
78 3300006844 Ga0075428_100264889 Ga0075428_1002648891 146
79 3300009093 Ga0105240_10010853 Ga0105240_100108534 146
80 3300010375 Ga0105239_10555739 Ga0105239_105557392 146
81 3300025913 Ga0207695_10000022 Ga0207695_1000002290 146
82 3300025936 Ga0207670_10213847 Ga0207670_102138472 146
83 3300026078 Ga0207702_10329560 Ga0207702_103295602 146
84 3300028653 Ga0265323_10003071 Ga0265323_100030714 146
85 3300028653 Ga0265323_10011780 Ga0265323_100117803 146
86 3300028653 Ga0265323_10012328 Ga0265323_100123282 146
87 3300031010 Ga0265771_1001535 Ga0265771_10015353 146
88 3300031344 Ga0265316_10004069 Ga0265316_100040692 146
89 3300031344 Ga0265316_11124604 Ga0265316_111246041 146
90 3300031712 Ga0265342_10085433 Ga0265342_100854332 146
91 3300037418 Ga0395900_0216229 Ga0395900_0216229_1374_1817 146
92 3300037471 Ga0395905_0031533 Ga0395905_0031533_3300_3743 146
93 3300041486 Ga0451807_1950312 Ga0451807_1950312_12_485 146
94 3300042876 Ga0451577_0014824 Ga0451577_0014824_3504_3947 146
95 3300045051 Ga0451576_0275569 Ga0451576_0275569_1063_1512 146
96 3300049574 Ga0501038_0002296 Ga0501038_0002296_8099_8539 146
97 3300049583 Ga0501067_0313317 Ga0501067_0313317_172_612 146
98 3300049586 Ga0501070_0507588 Ga0501070_0507588_283_729 146
99 3300050516 nmdc:mga0sz30_80521_c1 nmdc:mga0sz30_80521_c1_603_1043 146
100 3300001977 JGI24746J21847_1000073 JGI24746J21847_10000736 147
101 3300002244 JGI24742J22300_10011617 JGI24742J22300_100116172 147
102 3300003320 rootH2_10106787 rootH2_101067876 147
103 3300003323 rootH1_10060585 rootH1_100605852 147
104 3300003791 Ga0055530_10017940 Ga0055530_100179403 147
105 3300005290 Ga0065712_10095100 Ga0065712_100951003 147
106 3300005327 Ga0070658_10000638 Ga0070658_100006381 147
107 3300005328 Ga0070676_10102159 Ga0070676_101021591 147
108 3300005334 Ga0068869_100125489 Ga0068869_1001254892 147
109 3300005339 Ga0070660_100086174 Ga0070660_1000861742 147
110 3300005344 Ga0070661_100331680 Ga0070661_1003316801 147
111 3300005436 Ga0070713_100107838 Ga0070713_1001078385 147
112 3300005440 Ga0070705_100169936 Ga0070705_1001699362 147
113 3300005459 Ga0068867_100000064 Ga0068867_10000006446 147
114 3300005466 Ga0070685_10053697 Ga0070685_100536973 147
115 3300005548 Ga0070665_100296689 Ga0070665_1002966891 147
116 3300005564 Ga0070664_100005725 Ga0070664_1000057255 147
117 3300005718 Ga0068866_10488701 Ga0068866_104887012 147
118 3300005840 Ga0068870_10956120 Ga0068870_109561202 147
119 3300005842 Ga0068858_100209959 Ga0068858_1002099593 147
120 3300005844 Ga0068862_100857686 Ga0068862_1008576861 147
121 3300006175 Ga0070712_100169909 Ga0070712_1001699093 147
122 3300006358 Ga0068871_101154488 Ga0068871_1011544881 147
123 3300006847 Ga0075431_101087801 Ga0075431_1010878012 147
124 3300006914 Ga0075436_100212274 Ga0075436_1002122742 147
125 3300009093 Ga0105240_10676419 Ga0105240_106764191 147
126 3300009148 Ga0105243_10000088 Ga0105243_1000008815 147
127 3300009176 Ga0105242_10671034 Ga0105242_106710342 147
128 3300013308 Ga0157375_10339250 Ga0157375_103392502 147
129 3300014969 Ga0157376_10025349 Ga0157376_100253495 147
130 3300014969 Ga0157376_10845963 Ga0157376_108459632 147
131 3300025298 Ga0209050_1000602 Ga0209050_100060224 147
132 3300025907 Ga0207645_10043719 Ga0207645_100437193 147
133 3300025909 Ga0207705_10023564 Ga0207705_100235646 147
134 3300025913 Ga0207695_10037482 Ga0207695_100374825 147
135 3300025920 Ga0207649_10361373 Ga0207649_103613732 147
136 3300025922 Ga0207646_10767234 Ga0207646_107672341 147
137 3300025934 Ga0207686_10113948 Ga0207686_101139483 147
138 3300025935 Ga0207709_10000270 Ga0207709_1000027047 147
139 3300025936 Ga0207670_10003228 Ga0207670_100032285 147
140 3300025938 Ga0207704_10097641 Ga0207704_100976411 147
141 3300025942 Ga0207689_10059836 Ga0207689_100598363 147
142 3300025981 Ga0207640_10210806 Ga0207640_102108062 147
143 3300026035 Ga0207703_10219857 Ga0207703_102198571 147
144 3300026089 Ga0207648_10000192 Ga0207648_1000019246 147
145 3300028380 Ga0268265_10824421 Ga0268265_108244212 147
146 3300028573 Ga0265334_10017818 Ga0265334_100178183 147
147 3300028573 Ga0265334_10055912 Ga0265334_100559122 147
148 3300028800 Ga0265338_10024080 Ga0265338_100240803 147
149 3300030521 Ga0307511_10404488 Ga0307511_104044881 147
150 3300031240 Ga0265320_10011547 Ga0265320_100115475 147
151 3300031250 Ga0265331_10014288 Ga0265331_100142882 147
152 3300031250 Ga0265331_10075168 Ga0265331_100751682 147
153 3300031251 Ga0265327_10012185 Ga0265327_100121853 147
154 3300031251 Ga0265327_10021020 Ga0265327_100210202 147
155 3300031344 Ga0265316_10396532 Ga0265316_103965322 147
156 3300031712 Ga0265342_10248734 Ga0265342_102487341 147
157 3300031903 Ga0307407_11234228 Ga0307407_112342281 147
158 3300031911 Ga0307412_10000048 Ga0307412_1000004867 147
159 3300032004 Ga0307414_10519698 Ga0307414_105196982 147
160 3300035083 Ga0373926_0105643 Ga0373926_0105643_543_998 147
161 3300035116 Ga0373945_0056325 Ga0373945_0056325_888_1343 147
162 3300035118 Ga0373954_0050490 Ga0373954_0050490_504_959 147
163 3300035692 Ga0373935_0986583 Ga0373935_0986583_82_537 147
164 3300035695 Ga0373927_0249229 Ga0373927_0249229_102_557 147
165 3300035725 Ga0373947_0252081 Ga0373947_0252081_642_1097 147
166 3300037068 Ga0373925_0004566 Ga0373925_0004566_109_564 147
167 3300037471 Ga0395905_0236069 Ga0395905_0236069_1102_1554 147
168 3300038443 Ga0395901_0079199 Ga0395901_0079199_1208_1654 147
169 3300041505 Ga0451849_0582930 Ga0451849_0582930_164_607 147
170 3300042127 Ga0450890_000024 Ga0450890_000024_35737_36180 147
171 3300042129 Ga0450891_002469 Ga0450891_002469_1042_1485 147
172 3300042130 Ga0450892_000311 Ga0450892_000311_4922_5365 147
173 3300042532 Ga0450893_0000839 Ga0450893_0000839_1727_2170 147
174 3300042532 Ga0450893_0009065 Ga0450893_0009065_995_1438 147
175 3300045051 Ga0451576_0000807 Ga0451576_0000807_36870_37331 147
176 3300045051 Ga0451576_0002243 Ga0451576_0002243_24147_24608 147
177 3300045051 Ga0451576_0023563 Ga0451576_0023563_331_774 147
178 3300046517 Ga0495630_0155702 Ga0495630_0155702_989_1444 147
179 3300046517 Ga0495630_0738796 Ga0495630_0738796_230_682 147
180 3300046522 Ga0495643_0000997 Ga0495643_0000997_17045_17524 147
181 3300047444 Ga0495675_0101286 Ga0495675_0101286_33_479 147
182 3300047471 Ga0495684_0427654 Ga0495684_0427654_427_882 147
183 3300047472 Ga0495686_0584417 Ga0495686_0584417_38_493 147
184 3300049569 Ga0501032_0032209 Ga0501032_0032209_1081_1524 147
185 3300049569 Ga0501032_0802813 Ga0501032_0802813_54_518 147
186 3300049573 Ga0501037_1137342 Ga0501037_1137342_33_476 147
187 3300049574 Ga0501038_0626318 Ga0501038_0626318_206_652 147
188 3300049575 Ga0501039_0419315 Ga0501039_0419315_342_785 147
189 3300049580 Ga0501046_0009500 Ga0501046_0009500_6398_6853 147
190 3300049589 Ga0501073_0131037 Ga0501073_0131037_272_718 147
191 3300049665 Ga0501227_006598 Ga0501227_006598_177_632 147
192 3300049688 Ga0501259_007329 Ga0501259_007329_337_789 147
193 3300049742 Ga0501080_0635872 Ga0501080_0635872_83_529 147
194 3300049823 Ga0501044_0333949 Ga0501044_0333949_591_1043 147
195 3300050496 nmdc:mga07m45_312725_c1 nmdc:mga07m45_312725_c1_269_712 147
196 3300050511 nmdc:mga08y16_466949_c1 nmdc:mga08y16_466949_c1_356_817 147
197 3300050514 nmdc:mga08x19_456190_c1 nmdc:mga08x19_456190_c1_127_585 147
198 3300053136 Ga0500559_0125153 Ga0500559_0125153_319_768 147
199 3300053153 Ga0500616_0019154 Ga0500616_0019154_2104_2556 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

27

157

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9579 3 139
1jl3-assembly4.cif.gz_D crystal structure of b. subtilis arsc 0.9533 5 137
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9491 3 137
1jl3-assembly3.cif.gz_C crystal structure of b. subtilis arsc 0.945 5 137
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9437 3 137
ID Description Score Start End Superfamily
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.945 5 137 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9089 4 137 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9074 5 137 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8984 6 137 3.40.50.2300
3ia3C00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;AHSP 0.8877 107 144 1.20.58.420
ID Description Score Start End GO Terms
AF-A0A5R8KCJ9-F1-model_v4 Arsenate reductase ArsC 0.9938 6 146 GO:0046685
AF-A0A7C5GVU1-F1-model_v4 Arsenate reductase ArsC 0.9836 2 146 GO:0046685
AF-A0A093XZ27-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9833 2 147 GO:0046685
AF-A0A093XZ27-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9701 2 147 GO:0046685
AF-A0A1N6DYB7-F1-model_v4 Protein tyrosine phosphatase 0.9663 1 138 GO:0046685

Feature Viewer

pLDDT pTM Quality
92.06 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map