F305578

General Info

Members Datasets Scaffolds Average Seq Length
199 140 398 97

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_102800431|Ga0068859_1028004311
Length 112
Sequence MKRSKPTEAGSLFVIELSYKASLXXXXDEIDAHMTAHMRFLKKYYAAGNFLMSGRKIPREGGIILAVGESREQIEALVKEDPFHQHGLADIRVIEFRASQKSDDLQRVLAAL

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
83 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
88 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 1.51
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 34.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_102800431 3300005617 Unclassified 535
2 Ga0065707_10551830 3300005295 Bacteria 720
3 Ga0070658_10118621 3300005327 Bacteria 2197
4 Ga0070683_100056315 3300005329 Bacteria 3651
5 Ga0070670_101028307 3300005331 Unclassified 750
6 Ga0068869_100619047 3300005334 Bacteria 916
7 Ga0070682_100000963 3300005337 Bacteria 16764
8 Ga0070682_100545848 3300005337 Bacteria 906
9 Ga0070692_10471514 3300005345 Bacteria 808
10 Ga0070669_100762834 3300005353 Unclassified 820
11 Ga0070673_102110686 3300005364 Bacteria 535
12 Ga0070705_100237330 3300005440 Unclassified 1272
13 Ga0070694_100015924 3300005444 Bacteria 4730
14 Ga0070708_100328916 3300005445 Bacteria 1440
15 Ga0070708_101334405 3300005445 Bacteria 670
16 Ga0070681_11373476 3300005458 Unclassified 630
17 Ga0070707_102131989 3300005468 Unclassified 528
18 Ga0070698_100763886 3300005471 Bacteria 910
19 Ga0070699_101046121 3300005518 Unclassified 749
20 Ga0070672_100592122 3300005543 Unclassified 965
21 Ga0070672_101424330 3300005543 Bacteria 620
22 Ga0070696_100269551 3300005546 Unclassified 1294
23 Ga0070704_100300189 3300005549 Bacteria 1338
24 Ga0070664_100380546 3300005564 Bacteria 1288
25 Ga0070702_100723378 3300005615 Bacteria 761
26 Ga0068859_101663977 3300005617 Unclassified 705
27 Ga0068864_101233328 3300005618 Unclassified 747
28 Ga0068864_102505882 3300005618 Bacteria 522
29 Ga0068861_100540490 3300005719 Bacteria 1060
30 Ga0068863_100252952 3300005841 Bacteria 1702
31 Ga0068863_101022707 3300005841 Unclassified 829
32 Ga0068863_101933198 3300005841 Bacteria 600
33 Ga0068860_101694663 3300005843 Unclassified 654
34 Ga0068862_101611838 3300005844 Unclassified 656
35 Ga0081455_10776394 3300005937 Bacteria 603
36 Ga0081539_10147199 3300005985 Unclassified 1137
37 Ga0097621_100065234 3300006237 Bacteria 2996
38 Ga0097621_100556711 3300006237 Bacteria 1044
39 Ga0068871_101871924 3300006358 Bacteria 570
40 Ga0075428_101209572 3300006844 Unclassified 796
41 Ga0075428_101442606 3300006844 Bacteria 722
42 Ga0075428_102191402 3300006844 Unclassified 570
43 Ga0075430_100314693 3300006846 Bacteria 1294
44 Ga0075433_10077742 3300006852 Bacteria 2923
45 Ga0075433_10274034 3300006852 Bacteria 1495
46 Ga0075434_100022513 3300006871 Bacteria 6136
47 Ga0075434_100032604 3300006871 Bacteria 5138
48 Ga0075429_100225288 3300006880 Bacteria 1642
49 Ga0075436_100091128 3300006914 Bacteria 2119
50 Ga0097620_100668817 3300006931 Bacteria 1130
51 Ga0097620_101663783 3300006931 Unclassified 705
52 Ga0097620_102798555 3300006931 Unclassified 535
53 Ga0075435_100027660 3300007076 Bacteria 4439
54 Ga0075435_100045625 3300007076 Bacteria 3514
55 Ga0075435_100085348 3300007076 Bacteria 2598
56 Ga0111539_10000002 3300009094 Bacteria 983359
57 Ga0111539_10000711 3300009094 Bacteria 43179
58 Ga0111539_10010820 3300009094 Bacteria 11487
59 Ga0111539_11063188 3300009094 Unclassified 941
60 Ga0111539_13050463 3300009094 Unclassified 541
61 Ga0105247_10356437 3300009101 Unclassified 1030
62 Ga0114129_10067159 3300009147 Bacteria 5001
63 Ga0114129_10856517 3300009147 Bacteria 1155
64 Ga0114129_12148830 3300009147 Unclassified 672
65 Ga0105242_10734326 3300009176 Bacteria 970
66 Ga0105242_11201997 3300009176 Bacteria 777
67 Ga0105248_10113694 3300009177 Bacteria 3053
68 Ga0105238_10375942 3300009551 Unclassified 1412
69 Ga0157378_10744924 3300013297 Bacteria 1002
70 Ga0163163_11338668 3300014325 Unclassified 778
71 Ga0157380_10085447 3300014326 Bacteria 2589
72 Ga0157380_10492581 3300014326 Bacteria 1188
73 Ga0157380_10511924 3300014326 Unclassified 1168
74 Ga0157377_10198100 3300014745 Bacteria 1273
75 Ga0157377_10307900 3300014745 Bacteria 1048
76 Ga0157377_11639952 3300014745 Bacteria 517
77 Ga0157379_10450883 3300014968 Unclassified 1188
78 Ga0157379_10896250 3300014968 Unclassified 841
79 Ga0157379_12356466 3300014968 Bacteria 531
80 Ga0207682_10186841 3300025893 Unclassified 948
81 Ga0207705_10213739 3300025909 Bacteria 1463
82 Ga0207681_10738003 3300025923 Unclassified 820
83 Ga0207694_10271185 3300025924 Bacteria 1392
84 Ga0207650_10226210 3300025925 Bacteria 1507
85 Ga0207650_10365965 3300025925 Bacteria 1188
86 Ga0207670_10909501 3300025936 Bacteria 737
87 Ga0207669_11318127 3300025937 Bacteria 614
88 Ga0207669_11580011 3300025937 Unclassified 560
89 Ga0207691_10635816 3300025940 Bacteria 902
90 Ga0207691_10646260 3300025940 Bacteria 894
91 Ga0207691_10804952 3300025940 Bacteria 790
92 Ga0207711_10471339 3300025941 Bacteria 1169
93 Ga0207689_10441837 3300025942 Bacteria 1087
94 Ga0207689_10922605 3300025942 Bacteria 737
95 Ga0207679_11265240 3300025945 Bacteria 677
96 Ga0207640_11501570 3300025981 Bacteria 605
97 Ga0207708_10369710 3300026075 Bacteria 1180
98 Ga0207708_10739963 3300026075 Unclassified 843
99 Ga0207641_10739014 3300026088 Unclassified 971
100 Ga0207676_11532382 3300026095 Bacteria 664
101 Ga0207675_100693232 3300026118 Bacteria 1027
102 Ga0207675_101725340 3300026118 Bacteria 646
103 Ga0209999_1041608 3300027543 Bacteria 862
104 Ga0209971_1003939 3300027682 Bacteria 3512
105 Ga0209966_1046286 3300027695 Bacteria 918
106 Ga0209998_10053449 3300027717 Unclassified 939
107 Ga0209974_10305884 3300027876 Unclassified 609
108 Ga0207428_10000004 3300027907 Bacteria 727800
109 Ga0207428_10008282 3300027907 Bacteria 9400
110 Ga0207428_10075070 3300027907 Unclassified 2650
111 Ga0207428_10106894 3300027907 Bacteria 2156
112 Ga0207428_10404441 3300027907 Bacteria 999
113 Ga0268265_10855916 3300028380 Bacteria 890
114 Ga0268264_10059083 3300028381 Bacteria 3212
115 Ga0265334_10073789 3300028573 Bacteria 1266
116 Ga0265332_10410010 3300031238 Bacteria 560
117 Ga0265339_10121032 3300031249 Unclassified 1345
118 Ga0265331_10212444 3300031250 Bacteria 870
119 Ga0307508_10113498 3300031616 Bacteria 2310
120 Ga0265342_10147951 3300031712 Bacteria 1306
121 Ga0307416_102781988 3300032002 Unclassified 585
122 Ga0373934_0150917 3300035086 Unclassified 952
123 Ga0373953_0182194 3300035117 Unclassified 906
124 Ga0395905_1313763 3300037471 Bacteria 627
125 Ga0451791_0501737 3300041451 Unclassified 600
126 Ga0451791_1459853 3300041451 Unclassified 676
127 Ga0451853_1864433 3300041512 Unclassified 780
128 Ga0439446_0320116 3300042156 Bacteria 548
129 Ga0439435_0004290 3300042436 Bacteria 3058
130 Ga0451577_0330414 3300042876 Bacteria 1383
131 Ga0439440_0166322 3300042993 Bacteria 639
132 Ga0451576_0870716 3300045051 Bacteria 945
133 Ga0495592_0131594 3300046454 Unclassified 1749
134 Ga0495603_0595525 3300046455 Unclassified 633
135 Ga0495629_0184366 3300046459 Bacteria 1446
136 Ga0495651_0503207 3300046462 Bacteria 775
137 Ga0495653_0107526 3300046463 Bacteria 2010
138 Ga0495580_0086383 3300046472 Unclassified 2185
139 Ga0495582_0094787 3300046473 Unclassified 1667
140 Ga0495662_0559377 3300046476 Unclassified 560
141 Ga0495664_0419660 3300046477 Bacteria 803
142 Ga0495584_0108742 3300046491 Unclassified 1402
143 Ga0495608_0010242 3300046511 Bacteria 6542
144 Ga0495618_0626015 3300046514 Unclassified 638
145 Ga0495628_0134759 3300046516 Bacteria 1888
146 Ga0495644_0162784 3300046523 Unclassified 856
147 Ga0495642_0033514 3300046528 Bacteria 2065
148 Ga0495640_0358525 3300046533 Unclassified 899
149 Ga0495586_0279655 3300046535 Unclassified 955
150 Ga0495587_0065775 3300046536 Unclassified 2116
151 Ga0495621_0006819 3300046539 Bacteria 3355
152 Ga0495645_0339625 3300046543 Unclassified 970
153 Ga0495634_0152623 3300046642 Bacteria 1460
154 Ga0495599_0035874 3300046678 Bacteria 3113
155 Ga0495599_0270998 3300046678 Bacteria 1030
156 Ga0495647_0374619 3300046681 Unclassified 651
157 Ga0495669_0104963 3300046684 Unclassified 1315
158 Ga0495613_0000696 3300046689 Bacteria 26504
159 Ga0495600_0018594 3300046809 Bacteria 4429
160 Ga0495604_0109020 3300047317 Unclassified 2021
161 Ga0495636_0252143 3300047318 Unclassified 816
162 Ga0495674_0032382 3300047319 Unclassified 4742
163 Ga0495680_0057095 3300047322 Unclassified 3021
164 Ga0495680_0445687 3300047322 Bacteria 887
165 Ga0495684_0000441 3300047471 Bacteria 33992
166 Ga0495602_0573269 3300048088 Unclassified 779
167 Ga0496114_0439085 3300048917 Bacteria 1156
168 Ga0501034_0012176 3300049571 Bacteria 8895
169 Ga0501034_0472180 3300049571 Bacteria 1170
170 Ga0501071_0572061 3300049587 Bacteria 868
171 nmdc:mga05p37_125790_c1 3300050507 Bacteria 3148
172 nmdc:mga05p37_197325_c1 3300050507 Bacteria 2440
173 nmdc:mga09592_643591_c1 3300050508 Unclassified 906
174 nmdc:mga09592_977806_c1 3300050508 Bacteria 708
175 nmdc:mga0qj67_1078217_c1 3300050509 Unclassified 628
176 nmdc:mga06r32_1104059_c1 3300050510 Bacteria 742
177 nmdc:mga06r32_1317130_c1 3300050510 Bacteria 666
178 nmdc:mga06r32_179417_c1 3300050510 Bacteria 2103
179 nmdc:mga08y16_1068140_c1 3300050511 Bacteria 784
180 nmdc:mga08y16_13086_c1 3300050511 Bacteria 8728
181 nmdc:mga08y16_136066_c1 3300050511 Unclassified 2554
182 nmdc:mga08y16_1832386_c1 3300050511 Unclassified 559
183 nmdc:mga08y16_219320_c1 3300050511 Bacteria 1969
184 nmdc:mga08y16_291_c1 3300050511 Bacteria 45407
185 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
186 nmdc:mga08y16_46140_c1 3300050511 Bacteria 4563
187 nmdc:mga08y16_496138_c1 3300050511 Bacteria 1241
188 nmdc:mga0n895_2720_c1 3300050512 Bacteria 13946
189 nmdc:mga0rr50_68593_c1 3300050513 Bacteria 2697
190 nmdc:mga0rr50_74308_c1 3300050513 Bacteria 2602
191 nmdc:mga0a205_923414_c1 3300050515 Bacteria 720
192 nmdc:mga0a205_92466_c1 3300050515 Bacteria 2923
193 Ga0495601_0001829 3300053077 Bacteria 11816
194 Ga0495612_0566118 3300053078 Unclassified 524
195 Ga0495595_0096788 3300053084 Bacteria 1421
196 Ga0495619_0000709 3300053085 Bacteria 21712
197 Ga0495619_0511583 3300053085 Bacteria 825
198 Ga0500555_008198 3300053103 Unclassified 2978
199 Ga0501082_0228971 3300060353 Bacteria 1618
200 Ga0068859_102800431
201 Ga0065707_10551830
202 Ga0070658_10118621
203 Ga0070683_100056315
204 Ga0070670_101028307
205 Ga0068869_100619047
206 Ga0070682_100000963
207 Ga0070682_100545848
208 Ga0070692_10471514
209 Ga0070669_100762834
210 Ga0070673_102110686
211 Ga0070705_100237330
212 Ga0070694_100015924
213 Ga0070708_100328916
214 Ga0070708_101334405
215 Ga0070681_11373476
216 Ga0070707_102131989
217 Ga0070698_100763886
218 Ga0070699_101046121
219 Ga0070672_100592122
220 Ga0070672_101424330
221 Ga0070696_100269551
222 Ga0070704_100300189
223 Ga0070664_100380546
224 Ga0070702_100723378
225 Ga0068859_101663977
226 Ga0068864_101233328
227 Ga0068864_102505882
228 Ga0068861_100540490
229 Ga0068863_100252952
230 Ga0068863_101022707
231 Ga0068863_101933198
232 Ga0068860_101694663
233 Ga0068862_101611838
234 Ga0081455_10776394
235 Ga0081539_10147199
236 Ga0097621_100065234
237 Ga0097621_100556711
238 Ga0068871_101871924
239 Ga0075428_101209572
240 Ga0075428_101442606
241 Ga0075428_102191402
242 Ga0075430_100314693
243 Ga0075433_10077742
244 Ga0075433_10274034
245 Ga0075434_100022513
246 Ga0075434_100032604
247 Ga0075429_100225288
248 Ga0075436_100091128
249 Ga0097620_100668817
250 Ga0097620_101663783
251 Ga0097620_102798555
252 Ga0075435_100027660
253 Ga0075435_100045625
254 Ga0075435_100085348
255 Ga0111539_10000002
256 Ga0111539_10000711
257 Ga0111539_10010820
258 Ga0111539_11063188
259 Ga0111539_13050463
260 Ga0105247_10356437
261 Ga0114129_10067159
262 Ga0114129_10856517
263 Ga0114129_12148830
264 Ga0105242_10734326
265 Ga0105242_11201997
266 Ga0105248_10113694
267 Ga0105238_10375942
268 Ga0157378_10744924
269 Ga0163163_11338668
270 Ga0157380_10085447
271 Ga0157380_10492581
272 Ga0157380_10511924
273 Ga0157377_10198100
274 Ga0157377_10307900
275 Ga0157377_11639952
276 Ga0157379_10450883
277 Ga0157379_10896250
278 Ga0157379_12356466
279 Ga0207682_10186841
280 Ga0207705_10213739
281 Ga0207681_10738003
282 Ga0207694_10271185
283 Ga0207650_10226210
284 Ga0207650_10365965
285 Ga0207670_10909501
286 Ga0207669_11318127
287 Ga0207669_11580011
288 Ga0207691_10635816
289 Ga0207691_10646260
290 Ga0207691_10804952
291 Ga0207711_10471339
292 Ga0207689_10441837
293 Ga0207689_10922605
294 Ga0207679_11265240
295 Ga0207640_11501570
296 Ga0207708_10369710
297 Ga0207708_10739963
298 Ga0207641_10739014
299 Ga0207676_11532382
300 Ga0207675_100693232
301 Ga0207675_101725340
302 Ga0209999_1041608
303 Ga0209971_1003939
304 Ga0209966_1046286
305 Ga0209998_10053449
306 Ga0209974_10305884
307 Ga0207428_10000004
308 Ga0207428_10008282
309 Ga0207428_10075070
310 Ga0207428_10106894
311 Ga0207428_10404441
312 Ga0268265_10855916
313 Ga0268264_10059083
314 Ga0265334_10073789
315 Ga0265332_10410010
316 Ga0265339_10121032
317 Ga0265331_10212444
318 Ga0307508_10113498
319 Ga0265342_10147951
320 Ga0307416_102781988
321 Ga0373934_0150917
322 Ga0373953_0182194
323 Ga0395905_1313763
324 Ga0451791_0501737
325 Ga0451791_1459853
326 Ga0451853_1864433
327 Ga0439446_0320116
328 Ga0439435_0004290
329 Ga0451577_0330414
330 Ga0439440_0166322
331 Ga0451576_0870716
332 Ga0495592_0131594
333 Ga0495603_0595525
334 Ga0495629_0184366
335 Ga0495651_0503207
336 Ga0495653_0107526
337 Ga0495580_0086383
338 Ga0495582_0094787
339 Ga0495662_0559377
340 Ga0495664_0419660
341 Ga0495584_0108742
342 Ga0495608_0010242
343 Ga0495618_0626015
344 Ga0495628_0134759
345 Ga0495644_0162784
346 Ga0495642_0033514
347 Ga0495640_0358525
348 Ga0495586_0279655
349 Ga0495587_0065775
350 Ga0495621_0006819
351 Ga0495645_0339625
352 Ga0495634_0152623
353 Ga0495599_0035874
354 Ga0495599_0270998
355 Ga0495647_0374619
356 Ga0495669_0104963
357 Ga0495613_0000696
358 Ga0495600_0018594
359 Ga0495604_0109020
360 Ga0495636_0252143
361 Ga0495674_0032382
362 Ga0495680_0057095
363 Ga0495680_0445687
364 Ga0495684_0000441
365 Ga0495602_0573269
366 Ga0496114_0439085
367 Ga0501034_0012176
368 Ga0501034_0472180
369 Ga0501071_0572061
370 nmdc:mga05p37_125790_c1
371 nmdc:mga05p37_197325_c1
372 nmdc:mga09592_643591_c1
373 nmdc:mga09592_977806_c1
374 nmdc:mga0qj67_1078217_c1
375 nmdc:mga06r32_1104059_c1
376 nmdc:mga06r32_1317130_c1
377 nmdc:mga06r32_179417_c1
378 nmdc:mga08y16_1068140_c1
379 nmdc:mga08y16_13086_c1
380 nmdc:mga08y16_136066_c1
381 nmdc:mga08y16_1832386_c1
382 nmdc:mga08y16_219320_c1
383 nmdc:mga08y16_291_c1
384 nmdc:mga08y16_2_c1
385 nmdc:mga08y16_46140_c1
386 nmdc:mga08y16_496138_c1
387 nmdc:mga0n895_2720_c1
388 nmdc:mga0rr50_68593_c1
389 nmdc:mga0rr50_74308_c1
390 nmdc:mga0a205_923414_c1
391 nmdc:mga0a205_92466_c1
392 Ga0495601_0001829
393 Ga0495612_0566118
394 Ga0495595_0096788
395 Ga0495619_0000709
396 Ga0495619_0511583
397 Ga0500555_008198
398 Ga0501082_0228971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

11

97

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.8242 1 83
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.8224 2 83
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.8167 1 82
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7996 2 83
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7898 2 88
ID Description Score Start End Superfamily
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.864 2 82 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.826 1 83 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7755 2 87 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7529 1 83 3.30.70.1060
af_Q58857_3_83_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7389 1 85 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A532BUZ2-F1-model_v4 YCII-related domain-containing protein 1.005 1 67
AF-A0A529MFK3-F1-model_v4 YCII-related domain-containing protein 0.9999 1 79
AF-A0A1M3AJS5-F1-model_v4 deleted 0.9997 1 62
AF-A0A7M3DZG6-F1-model_v4 GTP cyclohydrolase 0.9981 1 78 GO:0016787
AF-A0A530MBC2-F1-model_v4 deleted 0.9978 1 59

Map