F305156

General Info

Members Datasets Scaffolds Average Seq Length
198 166 190 331

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2687453341|2688393871
Length 378
Sequence GPESRLDARFPRSGTPASATCTCAGYLVSWGAIIRPLNSTHGEIPSMARPATLFTGQWADLPLSKMAQLTKDFGYDGIELACWGDHFEVDKANSDPSYCDNKRAFLDSLGLQCHAISAHLVGQAVLDTIDIRHKSILPPYVWGDGNPAGVNERACEELKATARAAKKFGVGVVNGFTGSSIWHLNYSFPPVPQSMIDDGFKLLATRFHPILDEFAKNGVRFALEVHPTEIAFDIYSAKMALEALDNRPEFGFNFDPSHLIWQGVDPVEFIRAFPDRIYHVHVKDATTKLNGRSGILCSHLNFGDPRRGWDFRSPGRGSVNFEEIIRALNDIGYNGPLSVEWEDSGMDREFGAAEAARFVKNLDFAPSGRAFDSAFEKA

Samples

Sample ID Description Type Environment
1 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
2 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
3 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
4 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
5 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
6 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
7 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
8 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
67 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
68 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
74 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
75 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
82 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
83 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.95
Metatranscriptomes 1.01
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 8.59
Rhizosphere 82.32
Stem 0
Stem Tuber 0
Unclassified 7.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001032 3300003203 Bacteria 13007
2 Ga0065714_10066493 3300005288 Bacteria 6755
3 Ga0065704_10072769 3300005289 Bacteria 7993
4 Ga0070670_100006710 3300005331 Bacteria 9754
5 Ga0070666_10004716 3300005335 Bacteria 8336
6 Ga0070669_100003365 3300005353 Bacteria 11495
7 Ga0070675_100006737 3300005354 Bacteria 8834
8 Ga0070671_100003422 3300005355 Bacteria 12384
9 Ga0070674_100002511 3300005356 Bacteria 10158
10 Ga0070673_100003699 3300005364 Bacteria 9579
11 Ga0070688_100063159 3300005365 Bacteria 2346
12 Ga0070667_100009775 3300005367 Bacteria 7952
13 Ga0070678_100002716 3300005456 Bacteria 9766
14 Ga0070685_10218167 3300005466 Bacteria 1248
15 Ga0070672_100003506 3300005543 Bacteria 10166
16 Ga0070672_100139884 3300005543 Bacteria 1996
17 Ga0070672_100258930 3300005543 Bacteria 1467
18 Ga0068855_100076895 3300005563 Bacteria 3873
19 Ga0068863_100040813 3300005841 Bacteria 4412
20 Ga0081455_10052037 3300005937 Bacteria 3509
21 Ga0081539_10000218 3300005985 Bacteria 134538
22 Ga0075367_10063875 3300006178 Bacteria 2202
23 Ga0068871_100160450 3300006358 Bacteria 1923
24 Ga0075428_100000290 3300006844 Bacteria 49282
25 Ga0075428_100126311 3300006844 Bacteria 2783
26 Ga0075430_100071742 3300006846 Bacteria 2905
27 Ga0075431_100015695 3300006847 Bacteria 7681
28 Ga0105244_10014925 3300009036 Bacteria 4473
29 Ga0105240_10197170 3300009093 Bacteria 2363
30 Ga0114129_10496570 3300009147 Bacteria 1594
31 Ga0114129_10977762 3300009147 Bacteria 1067
32 Ga0105243_10006881 3300009148 Bacteria 8767
33 Ga0105238_10009632 3300009551 Bacteria 9664
34 Ga0105249_10311369 3300009553 Bacteria 1583
35 Ga0105246_10037730 3300011119 Bacteria 3244
36 Ga0163162_10006510 3300013306 Bacteria 11314
37 Ga0157372_10087748 3300013307 Bacteria 3530
38 Ga0163161_10032008 3300017792 Bacteria 3752
39 Ga0206350_10831288 3300020080 Bacteria 1099
40 Ga0207697_10000948 3300025315 Bacteria 16370
41 Ga0207655_1006046 3300025728 Bacteria 8090
42 Ga0207713_1018844 3300025735 Bacteria 3400
43 Ga0207688_10007781 3300025901 Bacteria 5830
44 Ga0207643_10106023 3300025908 Bacteria 1652
45 Ga0207693_10059454 3300025915 Bacteria 2994
46 Ga0207681_10015451 3300025923 Bacteria 4760
47 Ga0207694_10005772 3300025924 Bacteria 9485
48 Ga0207659_10001976 3300025926 Bacteria 12139
49 Ga0207687_10047400 3300025927 Bacteria 2979
50 Ga0207687_10313121 3300025927 Bacteria 1268
51 Ga0207644_10082593 3300025931 Bacteria 2377
52 Ga0207670_10079056 3300025936 Bacteria 2295
53 Ga0207669_10002352 3300025937 Bacteria 8037
54 Ga0207669_10116772 3300025937 Bacteria 1802
55 Ga0207661_10116016 3300025944 Bacteria 2273
56 Ga0207667_10073678 3300025949 Bacteria 3548
57 Ga0207651_10015241 3300025960 Bacteria 4462
58 Ga0207668_10187127 3300025972 Bacteria 1638
59 Ga0207708_10142480 3300026075 Bacteria 1881
60 Ga0207641_10018002 3300026088 Bacteria 5789
61 Ga0207675_100068160 3300026118 Bacteria 3326
62 Ga0207675_100569034 3300026118 Bacteria 1134
63 Ga0207683_10004409 3300026121 Bacteria 12171
64 Ga0265338_10010488 3300028800 Bacteria 10852
65 Ga0265338_10014527 3300028800 Bacteria 8752
66 Ga0265338_10229855 3300028800 Bacteria 1380
67 Ga0307511_10000237 3300030521 Bacteria 56458
68 Ga0307512_10008808 3300030522 Bacteria 9792
69 Ga0265760_10000481 3300031090 Bacteria 11203
70 Ga0265325_10054471 3300031241 Bacteria 2047
71 Ga0307513_10015242 3300031456 Bacteria 9329
72 Ga0307509_10013427 3300031507 Bacteria 9698
73 Ga0307509_10023524 3300031507 Bacteria 6914
74 Ga0307508_10176595 3300031616 Bacteria 1739
75 Ga0316576_10030859 3300031727 Unclassified 3799
76 Ga0316578_10110224 3300031728 Unclassified 1653
77 Ga0316577_10010254 3300031733 Bacteria 5053
78 Ga0307413_10019416 3300031824 Bacteria 3592
79 Ga0307518_10051215 3300031838 Bacteria 3002
80 Ga0307407_10230488 3300031903 Bacteria 1258
81 Ga0307409_100139029 3300031995 Bacteria 2089
82 Ga0307416_100705878 3300032002 Bacteria 1098
83 Ga0316583_10025157 3300032133 Bacteria 2126
84 Ga0316580_10008141 3300032139 Unclassified 3138
85 Ga0307507_10000009 3300033179 Bacteria 265992
86 Ga0307507_10124390 3300033179 Bacteria 2048
87 Ga0307510_10065368 3300033180 Bacteria 3684
88 Ga0373936_0035043 3300035113 Bacteria 1997
89 Ga0373943_0003071 3300035170 Bacteria 7586
90 Ga0316574_0079368 3300035398 Bacteria 2082
91 Ga0373931_0012653 3300035691 Bacteria 4092
92 Ga0373927_0013319 3300035695 Bacteria 5468
93 Ga0373947_0004337 3300035725 Bacteria 8329
94 Ga0316584_0019537 3300036712 Unclassified 4898
95 Ga0373925_0000008 3300037068 Bacteria 249158
96 Ga0436361_0932622 3300039447 Bacteria 1058
97 Ga0436361_1046165 3300039447 Bacteria 15030
98 Ga0451577_0428747 3300042876 Bacteria 1201
99 Ga0466969_0020129 3300044656 Bacteria 3459
100 Ga0453683_0049971 3300044673 Bacteria 2620
101 Ga0453684_0001099 3300044712 Bacteria 85094
102 Ga0453684_0045084 3300044712 Bacteria 5886
103 Ga0453684_0072183 3300044712 Bacteria 4359
104 Ga0453684_0116740 3300044712 Bacteria 3231
105 Ga0451576_0000252 3300045051 Bacteria 132040
106 Ga0451576_0001934 3300045051 Bacteria 33107
107 Ga0451576_0109946 3300045051 Bacteria 2868
108 Ga0495592_0001334 3300046454 Bacteria 17129
109 Ga0495603_0016139 3300046455 Bacteria 4516
110 Ga0495629_0142330 3300046459 Bacteria 1668
111 Ga0495651_0003412 3300046462 Bacteria 12184
112 Ga0495653_0001697 3300046463 Bacteria 17322
113 Ga0495580_0219259 3300046472 Bacteria 1308
114 Ga0495582_0027018 3300046473 Bacteria 3145
115 Ga0495662_0000025 3300046476 Bacteria 52709
116 Ga0495628_0000966 3300046516 Bacteria 26291
117 Ga0495630_0002439 3300046517 Bacteria 12865
118 Ga0495630_0108729 3300046517 Bacteria 2100
119 Ga0495666_0003296 3300046526 Bacteria 8153
120 Ga0495652_0005150 3300046529 Bacteria 12353
121 Ga0495665_0019809 3300046531 Bacteria 3617
122 Ga0495587_0002076 3300046536 Bacteria 13384
123 Ga0495622_0105062 3300046557 Bacteria 1294
124 Ga0495667_0002512 3300046559 Bacteria 12249
125 Ga0495656_0061405 3300046615 Bacteria 1641
126 Ga0495635_0002350 3300046663 Bacteria 12865
127 Ga0495588_0000803 3300046674 Bacteria 14042
128 Ga0495588_0035573 3300046674 Bacteria 2524
129 Ga0495599_0001787 3300046678 Bacteria 12469
130 Ga0495623_0001983 3300046679 Bacteria 13741
131 Ga0495646_0000216 3300046680 Bacteria 28707
132 Ga0495613_0017217 3300046689 Bacteria 5383
133 Ga0495600_0001459 3300046809 Bacteria 13113
134 Ga0495604_0000053 3300047317 Bacteria 101884
135 Ga0495674_0026614 3300047319 Bacteria 5292
136 Ga0495687_002523 3300047443 Bacteria 14532
137 Ga0495687_029921 3300047443 Bacteria 2513
138 Ga0495675_0002009 3300047444 Bacteria 12156
139 Ga0495684_0003200 3300047471 Bacteria 12838
140 Ga0495602_0003649 3300048088 Bacteria 15946
141 Ga0495614_0015521 3300048089 Bacteria 3321
142 Ga0496100_0068090 3300048903 Bacteria 2366
143 Ga0496101_0075530 3300048904 Bacteria 2481
144 Ga0496102_0008166 3300048905 Bacteria 8958
145 Ga0496102_0027560 3300048905 Bacteria 5073
146 Ga0496104_0005810 3300048907 Bacteria 10805
147 Ga0496105_0004670 3300048908 Bacteria 10326
148 Ga0496106_0087492 3300048909 Bacteria 2400
149 Ga0496107_0049699 3300048910 Bacteria 3022
150 Ga0496108_0045147 3300048911 Bacteria 3679
151 Ga0496108_0281689 3300048911 Bacteria 1447
152 Ga0496109_0014651 3300048912 Bacteria 6821
153 Ga0496109_0083667 3300048912 Bacteria 2943
154 Ga0496112_0008340 3300048915 Bacteria 9275
155 Ga0496113_0003126 3300048916 Bacteria 9848
156 Ga0496114_0023000 3300048917 Bacteria 5080
157 Ga0496115_0169947 3300048918 Bacteria 1803
158 Ga0496115_0283483 3300048918 Bacteria 1360
159 Ga0496124_0005264 3300048927 Bacteria 14640
160 Ga0496126_0097608 3300048929 Bacteria 2575
161 Ga0501032_0061788 3300049569 Bacteria 2511
162 Ga0501033_0000031 3300049570 Bacteria 156672
163 Ga0501034_0002338 3300049571 Bacteria 23141
164 Ga0501034_0005226 3300049571 Bacteria 14241
165 Ga0501034_0015467 3300049571 Bacteria 7841
166 Ga0501034_0042773 3300049571 Bacteria 4586
167 Ga0501034_0093520 3300049571 Bacteria 3003
168 Ga0501034_0281340 3300049571 Bacteria 1603
169 Ga0501036_0198386 3300049572 Bacteria 1688
170 Ga0501037_0018451 3300049573 Bacteria 5143
171 Ga0501037_0024025 3300049573 Bacteria 4506
172 Ga0501038_0018496 3300049574 Bacteria 6291
173 Ga0501042_0182767 3300049578 Bacteria 1513
174 Ga0501046_0045800 3300049580 Bacteria 3473
175 Ga0501047_0390799 3300049581 Bacteria 1224
176 Ga0501068_0140475 3300049584 Bacteria 1514
177 Ga0501073_0004525 3300049589 Bacteria 10454
178 Ga0501080_0011727 3300049742 Bacteria 8032
179 Ga0501080_0028032 3300049742 Bacteria 5237
180 Ga0501080_0062599 3300049742 Bacteria 3463
181 Ga0501035_0449348 3300049822 Bacteria 1066
182 Ga0501044_0022623 3300049823 Bacteria 6696
183 Ga0501045_0369207 3300049824 Bacteria 1068
184 nmdc:mga06r32_12566_c1 3300050510 Bacteria 7645
185 nmdc:mga08y16_497870_c1 3300050511 Bacteria 1238
186 Ga0495601_0244497 3300053077 Bacteria 1172
187 Ga0495655_0050051 3300053083 Bacteria 1103
188 Ga0495619_0127253 3300053085 Bacteria 1749
189 Ga0500660_036968 3300053100 Bacteria 2511
190 Ga0500616_0074680 3300053153 Bacteria 1718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10014527 Ga0265338_100145274 304
2 3300031456 Ga0307513_10015242 Ga0307513_100152427 307
3 3300033179 Ga0307507_10124390 Ga0307507_101243902 308
4 3300035691 Ga0373931_0012653 Ga0373931_0012653_2979_4010 310
5 3300005543 Ga0070672_100258930 Ga0070672_1002589301 316
6 3300049742 Ga0501080_0028032 Ga0501080_0028032_2870_3829 316
7 3300053153 Ga0500616_0074680 Ga0500616_0074680_481_1440 316
8 3300006358 Ga0068871_100160450 Ga0068871_1001604502 317
9 3300025908 Ga0207643_10106023 Ga0207643_101060232 317
10 3300044656 Ga0466969_0020129 Ga0466969_0020129_2182_3186 321
11 3300005288 Ga0065714_10066493 Ga0065714_100664932 325
12 3300005331 Ga0070670_100006710 Ga0070670_1000067109 325
13 3300005335 Ga0070666_10004716 Ga0070666_100047166 325
14 3300005353 Ga0070669_100003365 Ga0070669_10000336510 325
15 3300005354 Ga0070675_100006737 Ga0070675_1000067378 325
16 3300005355 Ga0070671_100003422 Ga0070671_10000342211 325
17 3300005356 Ga0070674_100002511 Ga0070674_1000025112 325
18 3300005364 Ga0070673_100003699 Ga0070673_1000036999 325
19 3300005367 Ga0070667_100009775 Ga0070667_1000097753 325
20 3300005456 Ga0070678_100002716 Ga0070678_1000027163 325
21 3300005543 Ga0070672_100003506 Ga0070672_1000035062 325
22 3300009036 Ga0105244_10014925 Ga0105244_100149253 325
23 3300009148 Ga0105243_10006881 Ga0105243_100068812 325
24 3300011119 Ga0105246_10037730 Ga0105246_100377303 325
25 3300013306 Ga0163162_10006510 Ga0163162_100065103 325
26 3300025315 Ga0207697_10000948 Ga0207697_1000094814 325
27 3300025728 Ga0207655_1006046 Ga0207655_10060467 325
28 3300025735 Ga0207713_1018844 Ga0207713_10188442 325
29 3300025923 Ga0207681_10015451 Ga0207681_100154513 325
30 3300025926 Ga0207659_10001976 Ga0207659_100019769 325
31 3300025927 Ga0207687_10047400 Ga0207687_100474002 325
32 3300025931 Ga0207644_10082593 Ga0207644_100825932 325
33 3300025937 Ga0207669_10002352 Ga0207669_100023526 325
34 3300025960 Ga0207651_10015241 Ga0207651_100152412 325
35 3300025972 Ga0207668_10187127 Ga0207668_101871272 325
36 3300026121 Ga0207683_10004409 Ga0207683_100044099 325
37 3300046557 Ga0495622_0105062 Ga0495622_0105062_47_1042 325
38 3300046615 Ga0495656_0061405 Ga0495656_0061405_228_1223 325
39 3300046674 Ga0495588_0000803 Ga0495588_0000803_4800_5795 325
40 3300048903 Ga0496100_0068090 Ga0496100_0068090_440_1435 325
41 3300048905 Ga0496102_0008166 Ga0496102_0008166_7380_8375 325
42 3300048905 Ga0496102_0027560 Ga0496102_0027560_2441_3436 325
43 3300048907 Ga0496104_0005810 Ga0496104_0005810_9027_10022 325
44 3300048908 Ga0496105_0004670 Ga0496105_0004670_8453_9448 325
45 3300048909 Ga0496106_0087492 Ga0496106_0087492_571_1566 325
46 3300048910 Ga0496107_0049699 Ga0496107_0049699_772_1767 325
47 3300048911 Ga0496108_0045147 Ga0496108_0045147_1429_2424 325
48 3300048912 Ga0496109_0014651 Ga0496109_0014651_491_1486 325
49 3300048915 Ga0496112_0008340 Ga0496112_0008340_7535_8530 325
50 3300048916 Ga0496113_0003126 Ga0496113_0003126_627_1622 325
51 3300048917 Ga0496114_0023000 Ga0496114_0023000_3646_4641 325
52 3300048927 Ga0496124_0005264 Ga0496124_0005264_1484_2479 325
53 3300050511 nmdc:mga08y16_497870_c1 nmdc:mga08y16_497870_c1_18_1001 326
54 iso_pu_bacteria 2684623219 2687235909 326
55 iso_pu_bacteria 2690315906 2691512583 326
56 iso_pu_bacteria 2946033335 2946035261 327
57 3300009147 Ga0114129_10977762 Ga0114129_109777621 328
58 3300031733 Ga0316577_10010254 Ga0316577_100102543 328
59 3300032139 Ga0316580_10008141 Ga0316580_100081412 328
60 3300036712 Ga0316584_0019537 Ga0316584_0019537_2756_3748 328
61 3300044673 Ga0453683_0049971 Ga0453683_0049971_424_1416 328
62 3300044712 Ga0453684_0001099 Ga0453684_0001099_48511_49503 328
63 3300045051 Ga0451576_0000252 Ga0451576_0000252_82538_83530 328
64 3300045051 Ga0451576_0109946 Ga0451576_0109946_158_1150 328
65 iso_pu_bacteria 2852646457 2852648164 328
66 iso_pu_bacteria 2920107658 2920113009 328
67 iso_pu_bacteria 2945941187 2945944682 328
68 iso_pu_bacteria 2945968032 2945970184 328
69 3300005841 Ga0068863_100040813 Ga0068863_1000408133 329
70 3300026088 Ga0207641_10018002 Ga0207641_100180025 329
71 3300042876 Ga0451577_0428747 Ga0451577_0428747_54_1046 329
72 3300044712 Ga0453684_0045084 Ga0453684_0045084_3528_4520 329
73 3300044712 Ga0453684_0072183 Ga0453684_0072183_3296_4288 329
74 3300044712 Ga0453684_0116740 Ga0453684_0116740_574_1566 329
75 3300045051 Ga0451576_0001934 Ga0451576_0001934_20162_21154 329
76 3300048911 Ga0496108_0281689 Ga0496108_0281689_16_1008 329
77 3300049570 Ga0501033_0000031 Ga0501033_0000031_145627_146619 329
78 3300049742 Ga0501080_0011727 Ga0501080_0011727_6990_7985 329
79 3300005289 Ga0065704_10072769 Ga0065704_100727696 330
80 3300005466 Ga0070685_10218167 Ga0070685_102181671 330
81 3300006178 Ga0075367_10063875 Ga0075367_100638752 330
82 3300009551 Ga0105238_10009632 Ga0105238_100096326 330
83 3300025924 Ga0207694_10005772 Ga0207694_100057723 330
84 3300028800 Ga0265338_10229855 Ga0265338_102298551 330
85 3300031090 Ga0265760_10000481 Ga0265760_100004811 330
86 3300031727 Ga0316576_10030859 Ga0316576_100308593 330
87 3300031728 Ga0316578_10110224 Ga0316578_101102242 330
88 3300032133 Ga0316583_10025157 Ga0316583_100251572 330
89 3300035398 Ga0316574_0079368 Ga0316574_0079368_92_1087 330
90 3300039447 Ga0436361_0932622 Ga0436361_0932622_21_1031 330
91 3300039447 Ga0436361_1046165 Ga0436361_1046165_1738_2751 330
92 3300049571 Ga0501034_0281340 Ga0501034_0281340_86_1087 330
93 3300049584 Ga0501068_0140475 Ga0501068_0140475_382_1377 330
94 3300005365 Ga0070688_100063159 Ga0070688_1000631592 331
95 3300005543 Ga0070672_100139884 Ga0070672_1001398842 331
96 3300005563 Ga0068855_100076895 Ga0068855_1000768952 331
97 3300005937 Ga0081455_10052037 Ga0081455_100520372 331
98 3300006844 Ga0075428_100000290 Ga0075428_10000029037 331
99 3300006844 Ga0075428_100126311 Ga0075428_1001263112 331
100 3300006846 Ga0075430_100071742 Ga0075430_1000717422 331
101 3300006847 Ga0075431_100015695 Ga0075431_1000156955 331
102 3300009553 Ga0105249_10311369 Ga0105249_103113692 331
103 3300017792 Ga0163161_10032008 Ga0163161_100320084 331
104 3300025927 Ga0207687_10313121 Ga0207687_103131211 331
105 3300025936 Ga0207670_10079056 Ga0207670_100790562 331
106 3300025949 Ga0207667_10073678 Ga0207667_100736783 331
107 3300026118 Ga0207675_100569034 Ga0207675_1005690341 331
108 3300048918 Ga0496115_0169947 Ga0496115_0169947_471_1469 331
109 3300048929 Ga0496126_0097608 Ga0496126_0097608_869_1867 331
110 3300049571 Ga0501034_0005226 Ga0501034_0005226_9785_10783 331
111 3300049571 Ga0501034_0015467 Ga0501034_0015467_1303_2301 331
112 3300049578 Ga0501042_0182767 Ga0501042_0182767_367_1365 331
113 3300049824 Ga0501045_0369207 Ga0501045_0369207_12_1010 331
114 3300050510 nmdc:mga06r32_12566_c1 nmdc:mga06r32_12566_c1_2621_3622 331
115 iso_pu_bacteria 2687453341 2688393871 331
116 3300009093 Ga0105240_10197170 Ga0105240_101971702 332
117 3300009147 Ga0114129_10496570 Ga0114129_104965701 332
118 3300013307 Ga0157372_10087748 Ga0157372_100877484 332
119 3300020080 Ga0206350_10831288 Ga0206350_108312881 332
120 3300025901 Ga0207688_10007781 Ga0207688_100077815 332
121 3300025915 Ga0207693_10059454 Ga0207693_100594542 332
122 3300025937 Ga0207669_10116772 Ga0207669_101167722 332
123 3300025944 Ga0207661_10116016 Ga0207661_101160162 332
124 3300026075 Ga0207708_10142480 Ga0207708_101424802 332
125 3300026118 Ga0207675_100068160 Ga0207675_1000681602 332
126 3300028800 Ga0265338_10010488 Ga0265338_100104887 332
127 3300031241 Ga0265325_10054471 Ga0265325_100544712 332
128 3300031824 Ga0307413_10019416 Ga0307413_100194162 332
129 3300031903 Ga0307407_10230488 Ga0307407_102304882 332
130 3300031995 Ga0307409_100139029 Ga0307409_1001390292 332
131 3300032002 Ga0307416_100705878 Ga0307416_1007058781 332
132 3300035113 Ga0373936_0035043 Ga0373936_0035043_540_1544 332
133 3300035170 Ga0373943_0003071 Ga0373943_0003071_1930_2934 332
134 3300035695 Ga0373927_0013319 Ga0373927_0013319_4293_5297 332
135 3300035725 Ga0373947_0004337 Ga0373947_0004337_1227_2231 332
136 3300046455 Ga0495603_0016139 Ga0495603_0016139_3402_4406 332
137 3300046459 Ga0495629_0142330 Ga0495629_0142330_558_1562 332
138 3300046472 Ga0495580_0219259 Ga0495580_0219259_237_1241 332
139 3300046473 Ga0495582_0027018 Ga0495582_0027018_409_1413 332
140 3300046517 Ga0495630_0108729 Ga0495630_0108729_65_1069 332
141 3300046531 Ga0495665_0019809 Ga0495665_0019809_2005_3009 332
142 3300046674 Ga0495588_0035573 Ga0495588_0035573_67_1071 332
143 3300048089 Ga0495614_0015521 Ga0495614_0015521_162_1166 332
144 3300048904 Ga0496101_0075530 Ga0496101_0075530_280_1281 332
145 3300048912 Ga0496109_0083667 Ga0496109_0083667_1606_2607 332
146 3300048918 Ga0496115_0283483 Ga0496115_0283483_80_1093 332
147 3300049569 Ga0501032_0061788 Ga0501032_0061788_1125_2135 332
148 3300049571 Ga0501034_0002338 Ga0501034_0002338_15693_16697 332
149 3300049571 Ga0501034_0042773 Ga0501034_0042773_146_1156 332
150 3300049571 Ga0501034_0093520 Ga0501034_0093520_1350_2351 332
151 3300049572 Ga0501036_0198386 Ga0501036_0198386_162_1172 332
152 3300049573 Ga0501037_0018451 Ga0501037_0018451_397_1398 332
153 3300049573 Ga0501037_0024025 Ga0501037_0024025_2440_3450 332
154 3300049574 Ga0501038_0018496 Ga0501038_0018496_1495_2496 332
155 3300049580 Ga0501046_0045800 Ga0501046_0045800_1687_2697 332
156 3300049581 Ga0501047_0390799 Ga0501047_0390799_164_1174 332
157 3300049589 Ga0501073_0004525 Ga0501073_0004525_6610_7641 332
158 3300049742 Ga0501080_0062599 Ga0501080_0062599_1399_2430 332
159 3300049822 Ga0501035_0449348 Ga0501035_0449348_19_1029 332
160 3300049823 Ga0501044_0022623 Ga0501044_0022623_3999_5009 332
161 3300053077 Ga0495601_0244497 Ga0495601_0244497_22_1026 332
162 3300053083 Ga0495655_0050051 Ga0495655_0050051_76_1077 332
163 3300053085 Ga0495619_0127253 Ga0495619_0127253_23_1027 332
164 3300003203 JGI25406J46586_10001032 JGI25406J46586_1000103210 333
165 3300005985 Ga0081539_10000218 Ga0081539_1000021817 333
166 3300030521 Ga0307511_10000237 Ga0307511_100002378 333
167 3300030522 Ga0307512_10008808 Ga0307512_100088082 333
168 3300031507 Ga0307509_10013427 Ga0307509_100134278 333
169 3300031507 Ga0307509_10023524 Ga0307509_100235241 333
170 3300031616 Ga0307508_10176595 Ga0307508_101765952 333
171 3300031838 Ga0307518_10051215 Ga0307518_100512153 333
172 3300033179 Ga0307507_10000009 Ga0307507_1000000949 333
173 3300033180 Ga0307510_10065368 Ga0307510_100653682 333
174 3300037068 Ga0373925_0000008 Ga0373925_0000008_37508_38509 333
175 3300046454 Ga0495592_0001334 Ga0495592_0001334_7092_8096 333
176 3300046462 Ga0495651_0003412 Ga0495651_0003412_4832_5836 333
177 3300046463 Ga0495653_0001697 Ga0495653_0001697_4644_5648 333
178 3300046476 Ga0495662_0000025 Ga0495662_0000025_18093_19097 333
179 3300046516 Ga0495628_0000966 Ga0495628_0000966_22072_23076 333
180 3300046517 Ga0495630_0002439 Ga0495630_0002439_7030_8034 333
181 3300046526 Ga0495666_0003296 Ga0495666_0003296_7017_8021 333
182 3300046529 Ga0495652_0005150 Ga0495652_0005150_6518_7522 333
183 3300046536 Ga0495587_0002076 Ga0495587_0002076_6032_7036 333
184 3300046559 Ga0495667_0002512 Ga0495667_0002512_6505_7509 333
185 3300046663 Ga0495635_0002350 Ga0495635_0002350_4832_5836 333
186 3300046678 Ga0495599_0001787 Ga0495599_0001787_4436_5440 333
187 3300046679 Ga0495623_0001983 Ga0495623_0001983_7906_8910 333
188 3300046680 Ga0495646_0000216 Ga0495646_0000216_8343_9347 333
189 3300046689 Ga0495613_0017217 Ga0495613_0017217_111_1115 333
190 3300046809 Ga0495600_0001459 Ga0495600_0001459_7278_8282 333
191 3300047317 Ga0495604_0000053 Ga0495604_0000053_54508_55512 333
192 3300047319 Ga0495674_0026614 Ga0495674_0026614_3728_4732 333
193 3300047443 Ga0495687_002523 Ga0495687_002523_4839_5843 333
194 3300047443 Ga0495687_029921 Ga0495687_029921_61_1065 333
195 3300047444 Ga0495675_0002009 Ga0495675_0002009_4832_5836 333
196 3300047471 Ga0495684_0003200 Ga0495684_0003200_7030_8034 333
197 3300048088 Ga0495602_0003649 Ga0495602_0003649_6796_7800 333
198 3300053100 Ga0500660_036968 Ga0500660_036968_1301_2305 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

67

362

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.9871 3 322
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.978 3 322
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.8647 1 317
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.8259 1 317
3p6l-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_1903) from parabacteroides distasonis atcc 8503 at 1.85 a resolution 0.8193 2 317
ID Description Score Start End Superfamily
2zdsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9824 3 321 3.20.20.150
2zdsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9763 3 321 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8522 1 317 3.20.20.150
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8519 4 320 3.20.20.150
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8468 4 320 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A5N6AW59-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9988 1 73 GO:0016853
AF-X0XQR7-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9926 1 204
AF-A0A6G3XUI2-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9924 68 168 GO:0016853
AF-A0A7K2XCR6-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9922 1 116 GO:0016853
AF-A0A3B1E944-F1-model_v4 Inosose isomerase (EC 5.3.99.11) 0.9917 1 167 GO:0016853

Feature Viewer

pLDDT pTM Quality
94.54 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map