F305086

General Info

Members Datasets Scaffolds Average Seq Length
198 142 396 104

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_004352|Ga0500643_004352_628_1014
Length 128
Sequence MASRFVVNSRKSPLPPLGASGYGTRMFLAIFRNRKRPDIDAKAYAADATRMEALARSQPGFLSFKSYTADDGEIVALSEWSSEAAVHAWGSHPDHAVIQRRGRAEYYQDYTLFACDSPTVHRFERPKS

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
90 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
94 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
95 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
96 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
97 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
98 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
99 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
116 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
117 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
142 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.62
Nodule 2.02
Rhizoplane 3.54
Rhizosphere 75.25
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_004352 3300053087 Bacteria 6444
2 SwRhRL2b_contig_3016067 2162886007 Bacteria 23314
3 JGI24739J22299_10238955 3300001989 Bacteria 532
4 JGI24738J21930_10018938 3300002075 Bacteria 1438
5 Ga0070658_10179464 3300005327 Bacteria 1781
6 Ga0070658_10681539 3300005327 Bacteria 892
7 Ga0070670_100175713 3300005331 Bacteria 1858
8 Ga0068869_100720309 3300005334 Bacteria 852
9 Ga0070660_100064251 3300005339 Bacteria 2855
10 Ga0070660_101715699 3300005339 Bacteria 535
11 Ga0070661_101164885 3300005344 Bacteria 644
12 Ga0070668_100032717 3300005347 Bacteria 3956
13 Ga0070669_100003833 3300005353 Bacteria 10862
14 Ga0070675_100636007 3300005354 Bacteria 969
15 Ga0070675_102015977 3300005354 Bacteria 532
16 Ga0070671_100000829 3300005355 Bacteria 22442
17 Ga0070671_100251189 3300005355 Bacteria 1502
18 Ga0070659_100034699 3300005366 Bacteria 3925
19 Ga0070659_100329800 3300005366 Bacteria 1277
20 Ga0070667_100324288 3300005367 Bacteria 1390
21 Ga0070667_100512277 3300005367 Bacteria 1100
22 Ga0070663_100393983 3300005455 Bacteria 1130
23 Ga0070662_100001857 3300005457 Bacteria 12937
24 Ga0070662_100157075 3300005457 Bacteria 1776
25 Ga0070681_10483752 3300005458 Bacteria 1151
26 Ga0070679_100037366 3300005530 Bacteria 4823
27 Ga0070684_101525451 3300005535 Bacteria 630
28 Ga0070665_100000070 3300005548 Bacteria 200681
29 Ga0068855_100057044 3300005563 Bacteria 4579
30 Ga0068855_100058146 3300005563 Bacteria 4530
31 Ga0070664_100045394 3300005564 Bacteria 3711
32 Ga0068857_100201121 3300005577 Bacteria 1816
33 Ga0068852_100305734 3300005616 Bacteria 1541
34 Ga0068852_100451221 3300005616 Bacteria 1273
35 Ga0068852_100480235 3300005616 Bacteria 1235
36 Ga0068852_101136537 3300005616 Bacteria 802
37 Ga0068859_103016617 3300005617 Bacteria 514
38 Ga0068851_10121731 3300005834 Bacteria 1403
39 Ga0068863_100008269 3300005841 Bacteria 10165
40 Ga0068863_100124572 3300005841 Bacteria 2458
41 Ga0068863_101023290 3300005841 Bacteria 829
42 Ga0068858_100251231 3300005842 Bacteria 1680
43 Ga0068860_100009280 3300005843 Bacteria 9776
44 Ga0068860_100141189 3300005843 Bacteria 2315
45 Ga0075364_11164953 3300006051 Bacteria 523
46 Ga0075366_10476372 3300006195 Bacteria 771
47 Ga0097621_100576684 3300006237 Bacteria 1026
48 Ga0075370_10016192 3300006353 Bacteria 4008
49 Ga0075370_10046467 3300006353 Bacteria 2457
50 Ga0079104_1021451 3300006946 Bacteria 1758
51 Ga0079104_1063403 3300006946 Bacteria 791
52 Ga0099826_10440445 3300006948 Bacteria 623
53 Ga0105251_10000882 3300009011 Bacteria 26854
54 Ga0105247_10018703 3300009101 Bacteria 4159
55 Ga0105248_10375263 3300009177 Bacteria 1601
56 Ga0105249_10144549 3300009553 Bacteria 2284
57 Ga0105246_10008927 3300011119 Bacteria 6169
58 Ga0157373_10066743 3300013100 Bacteria 2544
59 Ga0157373_10308366 3300013100 Bacteria 1124
60 Ga0157371_10661959 3300013102 Bacteria 780
61 Ga0157371_11251646 3300013102 Unclassified 573
62 Ga0157370_10148105 3300013104 Bacteria 2185
63 Ga0157372_10152255 3300013307 Bacteria 2670
64 Ga0157375_11013422 3300013308 Bacteria 970
65 Ga0163163_11189816 3300014325 Bacteria 825
66 Ga0157376_11886069 3300014969 Bacteria 634
67 Ga0207713_1030548 3300025735 Bacteria 2397
68 Ga0207710_10201510 3300025900 Bacteria 983
69 Ga0207705_10578529 3300025909 Bacteria 873
70 Ga0207660_10179644 3300025917 Bacteria 1643
71 Ga0207657_10221270 3300025919 Bacteria 1516
72 Ga0207649_10659130 3300025920 Bacteria 809
73 Ga0207652_10015692 3300025921 Bacteria 6169
74 Ga0207652_10314874 3300025921 Bacteria 1413
75 Ga0207652_10645622 3300025921 Bacteria 947
76 Ga0207681_10000487 3300025923 Bacteria 27811
77 Ga0207681_10403409 3300025923 Bacteria 1105
78 Ga0207650_10323167 3300025925 Bacteria 1264
79 Ga0207659_11841507 3300025926 Bacteria 514
80 Ga0207644_10002222 3300025931 Bacteria 12594
81 Ga0207644_10203763 3300025931 Bacteria 1561
82 Ga0207690_10021175 3300025932 Bacteria 4028
83 Ga0207690_10507377 3300025932 Bacteria 976
84 Ga0207690_10783776 3300025932 Bacteria 787
85 Ga0207706_10001925 3300025933 Bacteria 20393
86 Ga0207706_10191894 3300025933 Bacteria 1793
87 Ga0207706_10435749 3300025933 Bacteria 1135
88 Ga0207711_10014183 3300025941 Bacteria 6619
89 Ga0207661_11041270 3300025944 Bacteria 754
90 Ga0207679_10332423 3300025945 Bacteria 1319
91 Ga0207679_11640469 3300025945 Bacteria 589
92 Ga0207667_10026538 3300025949 Bacteria 6325
93 Ga0207667_10107458 3300025949 Bacteria 2879
94 Ga0207712_10091975 3300025961 Bacteria 2235
95 Ga0207668_10114695 3300025972 Bacteria 2028
96 Ga0207658_10001103 3300025986 Bacteria 21772
97 Ga0207658_10285295 3300025986 Bacteria 1417
98 Ga0207703_10767668 3300026035 Bacteria 919
99 Ga0207678_10016595 3300026067 Bacteria 6468
100 Ga0207641_10009197 3300026088 Bacteria 8151
101 Ga0207641_10088257 3300026088 Bacteria 2707
102 Ga0207674_10229058 3300026116 Bacteria 1806
103 Ga0207698_10381598 3300026142 Bacteria 1341
104 Ga0207698_10832224 3300026142 Bacteria 927
105 Ga0207698_12717939 3300026142 Bacteria 504
106 Ga0209281_1051166 3300027111 Bacteria 658
107 Ga0268266_10004067 3300028379 Bacteria 14142
108 Ga0268265_10006389 3300028380 Bacteria 7988
109 Ga0268265_10037123 3300028380 Bacteria 3573
110 Ga0268264_10002553 3300028381 Bacteria 15971
111 Ga0268264_10014576 3300028381 Bacteria 6458
112 Ga0268264_10109740 3300028381 Bacteria 2415
113 Ga0307408_100191811 3300031548 Bacteria 1647
114 Ga0307405_10228061 3300031731 Bacteria 1371
115 Ga0307413_10031448 3300031824 Bacteria 2996
116 Ga0307413_10230330 3300031824 Bacteria 1360
117 Ga0307410_10388021 3300031852 Bacteria 1125
118 Ga0307407_10526748 3300031903 Bacteria 870
119 Ga0307407_11294534 3300031903 Bacteria 572
120 Ga0307412_10013677 3300031911 Bacteria 4767
121 Ga0307412_10122991 3300031911 Bacteria 1871
122 Ga0307412_10129604 3300031911 Bacteria 1830
123 Ga0307409_100724370 3300031995 Bacteria 996
124 Ga0307416_100704632 3300032002 Bacteria 1099
125 Ga0307416_103832600 3300032002 Bacteria 504
126 Ga0307414_10063503 3300032004 Bacteria 2625
127 Ga0307414_10134423 3300032004 Bacteria 1926
128 Ga0307414_10201975 3300032004 Bacteria 1617
129 Ga0307411_10484069 3300032005 Bacteria 1043
130 Ga0307411_11710939 3300032005 Bacteria 582
131 Ga0307510_10549375 3300033180 Bacteria 601
132 Ga0373944_0339029 3300035089 Bacteria 570
133 Ga0316574_0870133 3300035398 Bacteria 546
134 Ga0316584_0173428 3300036712 Bacteria 1598
135 Ga0436364_0520634 3300037853 Bacteria 529
136 Ga0451800_0525694 3300041459 Unclassified 568
137 Ga0451802_0219998 3300041460 Bacteria 599
138 Ga0451833_0768336 3300041491 Bacteria 505
139 Ga0439443_032879 3300042003 Bacteria 861
140 Ga0450898_155771 3300042134 Bacteria 502
141 Ga0439435_0285467 3300042436 Bacteria 562
142 Ga0450893_0134944 3300042532 Bacteria 523
143 Ga0451577_0380558 3300042876 Bacteria 1281
144 Ga0451577_1725012 3300042876 Bacteria 551
145 Ga0453684_0157855 3300044712 Bacteria 2687
146 Ga0451576_0420342 3300045051 Bacteria 1402
147 Ga0495638_0461137 3300046460 Bacteria 647
148 Ga0495650_0140581 3300046471 Bacteria 874
149 Ga0495639_0175874 3300046475 Bacteria 1041
150 Ga0495621_0373124 3300046539 Bacteria 601
151 Ga0495668_0088736 3300046616 Bacteria 1695
152 Ga0495668_0336292 3300046616 Bacteria 829
153 Ga0495668_0363178 3300046616 Bacteria 795
154 Ga0495625_0019490 3300046660 Bacteria 5261
155 Ga0495686_0717288 3300047472 Bacteria 509
156 Ga0496101_0218651 3300048904 Bacteria 1478
157 Ga0496102_1800090 3300048905 Bacteria 530
158 Ga0496103_0267876 3300048906 Bacteria 1099
159 Ga0496110_1877269 3300048913 Bacteria 509
160 Ga0496114_0173682 3300048917 Bacteria 1879
161 Ga0496116_0022945 3300048919 Bacteria 4659
162 Ga0496116_0507171 3300048919 Bacteria 500
163 Ga0496117_0062571 3300048920 Bacteria 2549
164 Ga0496117_0480509 3300048920 Bacteria 607
165 Ga0496118_0527095 3300048921 Bacteria 581
166 Ga0496119_0107339 3300048922 Bacteria 1557
167 Ga0496120_0371123 3300048923 Bacteria 638
168 Ga0496121_0065027 3300048924 Bacteria 2970
169 Ga0496123_0458534 3300048926 Bacteria 566
170 Ga0496124_0047565 3300048927 Bacteria 3669
171 Ga0496125_0077674 3300048928 Bacteria 2557
172 Ga0496125_0592690 3300048928 Bacteria 606
173 Ga0501033_0145823 3300049570 Bacteria 1709
174 Ga0501034_0960093 3300049571 Bacteria 740
175 Ga0501039_1174374 3300049575 Bacteria 594
176 Ga0501047_0093157 3300049581 Bacteria 2892
177 Ga0501047_0136525 3300049581 Bacteria 2333
178 Ga0501224_009722 3300049664 Bacteria 1409
179 Ga0501035_0190606 3300049822 Bacteria 1763
180 Ga0501044_0361567 3300049823 Bacteria 1369
181 nmdc:mga03683_179320_c1 3300050489 Bacteria 966
182 nmdc:mga00v17_310242_c1 3300050491 Bacteria 589
183 nmdc:mga0k408_255435_c1 3300050493 Bacteria 1046
184 nmdc:mga0k408_670794_c1 3300050493 Bacteria 609
185 nmdc:mga07m45_105386_c1 3300050496 Bacteria 1622
186 nmdc:mga07m45_114496_c1 3300050496 Bacteria 1555
187 nmdc:mga07m45_160265_c1 3300050496 Bacteria 1306
188 nmdc:mga07m45_440900_c1 3300050496 Bacteria 755
189 Ga0500566_0405558 3300053094 Bacteria 609
190 Ga0500562_010623 3300053108 Bacteria 2335
191 Ga0500607_000077 3300053121 Bacteria 71543
192 Ga0500559_0000782 3300053136 Bacteria 20805
193 Ga0500559_0016058 3300053136 Bacteria 3161
194 Ga0500590_106530 3300053148 Bacteria 1337
195 Ga0500622_0000119 3300053156 Bacteria 82219
196 Ga0500637_0034549 3300053178 Bacteria 2829
197 Ga0500645_005004 3300053730 Bacteria 4965
198 Ga0500645_074095 3300053730 Bacteria 975
199 Ga0500643_004352
200 SwRhRL2b_contig_3016067
201 JGI24739J22299_10238955
202 JGI24738J21930_10018938
203 Ga0070658_10179464
204 Ga0070658_10681539
205 Ga0070670_100175713
206 Ga0068869_100720309
207 Ga0070660_100064251
208 Ga0070660_101715699
209 Ga0070661_101164885
210 Ga0070668_100032717
211 Ga0070669_100003833
212 Ga0070675_100636007
213 Ga0070675_102015977
214 Ga0070671_100000829
215 Ga0070671_100251189
216 Ga0070659_100034699
217 Ga0070659_100329800
218 Ga0070667_100324288
219 Ga0070667_100512277
220 Ga0070663_100393983
221 Ga0070662_100001857
222 Ga0070662_100157075
223 Ga0070681_10483752
224 Ga0070679_100037366
225 Ga0070684_101525451
226 Ga0070665_100000070
227 Ga0068855_100057044
228 Ga0068855_100058146
229 Ga0070664_100045394
230 Ga0068857_100201121
231 Ga0068852_100305734
232 Ga0068852_100451221
233 Ga0068852_100480235
234 Ga0068852_101136537
235 Ga0068859_103016617
236 Ga0068851_10121731
237 Ga0068863_100008269
238 Ga0068863_100124572
239 Ga0068863_101023290
240 Ga0068858_100251231
241 Ga0068860_100009280
242 Ga0068860_100141189
243 Ga0075364_11164953
244 Ga0075366_10476372
245 Ga0097621_100576684
246 Ga0075370_10016192
247 Ga0075370_10046467
248 Ga0079104_1021451
249 Ga0079104_1063403
250 Ga0099826_10440445
251 Ga0105251_10000882
252 Ga0105247_10018703
253 Ga0105248_10375263
254 Ga0105249_10144549
255 Ga0105246_10008927
256 Ga0157373_10066743
257 Ga0157373_10308366
258 Ga0157371_10661959
259 Ga0157371_11251646
260 Ga0157370_10148105
261 Ga0157372_10152255
262 Ga0157375_11013422
263 Ga0163163_11189816
264 Ga0157376_11886069
265 Ga0207713_1030548
266 Ga0207710_10201510
267 Ga0207705_10578529
268 Ga0207660_10179644
269 Ga0207657_10221270
270 Ga0207649_10659130
271 Ga0207652_10015692
272 Ga0207652_10314874
273 Ga0207652_10645622
274 Ga0207681_10000487
275 Ga0207681_10403409
276 Ga0207650_10323167
277 Ga0207659_11841507
278 Ga0207644_10002222
279 Ga0207644_10203763
280 Ga0207690_10021175
281 Ga0207690_10507377
282 Ga0207690_10783776
283 Ga0207706_10001925
284 Ga0207706_10191894
285 Ga0207706_10435749
286 Ga0207711_10014183
287 Ga0207661_11041270
288 Ga0207679_10332423
289 Ga0207679_11640469
290 Ga0207667_10026538
291 Ga0207667_10107458
292 Ga0207712_10091975
293 Ga0207668_10114695
294 Ga0207658_10001103
295 Ga0207658_10285295
296 Ga0207703_10767668
297 Ga0207678_10016595
298 Ga0207641_10009197
299 Ga0207641_10088257
300 Ga0207674_10229058
301 Ga0207698_10381598
302 Ga0207698_10832224
303 Ga0207698_12717939
304 Ga0209281_1051166
305 Ga0268266_10004067
306 Ga0268265_10006389
307 Ga0268265_10037123
308 Ga0268264_10002553
309 Ga0268264_10014576
310 Ga0268264_10109740
311 Ga0307408_100191811
312 Ga0307405_10228061
313 Ga0307413_10031448
314 Ga0307413_10230330
315 Ga0307410_10388021
316 Ga0307407_10526748
317 Ga0307407_11294534
318 Ga0307412_10013677
319 Ga0307412_10122991
320 Ga0307412_10129604
321 Ga0307409_100724370
322 Ga0307416_100704632
323 Ga0307416_103832600
324 Ga0307414_10063503
325 Ga0307414_10134423
326 Ga0307414_10201975
327 Ga0307411_10484069
328 Ga0307411_11710939
329 Ga0307510_10549375
330 Ga0373944_0339029
331 Ga0316574_0870133
332 Ga0316584_0173428
333 Ga0436364_0520634
334 Ga0451800_0525694
335 Ga0451802_0219998
336 Ga0451833_0768336
337 Ga0439443_032879
338 Ga0450898_155771
339 Ga0439435_0285467
340 Ga0450893_0134944
341 Ga0451577_0380558
342 Ga0451577_1725012
343 Ga0453684_0157855
344 Ga0451576_0420342
345 Ga0495638_0461137
346 Ga0495650_0140581
347 Ga0495639_0175874
348 Ga0495621_0373124
349 Ga0495668_0088736
350 Ga0495668_0336292
351 Ga0495668_0363178
352 Ga0495625_0019490
353 Ga0495686_0717288
354 Ga0496101_0218651
355 Ga0496102_1800090
356 Ga0496103_0267876
357 Ga0496110_1877269
358 Ga0496114_0173682
359 Ga0496116_0022945
360 Ga0496116_0507171
361 Ga0496117_0062571
362 Ga0496117_0480509
363 Ga0496118_0527095
364 Ga0496119_0107339
365 Ga0496120_0371123
366 Ga0496121_0065027
367 Ga0496123_0458534
368 Ga0496124_0047565
369 Ga0496125_0077674
370 Ga0496125_0592690
371 Ga0501033_0145823
372 Ga0501034_0960093
373 Ga0501039_1174374
374 Ga0501047_0093157
375 Ga0501047_0136525
376 Ga0501224_009722
377 Ga0501035_0190606
378 Ga0501044_0361567
379 nmdc:mga03683_179320_c1
380 nmdc:mga00v17_310242_c1
381 nmdc:mga0k408_255435_c1
382 nmdc:mga0k408_670794_c1
383 nmdc:mga07m45_105386_c1
384 nmdc:mga07m45_114496_c1
385 nmdc:mga07m45_160265_c1
386 nmdc:mga07m45_440900_c1
387 Ga0500566_0405558
388 Ga0500562_010623
389 Ga0500607_000077
390 Ga0500559_0000782
391 Ga0500559_0016058
392 Ga0500590_106530
393 Ga0500622_0000119
394 Ga0500637_0034549
395 Ga0500645_005004
396 Ga0500645_074095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

26

101

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mcs-assembly1.cif.gz_A crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution 0.8975 2 89
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.8818 1 95
2bbe-assembly1.cif.gz_A crystal structure of protein so0527 from shewanella oneidensis 0.8787 2 92
2gff-assembly1.cif.gz_A crystal structure of yersinia pestis lsrg 0.8751 4 92
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.8677 2 94
ID Description Score Start End Superfamily
af_A0A1D8PRM8_52_147_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9699 1 92 3.30.70.100
af_Q54J03_9_103_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9457 1 95 3.30.70.100
af_Q54J03_9_103_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9361 1 95 3.30.70.100
af_A0A1D8PRM8_52_147_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.921 1 92 3.30.70.100
af_Q8BG18_205_343_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9094 3 95 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1H2QYY6-F1-model_v4 Heme-degrading monooxygenase HmoA 0.9718 3 92 GO:0004497
AF-A0A534LVS2-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9573 2 103 GO:0004497
AF-A0A7C7YEQ5-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9567 5 88 GO:0004497
AF-A0A7Y9U4K4-F1-model_v4 Heme-degrading monooxygenase HmoA 0.9555 4 103 GO:0004497
AF-A0A7Y3PCI4-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9533 3 104 GO:0004497

Map