F304589

General Info

Members Datasets Scaffolds Average Seq Length
198 90 396 160

Family's Representative Sequence

Representative Sequence 3300028666|Ga0265336_10001051|Ga0265336_100010517
Length 186
Sequence MRRTVLRVLRMTRAVAPDPAVVRIRKTMPDTLSFRLNGGEVHLDVDSDRHLLWVLRTDLGLTGAKYGCGEGHCGACTVLVDGKPVRSCLRRAKEVHGKDVVTIEGLAKDGKLHPLQKAFADNEAMQCGYCTPGMIMEAAGLLRANPDPSEEQILSGMEHNLCRCGAHPRIVRAIHDAAAEMRGGAK

Samples

Sample ID Description Type Environment
1 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
2 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
3 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
4 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
5 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
6 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
7 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
8 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
10 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
15 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
16 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
17 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
18 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
19 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
20 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
21 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
22 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
23 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
24 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
25 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
26 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
27 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
28 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
29 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
30 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
31 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
32 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
33 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
34 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
35 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
36 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
37 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
38 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
39 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
40 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
41 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
42 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
43 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
44 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
45 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
49 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
50 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
51 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
52 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
53 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
54 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
59 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
60 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
61 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
62 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
63 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
64 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
65 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
66 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
69 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
72 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
73 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
74 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
75 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
79 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
83 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
84 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 1.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.51
Rhizosphere 99.49
Stem 0
Stem Tuber 0
Unclassified 9.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265336_10001051 3300028666 Bacteria 13495
2 Ga0070711_100001133 3300005439 Bacteria 14260
3 Ga0070678_101083555 3300005456 Bacteria 739
4 Ga0070697_100363269 3300005536 Bacteria 1252
5 Ga0097621_101726900 3300006237 Bacteria 596
6 Ga0105248_10674310 3300009177 Bacteria 1166
7 Ga0105249_10386535 3300009553 Bacteria 1426
8 Ga0207692_10119758 3300025898 Bacteria 1472
9 Ga0207684_10605598 3300025910 Unclassified 935
10 Ga0207663_10020529 3300025916 Bacteria 3743
11 Ga0207646_10098024 3300025922 Bacteria 2627
12 Ga0207712_10453619 3300025961 Bacteria 1088
13 Ga0207683_11431147 3300026121 Bacteria 639
14 Ga0265337_1000151 3300028556 Bacteria 35150
15 Ga0265337_1002004 3300028556 Bacteria 9672
16 Ga0265337_1006129 3300028556 Bacteria 4680
17 Ga0265337_1034280 3300028556 Bacteria 1494
18 Ga0265326_10025358 3300028558 Bacteria 1691
19 Ga0265326_10062541 3300028558 Bacteria 1053
20 Ga0265319_1032727 3300028563 Bacteria 1800
21 Ga0265319_1060242 3300028563 Bacteria 1233
22 Ga0265319_1084599 3300028563 Bacteria 1005
23 Ga0265319_1121517 3300028563 Bacteria 814
24 Ga0265334_10010363 3300028573 Bacteria 3938
25 Ga0265334_10108222 3300028573 Bacteria 1001
26 Ga0265318_10004477 3300028577 Bacteria 6760
27 Ga0265318_10023629 3300028577 Bacteria 2448
28 Ga0265318_10069164 3300028577 Bacteria 1309
29 Ga0265323_10056916 3300028653 Bacteria 1369
30 Ga0265322_10042495 3300028654 Bacteria 1294
31 Ga0265336_10004101 3300028666 Bacteria 5548
32 Ga0265336_10009774 3300028666 Bacteria 3305
33 Ga0265336_10026430 3300028666 Bacteria 1824
34 Ga0265336_10051223 3300028666 Bacteria 1247
35 Ga0265336_10062821 3300028666 Bacteria 1113
36 Ga0265336_10253829 3300028666 Bacteria 522
37 Ga0265338_10002328 3300028800 Bacteria 28735
38 Ga0265338_10010144 3300028800 Bacteria 11110
39 Ga0265338_10011845 3300028800 Bacteria 10022
40 Ga0265338_10020581 3300028800 Bacteria 6934
41 Ga0265338_10032099 3300028800 Bacteria 5132
42 Ga0265338_10064359 3300028800 Bacteria 3189
43 Ga0265338_10104561 3300028800 Bacteria 2297
44 Ga0265338_10106485 3300028800 Bacteria 2270
45 Ga0265338_10287201 3300028800 Bacteria 1200
46 Ga0265338_10289324 3300028800 Bacteria 1194
47 Ga0265338_10657877 3300028800 Bacteria 726
48 Ga0265324_10016579 3300029957 Bacteria 2687
49 Ga0265324_10090317 3300029957 Bacteria 1042
50 Ga0265330_10011802 3300031235 Bacteria 4092
51 Ga0265330_10121151 3300031235 Bacteria 1115
52 Ga0265330_10141439 3300031235 Bacteria 1023
53 Ga0265330_10243685 3300031235 Bacteria 758
54 Ga0265332_10041250 3300031238 Bacteria 1997
55 Ga0265332_10059207 3300031238 Bacteria 1639
56 Ga0265328_10010527 3300031239 Bacteria 3720
57 Ga0265328_10018591 3300031239 Bacteria 2677
58 Ga0265320_10001942 3300031240 Bacteria 14608
59 Ga0265320_10005576 3300031240 Bacteria 8063
60 Ga0265320_10015208 3300031240 Bacteria 4355
61 Ga0265320_10025922 3300031240 Bacteria 3076
62 Ga0265325_10081802 3300031241 Bacteria 1604
63 Ga0265329_10019007 3300031242 Bacteria 2340
64 Ga0265340_10042523 3300031247 Bacteria 2230
65 Ga0265340_10045980 3300031247 Bacteria 2130
66 Ga0265339_10027138 3300031249 Bacteria 3274
67 Ga0265339_10179796 3300031249 Bacteria 1054
68 Ga0265339_10555168 3300031249 Bacteria 528
69 Ga0265331_10058105 3300031250 Bacteria 1832
70 Ga0265327_10002606 3300031251 Bacteria 18665
71 Ga0265327_10371273 3300031251 Viruses 623
72 Ga0265316_10001026 3300031344 Bacteria 30252
73 Ga0265316_10011471 3300031344 Bacteria 7988
74 Ga0265316_10019019 3300031344 Bacteria 5888
75 Ga0265316_10038659 3300031344 Bacteria 3841
76 Ga0265316_10044298 3300031344 Bacteria 3540
77 Ga0265316_10110379 3300031344 Bacteria 2083
78 Ga0265316_10128946 3300031344 Bacteria 1906
79 Ga0265316_10265934 3300031344 Bacteria 1256
80 Ga0265316_10279580 3300031344 Bacteria 1220
81 Ga0265316_10311948 3300031344 Bacteria 1144
82 Ga0265316_10312417 3300031344 Bacteria 1143
83 Ga0265316_10378552 3300031344 Bacteria 1021
84 Ga0265313_10012781 3300031595 Bacteria 5096
85 Ga0265313_10014675 3300031595 Bacteria 4615
86 Ga0265313_10188406 3300031595 Bacteria 864
87 Ga0316575_10057302 3300031665 Bacteria 1553
88 Ga0316579_10032135 3300031691 Bacteria 2406
89 Ga0316579_10125956 3300031691 Bacteria 1232
90 Ga0265314_10000728 3300031711 Bacteria 39616
91 Ga0265314_10044427 3300031711 Bacteria 3150
92 Ga0265314_10457004 3300031711 Bacteria 679
93 Ga0265342_10031258 3300031712 Bacteria 3293
94 Ga0265342_10050338 3300031712 Bacteria 2489
95 Ga0265342_10159098 3300031712 Bacteria 1249
96 Ga0265342_10212710 3300031712 Bacteria 1045
97 Ga0265342_10496471 3300031712 Bacteria 623
98 Ga0265342_10594302 3300031712 Bacteria 559
99 Ga0316576_10018947 3300031727 Bacteria 4709
100 Ga0316576_10058707 3300031727 Bacteria 2814
101 Ga0316576_10067636 3300031727 Bacteria 2630
102 Ga0316576_10083510 3300031727 Bacteria 2373
103 Ga0316576_10103546 3300031727 Bacteria 2129
104 Ga0316576_10117772 3300031727 Bacteria 1993
105 Ga0316576_10250564 3300031727 Bacteria 1329
106 Ga0316578_10024927 3300031728 Unclassified 3358
107 Ga0316578_10056466 3300031728 Bacteria 2306
108 Ga0316578_10175070 3300031728 Bacteria 1293
109 Ga0316578_10233170 3300031728 Bacteria 1105
110 Ga0316578_10330429 3300031728 Bacteria 909
111 Ga0316578_10362697 3300031728 Unclassified 862
112 Ga0316577_10028186 3300031733 Bacteria 3132
113 Ga0316577_10041804 3300031733 Bacteria 2565
114 Ga0316577_10147580 3300031733 Unclassified 1325
115 Ga0316577_10478189 3300031733 Bacteria 708
116 Ga0316577_10544034 3300031733 Unclassified 660
117 Ga0316583_10004206 3300032133 Bacteria 5121
118 Ga0316585_10026908 3300032137 Bacteria 1792
119 Ga0316580_10008816 3300032139 Unclassified 3027
120 Ga0316580_10014429 3300032139 Bacteria 2413
121 Ga0316593_10261539 3300032168 Unclassified 649
122 Ga0316586_1063962 3300033527 Unclassified 671
123 Ga0316588_1096641 3300033528 Unclassified 738
124 Ga0373954_0009111 3300035118 Bacteria 4365
125 Ga0373961_0001163 3300035241 Bacteria 8214
126 Ga0316574_0042393 3300035398 Bacteria 2807
127 Ga0316574_0133846 3300035398 Bacteria 1596
128 Ga0316574_0619469 3300035398 Bacteria 668
129 Ga0373937_0155476 3300036401 Bacteria 2143
130 Ga0373937_0961042 3300036401 Bacteria 803
131 Ga0316582_0026702 3300036647 Bacteria 3478
132 Ga0316582_0323688 3300036647 Bacteria 1060
133 Ga0316582_0428967 3300036647 Bacteria 911
134 Ga0316582_0430085 3300036647 Bacteria 910
135 Ga0316582_0449960 3300036647 Bacteria 888
136 Ga0316582_0577542 3300036647 Bacteria 774
137 Ga0316582_0694527 3300036647 Bacteria 699
138 Ga0316584_0021288 3300036712 Bacteria 4711
139 Ga0316584_0024367 3300036712 Unclassified 4428
140 Ga0316584_0058134 3300036712 Unclassified 2895
141 Ga0316584_0110358 3300036712 Unclassified 2058
142 Ga0316584_0181654 3300036712 Bacteria 1557
143 Ga0316584_0319526 3300036712 Bacteria 1120
144 Ga0316584_0358523 3300036712 Bacteria 1046
145 Ga0316584_0886033 3300036712 Bacteria 602
146 Ga0316581_0185219 3300037588 Unclassified 642
147 Ga0451577_0456109 3300042876 Bacteria 1161
148 Ga0451577_1605006 3300042876 Bacteria 574
149 Ga0453684_0019097 3300044712 Bacteria 10463
150 Ga0453684_0041261 3300044712 Bacteria 6247
151 Ga0453684_0428359 3300044712 Bacteria 1476
152 Ga0453684_0792194 3300044712 Bacteria 1023
153 Ga0451576_2078755 3300045051 Unclassified 584
154 Ga0495592_0052782 3300046454 Bacteria 3017
155 Ga0495651_0029969 3300046462 Bacteria 4243
156 Ga0495651_0173775 3300046462 Bacteria 1531
157 Ga0495580_0169563 3300046472 Bacteria 1509
158 Ga0495582_0021076 3300046473 Bacteria 3568
159 Ga0495662_0052647 3300046476 Bacteria 1965
160 Ga0495664_0017179 3300046477 Bacteria 4133
161 Ga0495608_0110212 3300046511 Bacteria 1770
162 Ga0495618_0118952 3300046514 Unclassified 1692
163 Ga0495618_0235001 3300046514 Bacteria 1153
164 Ga0495628_0002377 3300046516 Bacteria 16990
165 Ga0495628_0064895 3300046516 Bacteria 2858
166 Ga0495630_0000076 3300046517 Bacteria 77289
167 Ga0495630_0023223 3300046517 Bacteria 4583
168 Ga0495652_0074452 3300046529 Bacteria 2824
169 Ga0495652_0280441 3300046529 Unclassified 1220
170 Ga0495665_0159947 3300046531 Bacteria 1174
171 Ga0495640_0040565 3300046533 Bacteria 3259
172 Ga0495586_0000001 3300046535 Bacteria 231314
173 Ga0495587_0034701 3300046536 Bacteria 3041
174 Ga0495645_0014267 3300046543 Bacteria 5634
175 Ga0495645_0135654 3300046543 Unclassified 1722
176 Ga0495667_0014080 3300046559 Bacteria 5397
177 Ga0495634_0002733 3300046642 Bacteria 14507
178 Ga0495634_0019988 3300046642 Bacteria 4752
179 Ga0495635_0008655 3300046663 Bacteria 7106
180 Ga0495635_0273906 3300046663 Bacteria 1135
181 Ga0495635_0510302 3300046663 Unclassified 791
182 Ga0495657_0109022 3300046675 Bacteria 1756
183 Ga0495599_0215406 3300046678 Bacteria 1176
184 Ga0495647_0006677 3300046681 Bacteria 3835
185 Ga0495658_0270238 3300046683 Unclassified 1071
186 Ga0495613_0024179 3300046689 Bacteria 4527
187 Ga0495600_0015968 3300046809 Bacteria 4758
188 Ga0495604_0068979 3300047317 Bacteria 2681
189 Ga0495674_0000207 3300047319 Bacteria 48305
190 Ga0495674_0103659 3300047319 Bacteria 2418
191 Ga0495680_0015441 3300047322 Bacteria 6589
192 Ga0495684_0048124 3300047471 Bacteria 3260
193 Ga0495684_0072088 3300047471 Bacteria 2625
194 Ga0496106_0500662 3300048909 Bacteria 976
195 Ga0501068_0714927 3300049584 Bacteria 655
196 Ga0501080_0777359 3300049742 Bacteria 841
197 Ga0501080_1782742 3300049742 Bacteria 517
198 Ga0501083_0000313 3300049744 Bacteria 30745
199 Ga0265336_10001051
200 Ga0070711_100001133
201 Ga0070678_101083555
202 Ga0070697_100363269
203 Ga0097621_101726900
204 Ga0105248_10674310
205 Ga0105249_10386535
206 Ga0207692_10119758
207 Ga0207684_10605598
208 Ga0207663_10020529
209 Ga0207646_10098024
210 Ga0207712_10453619
211 Ga0207683_11431147
212 Ga0265337_1000151
213 Ga0265337_1002004
214 Ga0265337_1006129
215 Ga0265337_1034280
216 Ga0265326_10025358
217 Ga0265326_10062541
218 Ga0265319_1032727
219 Ga0265319_1060242
220 Ga0265319_1084599
221 Ga0265319_1121517
222 Ga0265334_10010363
223 Ga0265334_10108222
224 Ga0265318_10004477
225 Ga0265318_10023629
226 Ga0265318_10069164
227 Ga0265323_10056916
228 Ga0265322_10042495
229 Ga0265336_10004101
230 Ga0265336_10009774
231 Ga0265336_10026430
232 Ga0265336_10051223
233 Ga0265336_10062821
234 Ga0265336_10253829
235 Ga0265338_10002328
236 Ga0265338_10010144
237 Ga0265338_10011845
238 Ga0265338_10020581
239 Ga0265338_10032099
240 Ga0265338_10064359
241 Ga0265338_10104561
242 Ga0265338_10106485
243 Ga0265338_10287201
244 Ga0265338_10289324
245 Ga0265338_10657877
246 Ga0265324_10016579
247 Ga0265324_10090317
248 Ga0265330_10011802
249 Ga0265330_10121151
250 Ga0265330_10141439
251 Ga0265330_10243685
252 Ga0265332_10041250
253 Ga0265332_10059207
254 Ga0265328_10010527
255 Ga0265328_10018591
256 Ga0265320_10001942
257 Ga0265320_10005576
258 Ga0265320_10015208
259 Ga0265320_10025922
260 Ga0265325_10081802
261 Ga0265329_10019007
262 Ga0265340_10042523
263 Ga0265340_10045980
264 Ga0265339_10027138
265 Ga0265339_10179796
266 Ga0265339_10555168
267 Ga0265331_10058105
268 Ga0265327_10002606
269 Ga0265327_10371273
270 Ga0265316_10001026
271 Ga0265316_10011471
272 Ga0265316_10019019
273 Ga0265316_10038659
274 Ga0265316_10044298
275 Ga0265316_10110379
276 Ga0265316_10128946
277 Ga0265316_10265934
278 Ga0265316_10279580
279 Ga0265316_10311948
280 Ga0265316_10312417
281 Ga0265316_10378552
282 Ga0265313_10012781
283 Ga0265313_10014675
284 Ga0265313_10188406
285 Ga0316575_10057302
286 Ga0316579_10032135
287 Ga0316579_10125956
288 Ga0265314_10000728
289 Ga0265314_10044427
290 Ga0265314_10457004
291 Ga0265342_10031258
292 Ga0265342_10050338
293 Ga0265342_10159098
294 Ga0265342_10212710
295 Ga0265342_10496471
296 Ga0265342_10594302
297 Ga0316576_10018947
298 Ga0316576_10058707
299 Ga0316576_10067636
300 Ga0316576_10083510
301 Ga0316576_10103546
302 Ga0316576_10117772
303 Ga0316576_10250564
304 Ga0316578_10024927
305 Ga0316578_10056466
306 Ga0316578_10175070
307 Ga0316578_10233170
308 Ga0316578_10330429
309 Ga0316578_10362697
310 Ga0316577_10028186
311 Ga0316577_10041804
312 Ga0316577_10147580
313 Ga0316577_10478189
314 Ga0316577_10544034
315 Ga0316583_10004206
316 Ga0316585_10026908
317 Ga0316580_10008816
318 Ga0316580_10014429
319 Ga0316593_10261539
320 Ga0316586_1063962
321 Ga0316588_1096641
322 Ga0373954_0009111
323 Ga0373961_0001163
324 Ga0316574_0042393
325 Ga0316574_0133846
326 Ga0316574_0619469
327 Ga0373937_0155476
328 Ga0373937_0961042
329 Ga0316582_0026702
330 Ga0316582_0323688
331 Ga0316582_0428967
332 Ga0316582_0430085
333 Ga0316582_0449960
334 Ga0316582_0577542
335 Ga0316582_0694527
336 Ga0316584_0021288
337 Ga0316584_0024367
338 Ga0316584_0058134
339 Ga0316584_0110358
340 Ga0316584_0181654
341 Ga0316584_0319526
342 Ga0316584_0358523
343 Ga0316584_0886033
344 Ga0316581_0185219
345 Ga0451577_0456109
346 Ga0451577_1605006
347 Ga0453684_0019097
348 Ga0453684_0041261
349 Ga0453684_0428359
350 Ga0453684_0792194
351 Ga0451576_2078755
352 Ga0495592_0052782
353 Ga0495651_0029969
354 Ga0495651_0173775
355 Ga0495580_0169563
356 Ga0495582_0021076
357 Ga0495662_0052647
358 Ga0495664_0017179
359 Ga0495608_0110212
360 Ga0495618_0118952
361 Ga0495618_0235001
362 Ga0495628_0002377
363 Ga0495628_0064895
364 Ga0495630_0000076
365 Ga0495630_0023223
366 Ga0495652_0074452
367 Ga0495652_0280441
368 Ga0495665_0159947
369 Ga0495640_0040565
370 Ga0495586_0000001
371 Ga0495587_0034701
372 Ga0495645_0014267
373 Ga0495645_0135654
374 Ga0495667_0014080
375 Ga0495634_0002733
376 Ga0495634_0019988
377 Ga0495635_0008655
378 Ga0495635_0273906
379 Ga0495635_0510302
380 Ga0495657_0109022
381 Ga0495599_0215406
382 Ga0495647_0006677
383 Ga0495658_0270238
384 Ga0495613_0024179
385 Ga0495600_0015968
386 Ga0495604_0068979
387 Ga0495674_0000207
388 Ga0495674_0103659
389 Ga0495680_0015441
390 Ga0495684_0048124
391 Ga0495684_0072088
392 Ga0496106_0500662
393 Ga0501068_0714927
394 Ga0501080_0777359
395 Ga0501080_1782742
396 Ga0501083_0000313

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

102

175

0.95

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

61

126

0.86

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

34

103

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9649 1 157
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9636 3 155
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9588 1 155
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9588 3 157
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9557 3 157
ID Description Score Start End Superfamily
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9781 1 75 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.978 1 77 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9727 1 77 3.10.20.30
3hrdH01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9701 2 77 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9683 3 77 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7Y8HGK4-F1-model_v4 (2Fe-2S)-binding protein 0.9862 3 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A1F9BR11-F1-model_v4 Ferredoxin 0.9844 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A2N1VDY3-F1-model_v4 Ferredoxin 0.9835 1 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A0S8JQ16-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9823 1 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A239DF95-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9794 5 152 GO:0016491
GO:0046872
GO:0051537

Map