F304481

General Info

Members Datasets Scaffolds Average Seq Length
198 165 396 264

Family's Representative Sequence

Representative Sequence 3300020075|Ga0206349_1447964|Ga0206349_14479643
Length 300
Sequence MSRTSSPDDDHVYLSLAEGHEDGDARWAFGTGFEDPLHGVSAALPPGIDGRALAAQCLALADDALVSAQRLGEWCTRAPELEIELALANIGLDLIGQARLLYSRTGQVDGTGRSEDAYAYFRDPAEFRNVRLAELPNGDFAFSITRLLALSAWRLALFERLAGAPDPVLSAIAAKAVKELAYHRQFAAEWAVRLGDGTDESHRRMQRALYHVAPYVPELFASLDDADHTRDGDGDAVSAIQDDVLAVLRQVTATAGLVLPPLDSPADAAGYGRAGHHTEHLSPLLAELQSVARAHPGAVW

Samples

Sample ID Description Type Environment
1 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
46 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
47 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
48 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
49 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
50 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
51 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
76 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
77 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
98 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
148 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
159 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
160 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
161 2808606448 Streptomyces sp. 193411 Isolate Unclassified
162 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
163 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
164 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
165 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.44
Metatranscriptomes 1.01
Isolates 4.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 1.01
Rhizoplane 1.52
Rhizosphere 86.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206349_1447964 3300020075 Bacteria 1926
2 JGI24739J22299_10002547 3300001989 Bacteria 7029
3 JGI24737J22298_10018377 3300001990 Bacteria 2244
4 JGI24735J21928_10014597 3300002067 Bacteria 2458
5 Ga0070658_10008487 3300005327 Bacteria 8261
6 Ga0068869_100606003 3300005334 Bacteria 926
7 Ga0070660_100284182 3300005339 Bacteria 1354
8 Ga0070659_100072022 3300005366 Bacteria 2750
9 Ga0070700_100182177 3300005441 Bacteria 1463
10 Ga0070684_100209350 3300005535 Bacteria 1777
11 Ga0070665_100048888 3300005548 Bacteria 4245
12 Ga0068855_100005522 3300005563 Bacteria 15431
13 Ga0068855_100021409 3300005563 Bacteria 7753
14 Ga0068854_100001906 3300005578 Bacteria 12696
15 Ga0068852_100088096 3300005616 Bacteria 2771
16 Ga0070717_10029585 3300006028 Bacteria 4395
17 Ga0105251_10000438 3300009011 Bacteria 40380
18 Ga0105240_10667019 3300009093 Bacteria 1138
19 Ga0105241_10013644 3300009174 Bacteria 5953
20 Ga0105238_10037372 3300009551 Bacteria 4936
21 Ga0105239_10185284 3300010375 Bacteria 2329
22 Ga0157370_10002136 3300013104 Bacteria 24141
23 Ga0157369_10000541 3300013105 Bacteria 49930
24 Ga0157374_10007108 3300013296 Bacteria 9533
25 Ga0157374_10121283 3300013296 Bacteria 2523
26 Ga0163163_10118433 3300014325 Bacteria 2681
27 Ga0182007_10005911 3300015262 Bacteria 5314
28 Ga0206353_11657990 3300020082 Bacteria 3758
29 Ga0207713_1000390 3300025735 Bacteria 47707
30 Ga0207688_10186988 3300025901 Bacteria 1237
31 Ga0207647_10001411 3300025904 Bacteria 18447
32 Ga0207647_10003708 3300025904 Bacteria 11421
33 Ga0207705_10006708 3300025909 Bacteria 8512
34 Ga0207695_10148445 3300025913 Bacteria 2286
35 Ga0207671_10001866 3300025914 Bacteria 23478
36 Ga0207693_10162726 3300025915 Bacteria 1756
37 Ga0207663_10104988 3300025916 Bacteria 1906
38 Ga0207657_10269236 3300025919 Bacteria 1354
39 Ga0207694_10101669 3300025924 Bacteria 2278
40 Ga0207690_10051457 3300025932 Bacteria 2754
41 Ga0207667_10070540 3300025949 Bacteria 3636
42 Ga0207667_10382248 3300025949 Bacteria 1434
43 Ga0207640_10077029 3300025981 Bacteria 2266
44 Ga0207678_10130286 3300026067 Bacteria 2145
45 Ga0207708_10226582 3300026075 Bacteria 1499
46 Ga0207675_100011002 3300026118 Bacteria 8474
47 Ga0207698_10021148 3300026142 Bacteria 4494
48 Ga0268266_10178847 3300028379 Bacteria 1930
49 Ga0265338_10253511 3300028800 Bacteria 1297
50 Ga0265324_10009024 3300029957 Bacteria 3915
51 Ga0307511_10000824 3300030521 Bacteria 33088
52 Ga0307512_10014403 3300030522 Bacteria 7365
53 Ga0307509_10051915 3300031507 Bacteria 4379
54 Ga0307508_10326973 3300031616 Bacteria 1125
55 Ga0307514_10099047 3300031649 Bacteria 2098
56 Ga0265314_10220342 3300031711 Bacteria 1108
57 Ga0307516_10045235 3300031730 Bacteria 4349
58 Ga0307413_10158105 3300031824 Bacteria 1589
59 Ga0307413_10400393 3300031824 Bacteria 1075
60 Ga0307518_10030581 3300031838 Bacteria 3900
61 Ga0307410_10147224 3300031852 Bacteria 1749
62 Ga0307407_10091972 3300031903 Bacteria 1862
63 Ga0307409_100051262 3300031995 Bacteria 3157
64 Ga0307409_100075795 3300031995 Bacteria 2695
65 Ga0307411_10044566 3300032005 Bacteria 2847
66 Ga0307415_100301699 3300032126 Bacteria 1327
67 Ga0307510_10120614 3300033180 Bacteria 2328
68 Ga0373943_0069849 3300035170 Bacteria 1776
69 Ga0373943_0500697 3300035170 Bacteria 710
70 Ga0373935_0113684 3300035692 Bacteria 1800
71 Ga0373927_0135064 3300035695 Bacteria 1612
72 Ga0373933_0039431 3300035724 Bacteria 2779
73 Ga0373947_0038930 3300035725 Bacteria 2828
74 Ga0373937_0003315 3300036401 Bacteria 13519
75 Ga0373925_0158280 3300037068 Bacteria 1783
76 Ga0395900_0008593 3300037418 Bacteria 10493
77 Ga0395900_0086981 3300037418 Bacteria 3212
78 Ga0395898_0004331 3300037466 Bacteria 15539
79 Ga0436364_0891096 3300037853 Bacteria 17632
80 Ga0395901_0000175 3300038443 Bacteria 83175
81 Ga0439436_0002457 3300041404 Bacteria 5570
82 Ga0451853_0570254 3300041512 Bacteria 4228
83 Ga0450894_000177 3300042131 Bacteria 11342
84 Ga0450896_000661 3300042133 Bacteria 3784
85 Ga0450899_000590 3300042135 Bacteria 4135
86 Ga0466969_0005280 3300044656 Bacteria 6875
87 Ga0466969_0011411 3300044656 Bacteria 4703
88 Ga0466965_0016912 3300044683 Bacteria 3478
89 Ga0466965_0067072 3300044683 Bacteria 1801
90 Ga0466966_0029762 3300044684 Bacteria 3550
91 Ga0466961_0001940 3300044693 Bacteria 12885
92 Ga0466961_0010581 3300044693 Bacteria 5886
93 Ga0466963_0260633 3300044694 Bacteria 1217
94 Ga0466964_0038716 3300044706 Bacteria 1918
95 Ga0466971_0043914 3300044719 Bacteria 2007
96 Ga0466970_0011367 3300044765 Bacteria 4537
97 Ga0466957_0014281 3300044842 Bacteria 4623
98 Ga0466960_0061958 3300044901 Bacteria 1837
99 Ga0466959_0007389 3300045049 Bacteria 7707
100 Ga0466959_0010368 3300045049 Bacteria 6657
101 Ga0466958_0086696 3300045836 Bacteria 1932
102 Ga0466967_0198589 3300045976 Bacteria 1899
103 Ga0495617_010958 3300046452 Bacteria 3100
104 Ga0495592_0016714 3300046454 Bacteria 5569
105 Ga0495592_0018554 3300046454 Bacteria 5293
106 Ga0495592_0105372 3300046454 Bacteria 2003
107 Ga0495603_0026223 3300046455 Bacteria 3521
108 Ga0495629_0022488 3300046459 Bacteria 4495
109 Ga0495629_0109841 3300046459 Bacteria 1922
110 Ga0495638_0034061 3300046460 Bacteria 3253
111 Ga0495651_0003243 3300046462 Bacteria 12488
112 Ga0495651_0018292 3300046462 Bacteria 5426
113 Ga0495650_0006798 3300046471 Bacteria 7057
114 Ga0495605_0008180 3300046474 Bacteria 5913
115 Ga0495662_0087910 3300046476 Bacteria 1514
116 Ga0495664_0003195 3300046477 Bacteria 8897
117 Ga0495594_0034797 3300046499 Bacteria 2741
118 Ga0495606_0004805 3300046507 Bacteria 13280
119 Ga0495610_0059865 3300046512 Bacteria 1816
120 Ga0495620_0003869 3300046515 Bacteria 8536
121 Ga0495628_0136765 3300046516 Bacteria 1872
122 Ga0495631_0026140 3300046518 Bacteria 2683
123 Ga0495632_0082522 3300046519 Bacteria 1532
124 Ga0495666_0019503 3300046526 Bacteria 3364
125 Ga0495642_0056531 3300046528 Bacteria 1621
126 Ga0495652_0184400 3300046529 Bacteria 1598
127 Ga0495652_0248080 3300046529 Bacteria 1321
128 Ga0495640_0065607 3300046533 Bacteria 2450
129 Ga0495587_0381974 3300046536 Bacteria 783
130 Ga0495597_0058131 3300046542 Bacteria 1690
131 Ga0495645_0018078 3300046543 Bacteria 5059
132 Ga0495645_0050758 3300046543 Bacteria 3019
133 Ga0495622_0007858 3300046557 Bacteria 4949
134 Ga0495633_0014108 3300046558 Bacteria 4188
135 Ga0495668_0025082 3300046616 Bacteria 3389
136 Ga0495634_0009470 3300046642 Bacteria 7183
137 Ga0495611_0013500 3300046648 Bacteria 3478
138 Ga0495625_0022764 3300046660 Bacteria 4796
139 Ga0495625_0057974 3300046660 Bacteria 2752
140 Ga0495635_0101159 3300046663 Bacteria 1970
141 Ga0495661_0040116 3300046665 Bacteria 2906
142 Ga0495588_0080293 3300046674 Bacteria 1702
143 Ga0495657_0003181 3300046675 Bacteria 13527
144 Ga0495657_0299478 3300046675 Bacteria 959
145 Ga0495646_0039421 3300046680 Bacteria 2912
146 Ga0495658_0024986 3300046683 Bacteria 3189
147 Ga0495613_0065005 3300046689 Bacteria 2666
148 Ga0495613_0143981 3300046689 Bacteria 1702
149 Ga0495613_0327808 3300046689 Bacteria 1056
150 Ga0495671_0155024 3300046692 Bacteria 1115
151 Ga0495649_0118253 3300046694 Bacteria 1402
152 Ga0495649_0134152 3300046694 Bacteria 1306
153 Ga0495581_0031281 3300047315 Bacteria 3084
154 Ga0495604_0002334 3300047317 Bacteria 15210
155 Ga0495604_0013480 3300047317 Bacteria 6513
156 Ga0495604_0087599 3300047317 Bacteria 2318
157 Ga0495674_0243736 3300047319 Bacteria 1481
158 Ga0495676_0072398 3300047321 Bacteria 2646
159 Ga0495676_0081570 3300047321 Bacteria 2451
160 Ga0495687_005511 3300047443 Bacteria 8035
161 Ga0495675_0001343 3300047444 Bacteria 14906
162 Ga0495675_0018469 3300047444 Bacteria 4426
163 Ga0495685_017299 3300047447 Bacteria 2468
164 Ga0495685_047920 3300047447 Bacteria 1452
165 Ga0495681_0024422 3300047470 Bacteria 3185
166 Ga0495686_0024486 3300047472 Bacteria 3965
167 Ga0495686_0178782 3300047472 Bacteria 1230
168 Ga0495593_0024487 3300047673 Bacteria 3344
169 Ga0496108_0237692 3300048911 Bacteria 1585
170 Ga0496112_0388043 3300048915 Bacteria 1337
171 Ga0496115_0148382 3300048918 Bacteria 1936
172 Ga0496116_0073120 3300048919 Bacteria 2163
173 Ga0496117_0068674 3300048920 Bacteria 2391
174 Ga0496118_0003961 3300048921 Bacteria 18087
175 Ga0496126_0253641 3300048929 Bacteria 1465
176 Ga0495678_044180 3300049459 Bacteria 1764
177 Ga0495682_0061602 3300049460 Bacteria 1354
178 Ga0501031_0074468 3300049568 Bacteria 2211
179 Ga0501031_0093153 3300049568 Bacteria 1966
180 Ga0501048_0338401 3300049582 Bacteria 1073
181 Ga0501071_0256223 3300049587 Bacteria 1321
182 Ga0501035_0261761 3300049822 Bacteria 1466
183 Ga0501045_0297104 3300049824 Bacteria 1202
184 nmdc:mga0yw44_596561_c1 3300050492 Bacteria 750
185 Ga0495595_0045064 3300053084 Bacteria 2028
186 Ga0495619_0010703 3300053085 Bacteria 5776
187 Ga0495619_0063419 3300053085 Bacteria 2462
188 Ga0495619_0074237 3300053085 Bacteria 2280
189 Ga0466962_0130240 3300061719 Bacteria 1215
190 2644019727 2643221601 Bacteria 7493239
191 2644180384 2643221631 Bacteria 8168043
192 2784585822 2784132148 Bacteria 8627943
193 2809229318 2808606448 Bacteria 8656184
194 2862386840 2862382967 Bacteria 10317375
195 2863407736 2863404153 Bacteria 9672205
196 2863407995 2863404153 Bacteria 9672205
197 2954008281 2954002825 Bacteria 9173742
198 8008560669 8008558824 Bacteria 10610750
199 Ga0206349_1447964
200 JGI24739J22299_10002547
201 JGI24737J22298_10018377
202 JGI24735J21928_10014597
203 Ga0070658_10008487
204 Ga0068869_100606003
205 Ga0070660_100284182
206 Ga0070659_100072022
207 Ga0070700_100182177
208 Ga0070684_100209350
209 Ga0070665_100048888
210 Ga0068855_100005522
211 Ga0068855_100021409
212 Ga0068854_100001906
213 Ga0068852_100088096
214 Ga0070717_10029585
215 Ga0105251_10000438
216 Ga0105240_10667019
217 Ga0105241_10013644
218 Ga0105238_10037372
219 Ga0105239_10185284
220 Ga0157370_10002136
221 Ga0157369_10000541
222 Ga0157374_10007108
223 Ga0157374_10121283
224 Ga0163163_10118433
225 Ga0182007_10005911
226 Ga0206353_11657990
227 Ga0207713_1000390
228 Ga0207688_10186988
229 Ga0207647_10001411
230 Ga0207647_10003708
231 Ga0207705_10006708
232 Ga0207695_10148445
233 Ga0207671_10001866
234 Ga0207693_10162726
235 Ga0207663_10104988
236 Ga0207657_10269236
237 Ga0207694_10101669
238 Ga0207690_10051457
239 Ga0207667_10070540
240 Ga0207667_10382248
241 Ga0207640_10077029
242 Ga0207678_10130286
243 Ga0207708_10226582
244 Ga0207675_100011002
245 Ga0207698_10021148
246 Ga0268266_10178847
247 Ga0265338_10253511
248 Ga0265324_10009024
249 Ga0307511_10000824
250 Ga0307512_10014403
251 Ga0307509_10051915
252 Ga0307508_10326973
253 Ga0307514_10099047
254 Ga0265314_10220342
255 Ga0307516_10045235
256 Ga0307413_10158105
257 Ga0307413_10400393
258 Ga0307518_10030581
259 Ga0307410_10147224
260 Ga0307407_10091972
261 Ga0307409_100051262
262 Ga0307409_100075795
263 Ga0307411_10044566
264 Ga0307415_100301699
265 Ga0307510_10120614
266 Ga0373943_0069849
267 Ga0373943_0500697
268 Ga0373935_0113684
269 Ga0373927_0135064
270 Ga0373933_0039431
271 Ga0373947_0038930
272 Ga0373937_0003315
273 Ga0373925_0158280
274 Ga0395900_0008593
275 Ga0395900_0086981
276 Ga0395898_0004331
277 Ga0436364_0891096
278 Ga0395901_0000175
279 Ga0439436_0002457
280 Ga0451853_0570254
281 Ga0450894_000177
282 Ga0450896_000661
283 Ga0450899_000590
284 Ga0466969_0005280
285 Ga0466969_0011411
286 Ga0466965_0016912
287 Ga0466965_0067072
288 Ga0466966_0029762
289 Ga0466961_0001940
290 Ga0466961_0010581
291 Ga0466963_0260633
292 Ga0466964_0038716
293 Ga0466971_0043914
294 Ga0466970_0011367
295 Ga0466957_0014281
296 Ga0466960_0061958
297 Ga0466959_0007389
298 Ga0466959_0010368
299 Ga0466958_0086696
300 Ga0466967_0198589
301 Ga0495617_010958
302 Ga0495592_0016714
303 Ga0495592_0018554
304 Ga0495592_0105372
305 Ga0495603_0026223
306 Ga0495629_0022488
307 Ga0495629_0109841
308 Ga0495638_0034061
309 Ga0495651_0003243
310 Ga0495651_0018292
311 Ga0495650_0006798
312 Ga0495605_0008180
313 Ga0495662_0087910
314 Ga0495664_0003195
315 Ga0495594_0034797
316 Ga0495606_0004805
317 Ga0495610_0059865
318 Ga0495620_0003869
319 Ga0495628_0136765
320 Ga0495631_0026140
321 Ga0495632_0082522
322 Ga0495666_0019503
323 Ga0495642_0056531
324 Ga0495652_0184400
325 Ga0495652_0248080
326 Ga0495640_0065607
327 Ga0495587_0381974
328 Ga0495597_0058131
329 Ga0495645_0018078
330 Ga0495645_0050758
331 Ga0495622_0007858
332 Ga0495633_0014108
333 Ga0495668_0025082
334 Ga0495634_0009470
335 Ga0495611_0013500
336 Ga0495625_0022764
337 Ga0495625_0057974
338 Ga0495635_0101159
339 Ga0495661_0040116
340 Ga0495588_0080293
341 Ga0495657_0003181
342 Ga0495657_0299478
343 Ga0495646_0039421
344 Ga0495658_0024986
345 Ga0495613_0065005
346 Ga0495613_0143981
347 Ga0495613_0327808
348 Ga0495671_0155024
349 Ga0495649_0118253
350 Ga0495649_0134152
351 Ga0495581_0031281
352 Ga0495604_0002334
353 Ga0495604_0013480
354 Ga0495604_0087599
355 Ga0495674_0243736
356 Ga0495676_0072398
357 Ga0495676_0081570
358 Ga0495687_005511
359 Ga0495675_0001343
360 Ga0495675_0018469
361 Ga0495685_017299
362 Ga0495685_047920
363 Ga0495681_0024422
364 Ga0495686_0024486
365 Ga0495686_0178782
366 Ga0495593_0024487
367 Ga0496108_0237692
368 Ga0496112_0388043
369 Ga0496115_0148382
370 Ga0496116_0073120
371 Ga0496117_0068674
372 Ga0496118_0003961
373 Ga0496126_0253641
374 Ga0495678_044180
375 Ga0495682_0061602
376 Ga0501031_0074468
377 Ga0501031_0093153
378 Ga0501048_0338401
379 Ga0501071_0256223
380 Ga0501035_0261761
381 Ga0501045_0297104
382 nmdc:mga0yw44_596561_c1
383 Ga0495595_0045064
384 Ga0495619_0010703
385 Ga0495619_0063419
386 Ga0495619_0074237
387 Ga0466962_0130240
388 2644019727
389 2644180384
390 2784585822
391 2809229318
392 2862386840
393 2863407736
394 2863407995
395 2954008281
396 8008560669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

44

300

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.9196 9 242
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.9084 9 242
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.8837 4 253
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.8833 8 253
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.8803 4 253
ID Description Score Start End Superfamily
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8838 4 253 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8803 4 253 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7861 8 246 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7467 4 222 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7426 8 246 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A6N8PLU7-F1-model_v4 deleted 0.9896 101 224
AF-A0A3D0ZKV3-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9895 111 207 GO:0005829
GO:0010124
AF-A0A7R9AIG2-F1-model_v4 MIP18 family-like domain-containing protein 0.9797 51 221 GO:0005829
GO:0010124
AF-A0A2X3IQY2-F1-model_v4 Phenylacetate-CoA oxygenase, PaaI subunit 0.9775 15 221 GO:0005829
GO:0010124
AF-A0A853QYY9-F1-model_v4 deleted 0.9749 1 189

Map