F304225

General Info

Members Datasets Scaffolds Average Seq Length
198 98 186 180

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10002985|Ga0075368_100029852
Length 205
Sequence MAGTRPQLLEWTMTALARPDVRLHPSWAATMSEFESEFPHGSGIWHLAEGTALDLTEAGCADFVATLLPFGDPQAEIPEGMVHCDYYWITAGSGAGAEVVGFLALRHRLNAWLFEEGGHIGYSVRPSRRGEGHASRALGLAVRRSAELGLDRVLVTCDEPNHPSARTIERNGGVQEDVRNGKRRYWIETGLSAGPGSAGRSAAPA

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221604 Nocardioides sp. Root190 Isolate Unclassified
4 2643221615 Nocardioides sp. Root224 Isolate Unclassified
5 2643221617 Nocardioides sp. Root79 Isolate Unclassified
6 2643221620 Nocardioides sp. Root240 Isolate Unclassified
7 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
8 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
9 2643221696 Nocardioides sp. Root140 Isolate Unclassified
10 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
11 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
12 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
36 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
40 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
41 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
42 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
46 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
47 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
48 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
49 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
56 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
57 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
58 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
59 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
62 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
63 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
64 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
65 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
68 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
69 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
72 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
75 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
79 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
80 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
81 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
82 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
85 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
86 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
87 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
88 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
89 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
90 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
91 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
92 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
93 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
94 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
95 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
96 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.94
Metatranscriptomes 0
Isolates 6.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 41.92
Nodule 0
Rhizoplane 8.59
Rhizosphere 43.43
Stem 0
Stem Tuber 0
Unclassified 6.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10174024 3300001989 Bacteria 634
2 Ga0070670_100261976 3300005331 Bacteria 1507
3 Ga0070682_100565675 3300005337 Bacteria 892
4 Ga0070700_100398093 3300005441 Bacteria 1035
5 Ga0068860_100002239 3300005843 Bacteria 20362
6 Ga0075365_10015214 3300006038 Bacteria 4649
7 Ga0075365_10019849 3300006038 Bacteria 4157
8 Ga0075365_10033107 3300006038 Bacteria 3328
9 Ga0075365_10151222 3300006038 Bacteria 1615
10 Ga0075365_10176196 3300006038 Bacteria 1494
11 Ga0075365_10177442 3300006038 Bacteria 1488
12 Ga0075365_10179283 3300006038 Bacteria 1481
13 Ga0075365_10251659 3300006038 Bacteria 1241
14 Ga0075365_10291261 3300006038 Bacteria 1149
15 Ga0075365_10346457 3300006038 Bacteria 1047
16 Ga0075365_10455504 3300006038 Bacteria 903
17 Ga0075368_10002985 3300006042 Bacteria 5588
18 Ga0075368_10085126 3300006042 Bacteria 1289
19 Ga0075363_100001330 3300006048 Bacteria 9261
20 Ga0075363_100001449 3300006048 Bacteria 8990
21 Ga0075363_100015559 3300006048 Bacteria 3741
22 Ga0075363_100039076 3300006048 Bacteria 2496
23 Ga0075363_100050665 3300006048 Bacteria 2213
24 Ga0075363_100085920 3300006048 Bacteria 1726
25 Ga0075363_100101155 3300006048 Bacteria 1595
26 Ga0075364_10017476 3300006051 Bacteria 4481
27 Ga0075364_10021467 3300006051 Bacteria 4070
28 Ga0075364_10032175 3300006051 Bacteria 3370
29 Ga0075364_10035253 3300006051 Bacteria 3233
30 Ga0075364_10090513 3300006051 Bacteria 2030
31 Ga0075364_10191805 3300006051 Bacteria 1384
32 Ga0075364_10339500 3300006051 Bacteria 1024
33 Ga0075432_10000397 3300006058 Bacteria 12681
34 Ga0075362_10001863 3300006177 Bacteria 6898
35 Ga0075362_10086589 3300006177 Bacteria 1450
36 Ga0075362_10158328 3300006177 Bacteria 1089
37 Ga0075367_10001619 3300006178 Bacteria 9776
38 Ga0075367_10079795 3300006178 Bacteria 1978
39 Ga0075367_10110902 3300006178 Bacteria 1684
40 Ga0075367_10151263 3300006178 Bacteria 1440
41 Ga0075370_10027673 3300006353 Bacteria 3147
42 Ga0075370_10030478 3300006353 Bacteria 3010
43 Ga0075370_10088218 3300006353 Bacteria 1788
44 Ga0075370_10187268 3300006353 Bacteria 1219
45 Ga0075370_10266210 3300006353 Bacteria 1017
46 Ga0111539_10579733 3300009094 Bacteria 1306
47 Ga0105243_10342441 3300009148 Bacteria 1370
48 Ga0157371_10182320 3300013102 Bacteria 1502
49 Ga0157370_10046695 3300013104 Bacteria 4152
50 Ga0163162_10017607 3300013306 Bacteria 6991
51 Ga0157375_10068830 3300013308 Bacteria 3543
52 Ga0157375_10159081 3300013308 Bacteria 2400
53 Ga0157375_10167536 3300013308 Bacteria 2342
54 Ga0157380_10184570 3300014326 Bacteria 1836
55 Ga0157380_10526009 3300014326 Bacteria 1155
56 Ga0157380_11330490 3300014326 Bacteria 767
57 Ga0207649_10435878 3300025920 Bacteria 986
58 Ga0207708_10246120 3300026075 Bacteria 1439
59 Ga0209813_10014844 3300027866 Bacteria 2103
60 Ga0209813_10059852 3300027866 Bacteria 1213
61 Ga0207428_10120823 3300027907 Bacteria 2009
62 Ga0268264_10000374 3300028381 Bacteria 65781
63 Ga0307408_100010637 3300031548 Bacteria 6070
64 Ga0307408_100046512 3300031548 Bacteria 3104
65 Ga0307408_101039363 3300031548 Bacteria 757
66 Ga0307405_10049019 3300031731 Bacteria 2608
67 Ga0307410_10087129 3300031852 Bacteria 2207
68 Ga0307410_10155961 3300031852 Bacteria 1705
69 Ga0307410_10575104 3300031852 Bacteria 937
70 Ga0307410_10604337 3300031852 Bacteria 915
71 Ga0307407_10130567 3300031903 Bacteria 1606
72 Ga0307407_10133053 3300031903 Bacteria 1594
73 Ga0307412_10027659 3300031911 Bacteria 3538
74 Ga0307412_10171545 3300031911 Bacteria 1622
75 Ga0307409_100123884 3300031995 Bacteria 2194
76 Ga0307409_100154476 3300031995 Bacteria 1998
77 Ga0307409_100256406 3300031995 Bacteria 1602
78 Ga0307409_100351994 3300031995 Bacteria 1390
79 Ga0307409_100385754 3300031995 Bacteria 1333
80 Ga0307409_100497515 3300031995 Unclassified 1186
81 Ga0307409_100865899 3300031995 Bacteria 915
82 Ga0307416_100206005 3300032002 Bacteria 1871
83 Ga0307416_100314929 3300032002 Bacteria 1563
84 Ga0307416_101033112 3300032002 Bacteria 925
85 Ga0307414_10623542 3300032004 Bacteria 970
86 Ga0307415_100076078 3300032126 Bacteria 2379
87 Ga0307415_100521129 3300032126 Bacteria 1043
88 Ga0395905_0058868 3300037471 Bacteria 3592
89 Ga0395905_0620881 3300037471 Bacteria 983
90 Ga0451795_0876742 3300041456 Bacteria 747
91 Ga0451833_1023831 3300041491 Bacteria 709
92 Ga0466965_0075027 3300044683 Bacteria 1705
93 Ga0466966_0005623 3300044684 Bacteria 8241
94 Ga0466961_0115397 3300044693 Bacteria 1688
95 Ga0466961_0132127 3300044693 Bacteria 1564
96 Ga0466963_0162954 3300044694 Bacteria 1552
97 Ga0466963_0676121 3300044694 Bacteria 729
98 Ga0466964_0008947 3300044706 Bacteria 3767
99 Ga0466971_0145650 3300044719 Bacteria 1104
100 Ga0466970_0056309 3300044765 Bacteria 2101
101 Ga0466970_0063013 3300044765 Bacteria 1988
102 Ga0466957_0737502 3300044842 Bacteria 697
103 Ga0466960_0114226 3300044901 Bacteria 1407
104 Ga0466960_0262321 3300044901 Bacteria 963
105 Ga0466958_0073491 3300045836 Bacteria 2095
106 Ga0466958_0171286 3300045836 Bacteria 1375
107 Ga0466967_0086404 3300045976 Bacteria 2841
108 Ga0466967_0189152 3300045976 Bacteria 1945
109 Ga0466967_0276330 3300045976 Bacteria 1611
110 Ga0495582_0132335 3300046473 Bacteria 1409
111 Ga0495620_0073738 3300046515 Bacteria 1391
112 Ga0495581_0304490 3300047315 Unclassified 931
113 Ga0496100_0008690 3300048903 Bacteria 5674
114 Ga0496100_0031331 3300048903 Bacteria 3306
115 Ga0496101_0005580 3300048904 Bacteria 8031
116 Ga0496101_0143632 3300048904 Bacteria 1821
117 Ga0496102_0019112 3300048905 Bacteria 6032
118 Ga0496102_0434369 3300048905 Bacteria 1232
119 Ga0496102_0761111 3300048905 Bacteria 891
120 Ga0496103_0009030 3300048906 Bacteria 5903
121 Ga0496106_0327971 3300048909 Bacteria 1229
122 Ga0496107_0006066 3300048910 Bacteria 8296
123 Ga0496109_0388875 3300048912 Bacteria 1318
124 Ga0496110_0055077 3300048913 Bacteria 3499
125 Ga0496110_0431771 3300048913 Bacteria 1201
126 Ga0496111_0023977 3300048914 Bacteria 4289
127 Ga0496114_0006867 3300048917 Bacteria 8966
128 Ga0496114_0081919 3300048917 Bacteria 2727
129 Ga0496124_0156598 3300048927 Bacteria 1781
130 Ga0501036_0179969 3300049572 Bacteria 1780
131 Ga0501037_0137967 3300049573 Bacteria 1746
132 Ga0501041_0112252 3300049577 Bacteria 1691
133 Ga0501069_0110921 3300049585 Bacteria 1562
134 Ga0501071_0063810 3300049587 Bacteria 2672
135 Ga0501071_0294849 3300049587 Bacteria 1229
136 Ga0501071_0320485 3300049587 Bacteria 1177
137 Ga0501074_0281138 3300049590 Bacteria 1183
138 Ga0501253_187175 3300049683 Unclassified 541
139 Ga0501079_0399417 3300049741 Bacteria 1078
140 Ga0501080_0266517 3300049742 Bacteria 1560
141 nmdc:mga03683_12320_c1 3300050489 Bacteria 3120
142 nmdc:mga03683_75168_c1 3300050489 Bacteria 1450
143 nmdc:mga03683_94632_c1 3300050489 Bacteria 1306
144 nmdc:mga03n38_20665_c1 3300050490 Bacteria 2638
145 nmdc:mga03n38_70132_c1 3300050490 Bacteria 1620
146 nmdc:mga00v17_170767_c1 3300050491 Bacteria 1402
147 nmdc:mga00v17_172533_c1 3300050491 Bacteria 1395
148 nmdc:mga00v17_183201_c1 3300050491 Bacteria 1351
149 nmdc:mga00v17_287996_c1 3300050491 Bacteria 1066
150 nmdc:mga00v17_28834_c1 3300050491 Bacteria 3254
151 nmdc:mga00v17_3374_c1 3300050491 Bacteria 8241
152 nmdc:mga00v17_460238_c1 3300050491 Bacteria 826
153 nmdc:mga00v17_678176_c1 3300050491 Bacteria 662
154 nmdc:mga00v17_80251_c1 3300050491 Bacteria 2036
155 nmdc:mga0yw44_171208_c1 3300050492 Bacteria 1426
156 nmdc:mga0yw44_197920_c1 3300050492 Bacteria 1326
157 nmdc:mga0yw44_23133_c1 3300050492 Bacteria 3497
158 nmdc:mga0yw44_268533_c1 3300050492 Bacteria 1138
159 nmdc:mga0yw44_288824_c1 3300050492 Bacteria 1097
160 nmdc:mga0yw44_332012_c1 3300050492 Bacteria 1022
161 nmdc:mga0yw44_451411_c1 3300050492 Bacteria 871
162 nmdc:mga0yw44_67332_c1 3300050492 Bacteria 2213
163 nmdc:mga0yw44_81176_c1 3300050492 Bacteria 2033
164 nmdc:mga0yw44_82425_c1 3300050492 Bacteria 2018
165 nmdc:mga0yw44_889394_c1 3300050492 Bacteria 604
166 nmdc:mga0yw44_92922_c1 3300050492 Bacteria 1910
167 nmdc:mga06z11_173214_c1 3300050494 Bacteria 1240
168 nmdc:mga06z11_200774_c1 3300050494 Bacteria 1158
169 nmdc:mga06z11_4922_c1 3300050494 Bacteria 5302
170 nmdc:mga04h51_25965_c1 3300050495 Bacteria 1808
171 nmdc:mga04h51_295881_c1 3300050495 Bacteria 658
172 nmdc:mga07m45_141830_c1 3300050496 Bacteria 1392
173 nmdc:mga07m45_164813_c1 3300050496 Bacteria 1287
174 nmdc:mga07m45_181204_c1 3300050496 Bacteria 1225
175 nmdc:mga07m45_20025_c1 3300050496 Bacteria 3631
176 nmdc:mga07m45_255276_c1 3300050496 Bacteria 1020
177 nmdc:mga07m45_35473_c1 3300050496 Bacteria 2774
178 nmdc:mga08y16_725165_c1 3300050511 Bacteria 992
179 Ga0495601_0594359 3300053077 Unclassified 710
180 Ga0500554_126581 3300053102 Bacteria 862
181 Ga0500556_0000907 3300053104 Bacteria 16423
182 Ga0500593_000348 3300053117 Bacteria 18705
183 Ga0500559_0001353 3300053136 Bacteria 14074
184 Ga0500559_0031153 3300053136 Bacteria 2287
185 Ga0501084_0078823 3300054114 Bacteria 2761
186 Ga0466962_0303589 3300061719 Bacteria 790

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_889394_c1 nmdc:mga0yw44_889394_c1_15_488 138
2 3300050495 nmdc:mga04h51_295881_c1 nmdc:mga04h51_295881_c1_167_637 145
3 iso_pu_bacteria 2643221604 2644033039 145
4 3300031995 Ga0307409_100351994 Ga0307409_1003519941 146
5 3300049587 Ga0501071_0320485 Ga0501071_0320485_61_564 146
6 3300006038 Ga0075365_10455504 Ga0075365_104555042 148
7 3300050494 nmdc:mga06z11_200774_c1 nmdc:mga06z11_200774_c1_290_868 148
8 3300049683 Ga0501253_187175 Ga0501253_187175_45_503 151
9 3300045836 Ga0466958_0171286 Ga0466958_0171286_396_944 152
10 3300049742 Ga0501080_0266517 Ga0501080_0266517_448_930 153
11 3300053102 Ga0500554_126581 Ga0500554_126581_303_830 154
12 3300006038 Ga0075365_10151222 Ga0075365_101512222 162
13 iso_pu_bacteria 2643221617 2644099967 162
14 iso_pu_bacteria 2643221620 2644117573 162
15 3300049572 Ga0501036_0179969 Ga0501036_0179969_1107_1685 163
16 3300049577 Ga0501041_0112252 Ga0501041_0112252_362_940 163
17 3300054114 Ga0501084_0078823 Ga0501084_0078823_744_1322 163
18 3300006048 Ga0075363_100001449 Ga0075363_1000014494 165
19 3300006178 Ga0075367_10001619 Ga0075367_100016197 165
20 3300027866 Ga0209813_10014844 Ga0209813_100148442 165
21 3300041491 Ga0451833_1023831 Ga0451833_1023831_155_697 165
22 3300050495 nmdc:mga04h51_25965_c1 nmdc:mga04h51_25965_c1_1042_1599 165
23 3300046515 Ga0495620_0073738 Ga0495620_0073738_358_861 166
24 iso_pu_bacteria 2643221615 2644090825 166
25 iso_pu_bacteria 2643221657 2644320628 166
26 3300014326 Ga0157380_10526009 Ga0157380_105260093 167
27 3300037471 Ga0395905_0620881 Ga0395905_0620881_163_696 167
28 iso_pu_bacteria 2643221567 2643852699 167
29 iso_pu_bacteria 2643221624 2644135207 167
30 iso_pu_bacteria 2690315906 2691515510 167
31 iso_pu_bacteria 2939598168 2939599180 167
32 iso_pu_bacteria 2953998280 2953998571 167
33 3300048903 Ga0496100_0031331 Ga0496100_0031331_21_548 168
34 3300048904 Ga0496101_0143632 Ga0496101_0143632_487_1014 168
35 3300048909 Ga0496106_0327971 Ga0496106_0327971_60_587 168
36 3300031852 Ga0307410_10575104 Ga0307410_105751042 169
37 3300031852 Ga0307410_10604337 Ga0307410_106043372 169
38 3300031903 Ga0307407_10133053 Ga0307407_101330532 169
39 3300031995 Ga0307409_100154476 Ga0307409_1001544763 169
40 3300031995 Ga0307409_100385754 Ga0307409_1003857542 169
41 3300031995 Ga0307409_100497515 Ga0307409_1004975152 169
42 3300032004 Ga0307414_10623542 Ga0307414_106235422 169
43 3300048905 Ga0496102_0761111 Ga0496102_0761111_90_602 169
44 3300053077 Ga0495601_0594359 Ga0495601_0594359_187_696 169
45 3300053117 Ga0500593_000348 Ga0500593_000348_17318_17863 169
46 iso_pu_bacteria 2643221561 2643827242 169
47 iso_pu_bacteria 2643221696 2644533931 169
48 3300005337 Ga0070682_100565675 Ga0070682_1005656751 170
49 3300005441 Ga0070700_100398093 Ga0070700_1003980933 170
50 3300006038 Ga0075365_10019849 Ga0075365_100198494 170
51 3300006042 Ga0075368_10085126 Ga0075368_100851262 170
52 3300006048 Ga0075363_100001330 Ga0075363_1000013302 170
53 3300006048 Ga0075363_100101155 Ga0075363_1001011552 170
54 3300006051 Ga0075364_10021467 Ga0075364_100214672 170
55 3300006051 Ga0075364_10035253 Ga0075364_100352532 170
56 3300006177 Ga0075362_10001863 Ga0075362_100018632 170
57 3300006178 Ga0075367_10110902 Ga0075367_101109022 170
58 3300006178 Ga0075367_10151263 Ga0075367_101512632 170
59 3300006353 Ga0075370_10027673 Ga0075370_100276733 170
60 3300006353 Ga0075370_10088218 Ga0075370_100882182 170
61 3300009094 Ga0111539_10579733 Ga0111539_105797334 170
62 3300009148 Ga0105243_10342441 Ga0105243_103424412 170
63 3300014326 Ga0157380_10184570 Ga0157380_101845703 170
64 3300026075 Ga0207708_10246120 Ga0207708_102461204 170
65 3300031852 Ga0307410_10155961 Ga0307410_101559612 170
66 3300044684 Ga0466966_0005623 Ga0466966_0005623_7485_8102 170
67 3300044693 Ga0466961_0132127 Ga0466961_0132127_947_1504 170
68 3300044694 Ga0466963_0162954 Ga0466963_0162954_398_955 170
69 3300044706 Ga0466964_0008947 Ga0466964_0008947_1189_1746 170
70 3300044719 Ga0466971_0145650 Ga0466971_0145650_77_634 170
71 3300044765 Ga0466970_0056309 Ga0466970_0056309_653_1255 170
72 3300045836 Ga0466958_0073491 Ga0466958_0073491_1454_2071 170
73 3300045976 Ga0466967_0086404 Ga0466967_0086404_637_1194 170
74 3300048913 Ga0496110_0431771 Ga0496110_0431771_446_958 170
75 3300049585 Ga0501069_0110921 Ga0501069_0110921_85_624 170
76 3300049587 Ga0501071_0294849 Ga0501071_0294849_100_693 170
77 3300049590 Ga0501074_0281138 Ga0501074_0281138_476_1003 170
78 3300049741 Ga0501079_0399417 Ga0501079_0399417_169_696 170
79 3300050489 nmdc:mga03683_12320_c1 nmdc:mga03683_12320_c1_658_1197 170
80 3300050491 nmdc:mga00v17_170767_c1 nmdc:mga00v17_170767_c1_297_842 170
81 3300050491 nmdc:mga00v17_3374_c1 nmdc:mga00v17_3374_c1_6734_7264 170
82 3300050491 nmdc:mga00v17_460238_c1 nmdc:mga00v17_460238_c1_199_738 170
83 3300050492 nmdc:mga0yw44_268533_c1 nmdc:mga0yw44_268533_c1_18_548 170
84 3300050492 nmdc:mga0yw44_451411_c1 nmdc:mga0yw44_451411_c1_226_759 170
85 3300050492 nmdc:mga0yw44_81176_c1 nmdc:mga0yw44_81176_c1_712_1251 170
86 3300050496 nmdc:mga07m45_141830_c1 nmdc:mga07m45_141830_c1_708_1247 170
87 3300050496 nmdc:mga07m45_35473_c1 nmdc:mga07m45_35473_c1_909_1439 170
88 3300050511 nmdc:mga08y16_725165_c1 nmdc:mga08y16_725165_c1_71_586 170
89 3300053104 Ga0500556_0000907 Ga0500556_0000907_4948_5496 170
90 3300061719 Ga0466962_0303589 Ga0466962_0303589_168_770 170
91 3300005331 Ga0070670_100261976 Ga0070670_1002619762 171
92 3300005843 Ga0068860_100002239 Ga0068860_10000223919 171
93 3300006038 Ga0075365_10015214 Ga0075365_100152144 171
94 3300006038 Ga0075365_10033107 Ga0075365_100331072 171
95 3300006038 Ga0075365_10176196 Ga0075365_101761962 171
96 3300006038 Ga0075365_10177442 Ga0075365_101774421 171
97 3300006038 Ga0075365_10179283 Ga0075365_101792832 171
98 3300006038 Ga0075365_10251659 Ga0075365_102516592 171
99 3300006038 Ga0075365_10346457 Ga0075365_103464572 171
100 3300006048 Ga0075363_100039076 Ga0075363_1000390762 171
101 3300006048 Ga0075363_100050665 Ga0075363_1000506652 171
102 3300006048 Ga0075363_100085920 Ga0075363_1000859202 171
103 3300006051 Ga0075364_10017476 Ga0075364_100174762 171
104 3300006051 Ga0075364_10090513 Ga0075364_100905132 171
105 3300006051 Ga0075364_10191805 Ga0075364_101918052 171
106 3300006051 Ga0075364_10339500 Ga0075364_103395002 171
107 3300006058 Ga0075432_10000397 Ga0075432_100003974 171
108 3300006177 Ga0075362_10086589 Ga0075362_100865892 171
109 3300006177 Ga0075362_10158328 Ga0075362_101583282 171
110 3300006353 Ga0075370_10030478 Ga0075370_100304782 171
111 3300006353 Ga0075370_10187268 Ga0075370_101872682 171
112 3300013102 Ga0157371_10182320 Ga0157371_101823202 171
113 3300013104 Ga0157370_10046695 Ga0157370_100466954 171
114 3300013306 Ga0163162_10017607 Ga0163162_100176076 171
115 3300013308 Ga0157375_10068830 Ga0157375_100688303 171
116 3300013308 Ga0157375_10159081 Ga0157375_101590812 171
117 3300013308 Ga0157375_10167536 Ga0157375_101675362 171
118 3300014326 Ga0157380_11330490 Ga0157380_113304902 171
119 3300025920 Ga0207649_10435878 Ga0207649_104358782 171
120 3300027907 Ga0207428_10120823 Ga0207428_101208232 171
121 3300028381 Ga0268264_10000374 Ga0268264_100003744 171
122 3300031548 Ga0307408_100010637 Ga0307408_1000106373 171
123 3300031548 Ga0307408_100046512 Ga0307408_1000465124 171
124 3300031548 Ga0307408_101039363 Ga0307408_1010393632 171
125 3300031731 Ga0307405_10049019 Ga0307405_100490192 171
126 3300031852 Ga0307410_10087129 Ga0307410_100871292 171
127 3300031903 Ga0307407_10130567 Ga0307407_101305671 171
128 3300031911 Ga0307412_10027659 Ga0307412_100276593 171
129 3300031911 Ga0307412_10171545 Ga0307412_101715451 171
130 3300031995 Ga0307409_100123884 Ga0307409_1001238842 171
131 3300031995 Ga0307409_100256406 Ga0307409_1002564062 171
132 3300031995 Ga0307409_100865899 Ga0307409_1008658991 171
133 3300032002 Ga0307416_100206005 Ga0307416_1002060052 171
134 3300032002 Ga0307416_100314929 Ga0307416_1003149292 171
135 3300032002 Ga0307416_101033112 Ga0307416_1010331122 171
136 3300032126 Ga0307415_100076078 Ga0307415_1000760782 171
137 3300032126 Ga0307415_100521129 Ga0307415_1005211292 171
138 3300041456 Ga0451795_0876742 Ga0451795_0876742_134_682 171
139 3300044842 Ga0466957_0737502 Ga0466957_0737502_120_635 171
140 3300044901 Ga0466960_0114226 Ga0466960_0114226_15_530 171
141 3300046473 Ga0495582_0132335 Ga0495582_0132335_368_886 171
142 3300047315 Ga0495581_0304490 Ga0495581_0304490_64_636 171
143 3300048903 Ga0496100_0008690 Ga0496100_0008690_4066_4584 171
144 3300048904 Ga0496101_0005580 Ga0496101_0005580_4067_4585 171
145 3300048905 Ga0496102_0019112 Ga0496102_0019112_483_1055 171
146 3300048905 Ga0496102_0434369 Ga0496102_0434369_175_693 171
147 3300048906 Ga0496103_0009030 Ga0496103_0009030_5259_5777 171
148 3300048910 Ga0496107_0006066 Ga0496107_0006066_3364_3882 171
149 3300048912 Ga0496109_0388875 Ga0496109_0388875_315_833 171
150 3300048913 Ga0496110_0055077 Ga0496110_0055077_1389_1907 171
151 3300048914 Ga0496111_0023977 Ga0496111_0023977_1575_2093 171
152 3300048917 Ga0496114_0006867 Ga0496114_0006867_8234_8806 171
153 3300048917 Ga0496114_0081919 Ga0496114_0081919_667_1245 171
154 3300048927 Ga0496124_0156598 Ga0496124_0156598_626_1204 171
155 3300049573 Ga0501037_0137967 Ga0501037_0137967_202_720 171
156 3300049587 Ga0501071_0063810 Ga0501071_0063810_1221_1835 171
157 3300050489 nmdc:mga03683_75168_c1 nmdc:mga03683_75168_c1_384_962 171
158 3300050489 nmdc:mga03683_94632_c1 nmdc:mga03683_94632_c1_274_813 171
159 3300050490 nmdc:mga03n38_20665_c1 nmdc:mga03n38_20665_c1_669_1262 171
160 3300050490 nmdc:mga03n38_70132_c1 nmdc:mga03n38_70132_c1_14_592 171
161 3300050491 nmdc:mga00v17_172533_c1 nmdc:mga00v17_172533_c1_383_937 171
162 3300050491 nmdc:mga00v17_183201_c1 nmdc:mga00v17_183201_c1_547_1086 171
163 3300050491 nmdc:mga00v17_287996_c1 nmdc:mga00v17_287996_c1_302_859 171
164 3300050491 nmdc:mga00v17_28834_c1 nmdc:mga00v17_28834_c1_747_1361 171
165 3300050491 nmdc:mga00v17_80251_c1 nmdc:mga00v17_80251_c1_480_1058 171
166 3300050492 nmdc:mga0yw44_171208_c1 nmdc:mga0yw44_171208_c1_383_961 171
167 3300050492 nmdc:mga0yw44_288824_c1 nmdc:mga0yw44_288824_c1_299_868 171
168 3300050492 nmdc:mga0yw44_332012_c1 nmdc:mga0yw44_332012_c1_432_1010 171
169 3300050492 nmdc:mga0yw44_67332_c1 nmdc:mga0yw44_67332_c1_1093_1707 171
170 3300050492 nmdc:mga0yw44_82425_c1 nmdc:mga0yw44_82425_c1_1042_1581 171
171 3300050492 nmdc:mga0yw44_92922_c1 nmdc:mga0yw44_92922_c1_455_994 171
172 3300050494 nmdc:mga06z11_173214_c1 nmdc:mga06z11_173214_c1_344_922 171
173 3300050496 nmdc:mga07m45_181204_c1 nmdc:mga07m45_181204_c1_69_662 171
174 3300050496 nmdc:mga07m45_20025_c1 nmdc:mga07m45_20025_c1_900_1478 171
175 3300006038 Ga0075365_10291261 Ga0075365_102912612 172
176 3300006042 Ga0075368_10002985 Ga0075368_100029852 172
177 3300006048 Ga0075363_100015559 Ga0075363_1000155593 172
178 3300006051 Ga0075364_10032175 Ga0075364_100321752 172
179 3300006178 Ga0075367_10079795 Ga0075367_100797953 172
180 3300006353 Ga0075370_10266210 Ga0075370_102662101 172
181 3300027866 Ga0209813_10059852 Ga0209813_100598522 172
182 3300050491 nmdc:mga00v17_678176_c1 nmdc:mga00v17_678176_c1_54_590 172
183 3300050492 nmdc:mga0yw44_197920_c1 nmdc:mga0yw44_197920_c1_286_882 172
184 3300050492 nmdc:mga0yw44_23133_c1 nmdc:mga0yw44_23133_c1_2625_3206 172
185 3300050494 nmdc:mga06z11_4922_c1 nmdc:mga06z11_4922_c1_4134_4661 172
186 3300050496 nmdc:mga07m45_164813_c1 nmdc:mga07m45_164813_c1_604_1155 172
187 3300050496 nmdc:mga07m45_255276_c1 nmdc:mga07m45_255276_c1_54_671 172
188 3300053136 Ga0500559_0001353 Ga0500559_0001353_11861_12403 172
189 3300053136 Ga0500559_0031153 Ga0500559_0031153_763_1293 172
190 3300001989 JGI24739J22299_10174024 JGI24739J22299_101740241 173
191 3300037471 Ga0395905_0058868 Ga0395905_0058868_2326_2847 173
192 3300044683 Ga0466965_0075027 Ga0466965_0075027_805_1326 173
193 3300044693 Ga0466961_0115397 Ga0466961_0115397_1097_1618 173
194 3300044694 Ga0466963_0676121 Ga0466963_0676121_140_661 173
195 3300044765 Ga0466970_0063013 Ga0466970_0063013_197_718 173
196 3300044901 Ga0466960_0262321 Ga0466960_0262321_88_609 173
197 3300045976 Ga0466967_0189152 Ga0466967_0189152_344_865 173
198 3300045976 Ga0466967_0276330 Ga0466967_0276330_30_575 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

60

173

0.85

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

54

174

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zbp-assembly1.cif.gz_B crystal structure of the ampcpr-bound atnudt7 0.8962 119 172
4zbp-assembly2.cif.gz_C-2 crystal structure of the ampcpr-bound atnudt7 0.8903 119 172
4zb3-assembly1.cif.gz_A-2 crystal structure of the apo atnudt7 0.8853 119 172
4zbp-assembly1.cif.gz_A crystal structure of the ampcpr-bound atnudt7 0.8844 119 173
3fxt-assembly1.cif.gz_A crystal structure of the n-terminal domain of human nudt6 0.8561 116 173
ID Description Score Start End Superfamily
af_P53370_43_134_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8958 116 173 3.40.630.30
af_A0A1D6P4C1_24_107_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8744 116 172 3.40.630.30
af_Q54U83_110_201_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8728 118 173 3.40.630.30
af_Q9SJC4_7_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8688 126 172 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8663 118 173 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A139PHK1-F1-model_v4 Acetyltransferase 1 102 173 GO:0016747
AF-A0A654UCQ9-F1-model_v4 deleted 0.9951 94 172
AF-F5VWX6-F1-model_v4 Acetyltransferase, GNAT domain protein 0.994 82 173 GO:0016747
AF-A0A496KFX3-F1-model_v4 deleted 0.9932 94 172
AF-A0A1Y4RC52-F1-model_v4 N-acetyltransferase domain-containing protein 0.9842 82 173 GO:0016747

Feature Viewer

pLDDT pTM Quality
94.48 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map