F303888

General Info

Members Datasets Scaffolds Average Seq Length
198 124 396 165

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10074816|Ga0070658_100748162
Length 190
Sequence MGNESMHWVIEHLSHCTLNITISLMREIVIIAHDIRSTHNIGSLLRTCDGLGVRAVYFTGYTPYPALAENDPCLPHIAQKLTRQIHKTALGAEDFVPWSHIEDIHACIRQLHSQGFTVAALEQTGRSTPLPDFTAPQKIALLLGREVEGIAPDILALCDVAVEIPMAGQKESFNVVQAAAMALYHLRFSV

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
61 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
62 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
63 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
64 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
68 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
113 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
121 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
122 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
123 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 0
Rhizoplane 2.53
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 17.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10074816 3300005327 Bacteria 2778
2 JGI25406J46586_10020033 3300003203 Bacteria 2714
3 Ga0070658_10000012 3300005327 Bacteria 277871
4 Ga0070658_10947217 3300005327 Unclassified 749
5 Ga0070682_100163487 3300005337 Bacteria 1540
6 Ga0070660_100158988 3300005339 Bacteria 1820
7 Ga0070691_10622618 3300005341 Unclassified 639
8 Ga0070661_100018470 3300005344 Bacteria 4956
9 Ga0070673_100001360 3300005364 Bacteria 14303
10 Ga0070678_100000234 3300005456 Bacteria 25286
11 Ga0070681_10260535 3300005458 Bacteria 1646
12 Ga0070681_10485371 3300005458 Bacteria 1148
13 Ga0070685_10001561 3300005466 Bacteria 12067
14 Ga0070685_10028656 3300005466 Unclassified 3087
15 Ga0070679_100363173 3300005530 Bacteria 1395
16 Ga0070684_100084519 3300005535 Bacteria 2814
17 Ga0068853_100144324 3300005539 Bacteria 2138
18 Ga0070693_100014172 3300005547 Bacteria 4078
19 Ga0070665_100167335 3300005548 Unclassified 2200
20 Ga0070665_100482558 3300005548 Bacteria 1250
21 Ga0070704_100056424 3300005549 Bacteria 2789
22 Ga0068855_100053150 3300005563 Bacteria 4767
23 Ga0068855_100730132 3300005563 Unclassified 1058
24 Ga0068857_100002635 3300005577 Bacteria 14727
25 Ga0068852_100131716 3300005616 Bacteria 2303
26 Ga0081539_10001746 3300005985 Bacteria 34691
27 Ga0075364_10283446 3300006051 Unclassified 1127
28 Ga0105240_10005294 3300009093 Bacteria 19262
29 Ga0105240_10258616 3300009093 Bacteria 2009
30 Ga0105245_10000001 3300009098 Bacteria 939270
31 Ga0105245_10001369 3300009098 Bacteria 22074
32 Ga0105245_10116517 3300009098 Bacteria 2491
33 Ga0105245_10241893 3300009098 Bacteria 1750
34 Ga0105241_10165861 3300009174 Bacteria 1820
35 Ga0105241_10439322 3300009174 Bacteria 1152
36 Ga0105241_11225142 3300009174 Unclassified 712
37 Ga0105248_10237892 3300009177 Bacteria 2050
38 Ga0105237_10110426 3300009545 Bacteria 2742
39 Ga0105238_10026429 3300009551 Bacteria 5918
40 Ga0105238_10373878 3300009551 Bacteria 1416
41 Ga0105238_11083916 3300009551 Bacteria 823
42 Ga0105239_10013465 3300010375 Bacteria 9084
43 Ga0105239_10014654 3300010375 Bacteria 8694
44 Ga0105239_10058980 3300010375 Unclassified 4212
45 Ga0105239_11230683 3300010375 Bacteria 863
46 Ga0157373_10089478 3300013100 Bacteria 2168
47 Ga0157373_10208592 3300013100 Unclassified 1377
48 Ga0157370_10045283 3300013104 Bacteria 4222
49 Ga0157369_10016700 3300013105 Bacteria 8251
50 Ga0157369_10031355 3300013105 Bacteria 5854
51 Ga0157369_10114116 3300013105 Bacteria 2869
52 Ga0157374_10000195 3300013296 Bacteria 56142
53 Ga0157374_10002313 3300013296 Bacteria 16059
54 Ga0157374_10007870 3300013296 Bacteria 9099
55 Ga0157374_10246023 3300013296 Unclassified 1759
56 Ga0157378_10016124 3300013297 Bacteria 6543
57 Ga0157372_10000187 3300013307 Bacteria 68372
58 Ga0157372_10025457 3300013307 Bacteria 6434
59 Ga0157376_10000001 3300014969 Bacteria 842910
60 Ga0207705_10000056 3300025909 Bacteria 157554
61 Ga0207705_10021205 3300025909 Bacteria 4634
62 Ga0207654_10798373 3300025911 Bacteria 682
63 Ga0207707_10005833 3300025912 Bacteria 10761
64 Ga0207707_10013625 3300025912 Bacteria 7090
65 Ga0207695_10011003 3300025913 Bacteria 10992
66 Ga0207695_10063361 3300025913 Bacteria 3813
67 Ga0207695_10693260 3300025913 Unclassified 899
68 Ga0207671_10893959 3300025914 Unclassified 702
69 Ga0207660_10011587 3300025917 Bacteria 5746
70 Ga0207660_11578575 3300025917 Unclassified 529
71 Ga0207657_10099823 3300025919 Bacteria 2410
72 Ga0207657_10116268 3300025919 Unclassified 2204
73 Ga0207649_10014827 3300025920 Bacteria 4371
74 Ga0207652_10050155 3300025921 Bacteria 3575
75 Ga0207652_10426936 3300025921 Bacteria 1195
76 Ga0207694_10000890 3300025924 Bacteria 26483
77 Ga0207694_10735800 3300025924 Bacteria 832
78 Ga0207687_10000030 3300025927 Bacteria 155548
79 Ga0207687_10097179 3300025927 Bacteria 2160
80 Ga0207687_10175575 3300025927 Bacteria 1656
81 Ga0207644_10080177 3300025931 Bacteria 2410
82 Ga0207686_10561561 3300025934 Unclassified 893
83 Ga0207669_10508074 3300025937 Unclassified 965
84 Ga0207691_10022874 3300025940 Bacteria 5892
85 Ga0207711_10109964 3300025941 Bacteria 2450
86 Ga0207667_10011999 3300025949 Bacteria 10031
87 Ga0207667_10620454 3300025949 Bacteria 1089
88 Ga0207651_10000191 3300025960 Bacteria 26637
89 Ga0207639_10011404 3300026041 Bacteria 6173
90 Ga0207641_10121220 3300026088 Unclassified 2334
91 Ga0207674_10005935 3300026116 Bacteria 14443
92 Ga0207683_10018388 3300026121 Bacteria 5963
93 Ga0207698_10076397 3300026142 Bacteria 2681
94 Ga0268266_10001545 3300028379 Bacteria 26966
95 Ga0268266_10153110 3300028379 Bacteria 2080
96 Ga0265337_1051954 3300028556 Bacteria 1152
97 Ga0265326_10019021 3300028558 Bacteria 1975
98 Ga0265326_10089110 3300028558 Bacteria 874
99 Ga0265334_10006146 3300028573 Bacteria 5199
100 Ga0265334_10230028 3300028573 Unclassified 640
101 Ga0265318_10008288 3300028577 Bacteria 4635
102 Ga0265322_10026484 3300028654 Unclassified 1657
103 Ga0265322_10049463 3300028654 Bacteria 1194
104 Ga0265336_10000047 3300028666 Bacteria 123576
105 Ga0265336_10019082 3300028666 Unclassified 2216
106 Ga0265338_10000039 3300028800 Bacteria 236135
107 Ga0265338_10000054 3300028800 Bacteria 207383
108 Ga0265338_10000178 3300028800 Bacteria 118345
109 Ga0265338_10000601 3300028800 Bacteria 63282
110 Ga0265338_10006957 3300028800 Bacteria 14220
111 Ga0265338_10027805 3300028800 Bacteria 5662
112 Ga0265338_10054011 3300028800 Bacteria 3587
113 Ga0265338_10288094 3300028800 Bacteria 1197
114 Ga0265324_10008913 3300029957 Unclassified 3949
115 Ga0265324_10076679 3300029957 Bacteria 1137
116 Ga0265330_10018568 3300031235 Unclassified 3194
117 Ga0265330_10104487 3300031235 Bacteria 1211
118 Ga0265332_10040690 3300031238 Bacteria 2011
119 Ga0265328_10026512 3300031239 Bacteria 2177
120 Ga0265328_10055908 3300031239 Bacteria 1448
121 Ga0265320_10028608 3300031240 Bacteria 2892
122 Ga0265325_10043861 3300031241 Bacteria 2332
123 Ga0265325_10065852 3300031241 Bacteria 1828
124 Ga0265329_10030043 3300031242 Bacteria 1772
125 Ga0265329_10070778 3300031242 Bacteria 1103
126 Ga0265340_10117836 3300031247 Bacteria 1223
127 Ga0265339_10036394 3300031249 Unclassified 2755
128 Ga0265331_10094480 3300031250 Bacteria 1380
129 Ga0265316_10118803 3300031344 Bacteria 1997
130 Ga0265316_10215497 3300031344 Bacteria 1418
131 Ga0265313_10033046 3300031595 Bacteria 2633
132 Ga0265313_10309845 3300031595 Unclassified 632
133 Ga0265314_10036333 3300031711 Unclassified 3581
134 Ga0265314_10109216 3300031711 Unclassified 1761
135 Ga0265342_10180196 3300031712 Bacteria 1157
136 Ga0265342_10194561 3300031712 Bacteria 1105
137 Ga0307516_10333597 3300031730 Unclassified 1185
138 Ga0395899_0005886 3300037312 Bacteria 9515
139 Ga0395900_0011364 3300037418 Bacteria 9108
140 Ga0395905_0000238 3300037471 Bacteria 83164
141 Ga0395905_0004532 3300037471 Bacteria 14388
142 Ga0395901_0014293 3300038443 Bacteria 8080
143 Ga0395901_0038302 3300038443 Unclassified 4958
144 Ga0451577_0006408 3300042876 Bacteria 11746
145 Ga0453683_0185076 3300044673 Bacteria 1321
146 Ga0453684_0327266 3300044712 Bacteria 1734
147 Ga0495672_0201483 3300047320 Unclassified 995
148 Ga0496100_0047486 3300048903 Bacteria 2767
149 Ga0496100_1159926 3300048903 Unclassified 609
150 Ga0496105_0352661 3300048908 Unclassified 1175
151 Ga0496112_0023282 3300048915 Bacteria 5915
152 Ga0496115_0000007 3300048918 Bacteria 244991
153 Ga0501031_0000291 3300049568 Bacteria 28536
154 Ga0501032_0015086 3300049569 Bacteria 5457
155 Ga0501032_0020221 3300049569 Unclassified 4641
156 Ga0501032_0064972 3300049569 Bacteria 2442
157 Ga0501033_0100099 3300049570 Bacteria 2116
158 Ga0501034_0000863 3300049571 Bacteria 44903
159 Ga0501034_0002719 3300049571 Bacteria 20818
160 Ga0501034_0078316 3300049571 Bacteria 3310
161 Ga0501034_0556317 3300049571 Bacteria 1056
162 Ga0501036_0083652 3300049572 Bacteria 2698
163 Ga0501037_0105662 3300049573 Bacteria 2029
164 Ga0501037_0505425 3300049573 Bacteria 819
165 Ga0501038_0001298 3300049574 Bacteria 22761
166 Ga0501039_0000092 3300049575 Bacteria 63611
167 Ga0501039_0005486 3300049575 Bacteria 9598
168 Ga0501039_0178603 3300049575 Bacteria 1669
169 Ga0501039_0341625 3300049575 Bacteria 1176
170 Ga0501040_0131020 3300049576 Bacteria 1763
171 Ga0501041_0084961 3300049577 Bacteria 1951
172 Ga0501042_0002357 3300049578 Bacteria 11581
173 Ga0501043_0000025 3300049579 Bacteria 149850
174 Ga0501043_0010651 3300049579 Bacteria 7203
175 Ga0501043_0053741 3300049579 Bacteria 3163
176 Ga0501046_0011588 3300049580 Bacteria 7536
177 Ga0501046_0300543 3300049580 Unclassified 1172
178 Ga0501047_0000229 3300049581 Bacteria 66412
179 Ga0501047_0004018 3300049581 Bacteria 13826
180 Ga0501047_0164731 3300049581 Bacteria 2088
181 Ga0501067_0161041 3300049583 Bacteria 1249
182 Ga0501072_0531034 3300049588 Unclassified 930
183 Ga0501073_0000001 3300049589 Bacteria 677932
184 Ga0501074_0314376 3300049590 Bacteria 1112
185 Ga0501077_0014109 3300049593 Bacteria 5013
186 Ga0501198_003420 3300049649 Bacteria 2167
187 Ga0501080_0009480 3300049742 Bacteria 8880
188 Ga0501083_0040686 3300049744 Bacteria 3155
189 Ga0501035_0000033 3300049822 Bacteria 175087
190 Ga0501035_0005734 3300049822 Bacteria 11713
191 Ga0501044_0048773 3300049823 Bacteria 4373
192 Ga0501045_0044721 3300049824 Bacteria 3226
193 nmdc:mga00v17_145638_c2 3300050491 Unclassified 1127
194 Ga0500593_000001 3300053117 Bacteria 784404
195 Ga0500614_000647 3300053123 Bacteria 8893
196 Ga0500655_001036 3300053133 Bacteria 5364
197 Ga0500568_0004417 3300053139 Bacteria 7515
198 Ga0501082_0000892 3300060353 Bacteria 26336
199 Ga0070658_10074816
200 JGI25406J46586_10020033
201 Ga0070658_10000012
202 Ga0070658_10947217
203 Ga0070682_100163487
204 Ga0070660_100158988
205 Ga0070691_10622618
206 Ga0070661_100018470
207 Ga0070673_100001360
208 Ga0070678_100000234
209 Ga0070681_10260535
210 Ga0070681_10485371
211 Ga0070685_10001561
212 Ga0070685_10028656
213 Ga0070679_100363173
214 Ga0070684_100084519
215 Ga0068853_100144324
216 Ga0070693_100014172
217 Ga0070665_100167335
218 Ga0070665_100482558
219 Ga0070704_100056424
220 Ga0068855_100053150
221 Ga0068855_100730132
222 Ga0068857_100002635
223 Ga0068852_100131716
224 Ga0081539_10001746
225 Ga0075364_10283446
226 Ga0105240_10005294
227 Ga0105240_10258616
228 Ga0105245_10000001
229 Ga0105245_10001369
230 Ga0105245_10116517
231 Ga0105245_10241893
232 Ga0105241_10165861
233 Ga0105241_10439322
234 Ga0105241_11225142
235 Ga0105248_10237892
236 Ga0105237_10110426
237 Ga0105238_10026429
238 Ga0105238_10373878
239 Ga0105238_11083916
240 Ga0105239_10013465
241 Ga0105239_10014654
242 Ga0105239_10058980
243 Ga0105239_11230683
244 Ga0157373_10089478
245 Ga0157373_10208592
246 Ga0157370_10045283
247 Ga0157369_10016700
248 Ga0157369_10031355
249 Ga0157369_10114116
250 Ga0157374_10000195
251 Ga0157374_10002313
252 Ga0157374_10007870
253 Ga0157374_10246023
254 Ga0157378_10016124
255 Ga0157372_10000187
256 Ga0157372_10025457
257 Ga0157376_10000001
258 Ga0207705_10000056
259 Ga0207705_10021205
260 Ga0207654_10798373
261 Ga0207707_10005833
262 Ga0207707_10013625
263 Ga0207695_10011003
264 Ga0207695_10063361
265 Ga0207695_10693260
266 Ga0207671_10893959
267 Ga0207660_10011587
268 Ga0207660_11578575
269 Ga0207657_10099823
270 Ga0207657_10116268
271 Ga0207649_10014827
272 Ga0207652_10050155
273 Ga0207652_10426936
274 Ga0207694_10000890
275 Ga0207694_10735800
276 Ga0207687_10000030
277 Ga0207687_10097179
278 Ga0207687_10175575
279 Ga0207644_10080177
280 Ga0207686_10561561
281 Ga0207669_10508074
282 Ga0207691_10022874
283 Ga0207711_10109964
284 Ga0207667_10011999
285 Ga0207667_10620454
286 Ga0207651_10000191
287 Ga0207639_10011404
288 Ga0207641_10121220
289 Ga0207674_10005935
290 Ga0207683_10018388
291 Ga0207698_10076397
292 Ga0268266_10001545
293 Ga0268266_10153110
294 Ga0265337_1051954
295 Ga0265326_10019021
296 Ga0265326_10089110
297 Ga0265334_10006146
298 Ga0265334_10230028
299 Ga0265318_10008288
300 Ga0265322_10026484
301 Ga0265322_10049463
302 Ga0265336_10000047
303 Ga0265336_10019082
304 Ga0265338_10000039
305 Ga0265338_10000054
306 Ga0265338_10000178
307 Ga0265338_10000601
308 Ga0265338_10006957
309 Ga0265338_10027805
310 Ga0265338_10054011
311 Ga0265338_10288094
312 Ga0265324_10008913
313 Ga0265324_10076679
314 Ga0265330_10018568
315 Ga0265330_10104487
316 Ga0265332_10040690
317 Ga0265328_10026512
318 Ga0265328_10055908
319 Ga0265320_10028608
320 Ga0265325_10043861
321 Ga0265325_10065852
322 Ga0265329_10030043
323 Ga0265329_10070778
324 Ga0265340_10117836
325 Ga0265339_10036394
326 Ga0265331_10094480
327 Ga0265316_10118803
328 Ga0265316_10215497
329 Ga0265313_10033046
330 Ga0265313_10309845
331 Ga0265314_10036333
332 Ga0265314_10109216
333 Ga0265342_10180196
334 Ga0265342_10194561
335 Ga0307516_10333597
336 Ga0395899_0005886
337 Ga0395900_0011364
338 Ga0395905_0000238
339 Ga0395905_0004532
340 Ga0395901_0014293
341 Ga0395901_0038302
342 Ga0451577_0006408
343 Ga0453683_0185076
344 Ga0453684_0327266
345 Ga0495672_0201483
346 Ga0496100_0047486
347 Ga0496100_1159926
348 Ga0496105_0352661
349 Ga0496112_0023282
350 Ga0496115_0000007
351 Ga0501031_0000291
352 Ga0501032_0015086
353 Ga0501032_0020221
354 Ga0501032_0064972
355 Ga0501033_0100099
356 Ga0501034_0000863
357 Ga0501034_0002719
358 Ga0501034_0078316
359 Ga0501034_0556317
360 Ga0501036_0083652
361 Ga0501037_0105662
362 Ga0501037_0505425
363 Ga0501038_0001298
364 Ga0501039_0000092
365 Ga0501039_0005486
366 Ga0501039_0178603
367 Ga0501039_0341625
368 Ga0501040_0131020
369 Ga0501041_0084961
370 Ga0501042_0002357
371 Ga0501043_0000025
372 Ga0501043_0010651
373 Ga0501043_0053741
374 Ga0501046_0011588
375 Ga0501046_0300543
376 Ga0501047_0000229
377 Ga0501047_0004018
378 Ga0501047_0164731
379 Ga0501067_0161041
380 Ga0501072_0531034
381 Ga0501073_0000001
382 Ga0501074_0314376
383 Ga0501077_0014109
384 Ga0501198_003420
385 Ga0501080_0009480
386 Ga0501083_0040686
387 Ga0501035_0000033
388 Ga0501035_0005734
389 Ga0501044_0048773
390 Ga0501045_0044721
391 nmdc:mga00v17_145638_c2
392 Ga0500593_000001
393 Ga0500614_000647
394 Ga0500655_001036
395 Ga0500568_0004417
396 Ga0501082_0000892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

73

184

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l0z-assembly1.cif.gz_B crystal structure of adomet bound rrna methyltransferase from sinorhizobium meliloti 0.9123 7 168
5kzk-assembly1.cif.gz_B crystal structure of rrna methyltransferase from sinorhizobium meliloti 0.9087 7 168
1ipa-assembly1.cif.gz_A crystal structure of rna 2'-o ribose methyltransferase 0.8982 5 164
7qiu-assembly1.cif.gz_B ysga 23s rna methyltransferase from bacillus subtilis 0.8878 6 166
4x3m-assembly1.cif.gz_B crystal structure of ttha0275 from thermus thermophilus (hb8) in complex with adenosine in space group p212121 0.8827 7 170
ID Description Score Start End Superfamily
af_Q07527_1273_1436_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9 5 166 3.40.1280.10
af_Q2G2M3_73_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8981 6 167 3.40.1280.10
5l0zB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8934 7 168 3.40.1280.10
af_Q4DMS1_1569_1735_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8926 10 166 3.40.1280.10
af_Q22484_1055_1224_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.892 1 164 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A3S0DQC6-F1-model_v4 TrmH family RNA methyltransferase 0.9938 6 167 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A1F7QJ00-F1-model_v4 tRNA/rRNA methyltransferase SpoU type domain-containing protein 0.9887 6 167 GO:0000049
GO:0002938
GO:0008173
AF-A0A7C3RA58-F1-model_v4 TrmH family RNA methyltransferase 0.9828 5 166 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A258HCK5-F1-model_v4 tRNA/rRNA methyltransferase SpoU type domain-containing protein 0.9827 6 166 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A3D3HB42-F1-model_v4 TrmH family RNA methyltransferase 0.982 6 167 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0016020
GO:0032259

Map