F303881

General Info

Members Datasets Scaffolds Average Seq Length
198 149 396 204

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10001396|Ga0070658_100013963
Length 230
Sequence LVNLFIACYNAPMPLDQQLLILAVVAYLLGSIPFGLIVGRLNGIDPRKGGSGNIGATNVGRLLGRKFFWIVFFLDLLKGLIPMAVAATLARHVDTAHKPYGLWMLVGSAAFLGHLFPVWLKFKGGKGVATAAGVLLGLWPYYTLPGLVPLVVFILIFLATKTVSIGSIFASATFPLAFIGIGLFAGWPVFGRQLPLLVLALAVPTLIIVRHRSNIARLLAGTEKPSQKPS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
114 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
115 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
124 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
125 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
145 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
147 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
148 2547132512 Azospira oryzae 6a3 Isolate Unclassified
149 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.53
Nodule 0
Rhizoplane 0.51
Rhizosphere 92.42
Stem 0
Stem Tuber 0
Unclassified 9.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10001396 3300005327 Bacteria 20612
2 JGI25151J46595_10003843 3300003187 Bacteria 8130
3 Ga0065165_1027211 3300005262 Bacteria 1868
4 Ga0065704_10004052 3300005289 Bacteria 4085
5 Ga0065704_10028103 3300005289 Unclassified 1247
6 Ga0065704_10105278 3300005289 Bacteria 2116
7 Ga0065704_10152590 3300005289 Unclassified 1417
8 Ga0065715_10112145 3300005293 Bacteria 2542
9 Ga0065707_10085979 3300005295 Bacteria 5747
10 Ga0065707_10121704 3300005295 Bacteria 2104
11 Ga0070690_100000076 3300005330 Bacteria 48076
12 Ga0068869_100012719 3300005334 Bacteria 5566
13 Ga0068868_100009701 3300005338 Bacteria 6946
14 Ga0070689_100000982 3300005340 Bacteria 17835
15 Ga0070689_100541604 3300005340 Bacteria 1002
16 Ga0070691_10033440 3300005341 Bacteria 2419
17 Ga0070687_100051611 3300005343 Bacteria 2130
18 Ga0070692_10012531 3300005345 Bacteria 3927
19 Ga0070671_100029442 3300005355 Bacteria 4527
20 Ga0070674_100342415 3300005356 Bacteria 1205
21 Ga0070674_100414782 3300005356 Bacteria 1103
22 Ga0070659_100562139 3300005366 Bacteria 977
23 Ga0070713_100498789 3300005436 Bacteria 1148
24 Ga0070710_10027025 3300005437 Bacteria 3056
25 Ga0070701_10001340 3300005438 Bacteria 9074
26 Ga0070711_100002325 3300005439 Bacteria 10806
27 Ga0070711_100026285 3300005439 Bacteria 3814
28 Ga0070700_100002536 3300005441 Bacteria 9317
29 Ga0070694_100554336 3300005444 Bacteria 921
30 Ga0070708_100425745 3300005445 Unclassified 1252
31 Ga0070678_100003427 3300005456 Bacteria 8848
32 Ga0068867_100014044 3300005459 Bacteria 5673
33 Ga0070706_100009196 3300005467 Bacteria 9202
34 Ga0070706_100060229 3300005467 Bacteria 3504
35 Ga0070706_100769843 3300005467 Bacteria 891
36 Ga0070698_100004034 3300005471 Bacteria 16161
37 Ga0070699_100641517 3300005518 Bacteria 969
38 Ga0070697_100005229 3300005536 Bacteria 9972
39 Ga0070697_100107576 3300005536 Bacteria 2320
40 Ga0068853_100454439 3300005539 Bacteria 1205
41 Ga0070686_100000265 3300005544 Bacteria 35750
42 Ga0070686_100170949 3300005544 Bacteria 1537
43 Ga0070695_100061566 3300005545 Bacteria 2435
44 Ga0070695_100200367 3300005545 Bacteria 1426
45 Ga0070696_100105762 3300005546 Bacteria 2022
46 Ga0070693_100115438 3300005547 Bacteria 1658
47 Ga0070665_100000666 3300005548 Bacteria 46257
48 Ga0070704_100024422 3300005549 Bacteria 3966
49 Ga0070702_100000169 3300005615 Bacteria 20800
50 Ga0070702_100587150 3300005615 Bacteria 833
51 Ga0068859_100212699 3300005617 Bacteria 2020
52 Ga0068859_101330624 3300005617 Bacteria 792
53 Ga0068864_100109446 3300005618 Bacteria 2460
54 Ga0068866_10000107 3300005718 Bacteria 35562
55 Ga0068861_100021254 3300005719 Bacteria 4664
56 Ga0068863_100629200 3300005841 Unclassified 1063
57 Ga0068858_100002634 3300005842 Bacteria 18080
58 Ga0068860_100017080 3300005843 Bacteria 7074
59 Ga0068862_100020803 3300005844 Bacteria 5481
60 Ga0081455_10074037 3300005937 Unclassified 2814
61 Ga0070717_10024821 3300006028 Bacteria 4763
62 Ga0075363_100255594 3300006048 Bacteria 1010
63 Ga0070715_10264016 3300006163 Bacteria 905
64 Ga0070716_100255219 3300006173 Bacteria 1197
65 Ga0070716_100735817 3300006173 Unclassified 757
66 Ga0070712_100052880 3300006175 Bacteria 2834
67 Ga0070712_100109583 3300006175 Bacteria 2058
68 Ga0070712_100217006 3300006175 Unclassified 1512
69 Ga0097621_100062590 3300006237 Bacteria 3055
70 Ga0068871_100001459 3300006358 Bacteria 15833
71 Ga0075434_100005002 3300006871 Bacteria 12031
72 Ga0068865_100000281 3300006881 Bacteria 28119
73 Ga0068865_100960122 3300006881 Unclassified 746
74 Ga0097620_100212701 3300006931 Bacteria 2020
75 Ga0097620_101330887 3300006931 Bacteria 792
76 Ga0099795_10023528 3300007788 Bacteria 2045
77 Ga0105245_10000511 3300009098 Bacteria 35566
78 Ga0105243_10021374 3300009148 Bacteria 4911
79 Ga0105242_10044986 3300009176 Bacteria 3576
80 Ga0105242_10421375 3300009176 Bacteria 1251
81 Ga0105248_11319023 3300009177 Unclassified 816
82 Ga0105249_10047308 3300009553 Bacteria 3919
83 Ga0099796_10031301 3300010159 Unclassified 1734
84 Ga0105239_10827227 3300010375 Bacteria 1061
85 Ga0157373_10036884 3300013100 Bacteria 3507
86 Ga0157373_10495791 3300013100 Viruses 882
87 Ga0157371_10034760 3300013102 Bacteria 3614
88 Ga0157378_10001719 3300013297 Bacteria 19668
89 Ga0163162_10031739 3300013306 Bacteria 5241
90 Ga0157372_11024116 3300013307 Bacteria 956
91 Ga0157375_10509352 3300013308 Bacteria 1367
92 Ga0157375_10882367 3300013308 Bacteria 1039
93 Ga0163163_10264163 3300014325 Bacteria 1772
94 Ga0157379_10041411 3300014968 Bacteria 4112
95 Ga0157376_10009805 3300014969 Bacteria 6980
96 Ga0182006_1016808 3300015261 Bacteria 3118
97 Ga0163161_10259008 3300017792 Bacteria 1358
98 Ga0207692_10147756 3300025898 Bacteria 1343
99 Ga0207699_10217666 3300025906 Bacteria 1302
100 Ga0207643_10039489 3300025908 Bacteria 2655
101 Ga0207705_10001070 3300025909 Bacteria 22233
102 Ga0207684_10073925 3300025910 Bacteria 2895
103 Ga0207684_10382735 3300025910 Bacteria 1210
104 Ga0207693_10063613 3300025915 Bacteria 2890
105 Ga0207693_10073923 3300025915 Bacteria 2668
106 Ga0207693_10086409 3300025915 Bacteria 2457
107 Ga0207693_10116817 3300025915 Bacteria 2094
108 Ga0207663_10047720 3300025916 Bacteria 2646
109 Ga0207687_10016934 3300025927 Bacteria 4790
110 Ga0207664_10078450 3300025929 Bacteria 2678
111 Ga0207644_10055109 3300025931 Bacteria 2865
112 Ga0207686_10000084 3300025934 Bacteria 79402
113 Ga0207709_10065410 3300025935 Bacteria 2287
114 Ga0207670_10001778 3300025936 Bacteria 11283
115 Ga0207670_10474005 3300025936 Bacteria 1013
116 Ga0207669_10186371 3300025937 Bacteria 1493
117 Ga0207704_10010362 3300025938 Bacteria 4545
118 Ga0207665_10011382 3300025939 Bacteria 5842
119 Ga0207665_10101864 3300025939 Bacteria 2006
120 Ga0207689_10001984 3300025942 Bacteria 19331
121 Ga0207703_10001789 3300026035 Bacteria 19164
122 Ga0207639_10434806 3300026041 Bacteria 1189
123 Ga0207708_10000049 3300026075 Bacteria 114743
124 Ga0207708_10092971 3300026075 Bacteria 2328
125 Ga0207641_10357957 3300026088 Bacteria 1393
126 Ga0207648_10000161 3300026089 Bacteria 69095
127 Ga0207676_10106340 3300026095 Bacteria 2338
128 Ga0207675_100000176 3300026118 Bacteria 57464
129 Ga0207675_100477825 3300026118 Bacteria 1238
130 Ga0207683_10515455 3300026121 Unclassified 1105
131 Ga0209371_1000127 3300027312 Bacteria 127069
132 Ga0268266_10000777 3300028379 Bacteria 42678
133 Ga0268265_10016608 3300028380 Bacteria 5062
134 Ga0268264_10064701 3300028381 Bacteria 3078
135 Ga0265338_10001853 3300028800 Bacteria 33209
136 Ga0265338_10036894 3300028800 Bacteria 4666
137 Ga0265338_10120846 3300028800 Bacteria 2088
138 Ga0265324_10000410 3300029957 Bacteria 30845
139 Ga0268256_1000104 3300030500 Bacteria 127069
140 Ga0265330_10118077 3300031235 Bacteria 1131
141 Ga0265332_10000039 3300031238 Bacteria 128373
142 Ga0265339_10072824 3300031249 Bacteria 1828
143 Ga0265327_10004802 3300031251 Bacteria 11735
144 Ga0265316_10010545 3300031344 Bacteria 8413
145 Ga0265316_10023840 3300031344 Bacteria 5139
146 Ga0316577_10020281 3300031733 Bacteria 3685
147 Ga0316580_10102342 3300032139 Unclassified 877
148 Ga0373928_0053752 3300035084 Bacteria 957
149 Ga0373936_0013276 3300035113 Bacteria 3143
150 Ga0373955_0384576 3300035172 Bacteria 852
151 Ga0373935_0008593 3300035692 Bacteria 6110
152 Ga0373947_0040794 3300035725 Bacteria 2766
153 Ga0373947_0674225 3300035725 Unclassified 705
154 Ga0316584_0000170 3300036712 Bacteria 30855
155 Ga0373925_0111148 3300037068 Unclassified 2117
156 Ga0373925_0662280 3300037068 Bacteria 860
157 Ga0436365_0530154 3300039437 Unclassified 963
158 Ga0436365_0737905 3300039437 Bacteria 3096
159 Ga0436365_1342894 3300039437 Unclassified 1359
160 Ga0436365_1569466 3300039437 Bacteria 770
161 Ga0439466_0025046 3300041411 Bacteria 2086
162 Ga0439432_096719 3300042006 Bacteria 885
163 Ga0439464_0010374 3300042439 Bacteria 2458
164 Ga0451577_0002442 3300042876 Bacteria 22165
165 Ga0451577_0036565 3300042876 Bacteria 4420
166 Ga0451577_0235927 3300042876 Bacteria 1654
167 Ga0451577_0264016 3300042876 Bacteria 1559
168 Ga0451577_0375484 3300042876 Bacteria 1290
169 Ga0453684_0005854 3300044712 Bacteria 23899
170 Ga0453684_0045290 3300044712 Bacteria 5872
171 Ga0453684_0048804 3300044712 Bacteria 5590
172 Ga0453684_0094888 3300044712 Bacteria 3668
173 Ga0451576_0236945 3300045051 Bacteria 1906
174 Ga0451576_0274091 3300045051 Bacteria 1764
175 Ga0451576_1206169 3300045051 Bacteria 790
176 Ga0495603_0356095 3300046455 Unclassified 840
177 Ga0495618_0372899 3300046514 Unclassified 877
178 Ga0495586_0450491 3300046535 Bacteria 742
179 Ga0495621_0056055 3300046539 Bacteria 1420
180 Ga0495621_0153779 3300046539 Bacteria 906
181 Ga0495684_0618234 3300047471 Unclassified 729
182 Ga0495686_0010707 3300047472 Bacteria 6508
183 Ga0496112_0029043 3300048915 Bacteria 5346
184 Ga0496118_0266484 3300048921 Bacteria 963
185 Ga0496122_0207952 3300048925 Bacteria 1137
186 Ga0501034_0002683 3300049571 Bacteria 20983
187 Ga0501047_0091338 3300049581 Bacteria 2923
188 Ga0501080_0009352 3300049742 Bacteria 8937
189 Ga0501081_0763014 3300049743 Bacteria 727
190 Ga0501083_0031789 3300049744 Bacteria 3622
191 Ga0501083_0040403 3300049744 Bacteria 3166
192 Ga0501044_0031232 3300049823 Bacteria 5607
193 Ga0500566_0355186 3300053094 Bacteria 670
194 Ga0500556_0159084 3300053104 Bacteria 891
195 Ga0530510_0003746 3300061734 Bacteria 10467
196 2526211785 2526164512 Bacteria 4025691
197 2548848849 2547132512 Bacteria 3416496
198 3007320398 3007315729 Bacteria 5076637
199 Ga0070658_10001396
200 JGI25151J46595_10003843
201 Ga0065165_1027211
202 Ga0065704_10004052
203 Ga0065704_10028103
204 Ga0065704_10105278
205 Ga0065704_10152590
206 Ga0065715_10112145
207 Ga0065707_10085979
208 Ga0065707_10121704
209 Ga0070690_100000076
210 Ga0068869_100012719
211 Ga0068868_100009701
212 Ga0070689_100000982
213 Ga0070689_100541604
214 Ga0070691_10033440
215 Ga0070687_100051611
216 Ga0070692_10012531
217 Ga0070671_100029442
218 Ga0070674_100342415
219 Ga0070674_100414782
220 Ga0070659_100562139
221 Ga0070713_100498789
222 Ga0070710_10027025
223 Ga0070701_10001340
224 Ga0070711_100002325
225 Ga0070711_100026285
226 Ga0070700_100002536
227 Ga0070694_100554336
228 Ga0070708_100425745
229 Ga0070678_100003427
230 Ga0068867_100014044
231 Ga0070706_100009196
232 Ga0070706_100060229
233 Ga0070706_100769843
234 Ga0070698_100004034
235 Ga0070699_100641517
236 Ga0070697_100005229
237 Ga0070697_100107576
238 Ga0068853_100454439
239 Ga0070686_100000265
240 Ga0070686_100170949
241 Ga0070695_100061566
242 Ga0070695_100200367
243 Ga0070696_100105762
244 Ga0070693_100115438
245 Ga0070665_100000666
246 Ga0070704_100024422
247 Ga0070702_100000169
248 Ga0070702_100587150
249 Ga0068859_100212699
250 Ga0068859_101330624
251 Ga0068864_100109446
252 Ga0068866_10000107
253 Ga0068861_100021254
254 Ga0068863_100629200
255 Ga0068858_100002634
256 Ga0068860_100017080
257 Ga0068862_100020803
258 Ga0081455_10074037
259 Ga0070717_10024821
260 Ga0075363_100255594
261 Ga0070715_10264016
262 Ga0070716_100255219
263 Ga0070716_100735817
264 Ga0070712_100052880
265 Ga0070712_100109583
266 Ga0070712_100217006
267 Ga0097621_100062590
268 Ga0068871_100001459
269 Ga0075434_100005002
270 Ga0068865_100000281
271 Ga0068865_100960122
272 Ga0097620_100212701
273 Ga0097620_101330887
274 Ga0099795_10023528
275 Ga0105245_10000511
276 Ga0105243_10021374
277 Ga0105242_10044986
278 Ga0105242_10421375
279 Ga0105248_11319023
280 Ga0105249_10047308
281 Ga0099796_10031301
282 Ga0105239_10827227
283 Ga0157373_10036884
284 Ga0157373_10495791
285 Ga0157371_10034760
286 Ga0157378_10001719
287 Ga0163162_10031739
288 Ga0157372_11024116
289 Ga0157375_10509352
290 Ga0157375_10882367
291 Ga0163163_10264163
292 Ga0157379_10041411
293 Ga0157376_10009805
294 Ga0182006_1016808
295 Ga0163161_10259008
296 Ga0207692_10147756
297 Ga0207699_10217666
298 Ga0207643_10039489
299 Ga0207705_10001070
300 Ga0207684_10073925
301 Ga0207684_10382735
302 Ga0207693_10063613
303 Ga0207693_10073923
304 Ga0207693_10086409
305 Ga0207693_10116817
306 Ga0207663_10047720
307 Ga0207687_10016934
308 Ga0207664_10078450
309 Ga0207644_10055109
310 Ga0207686_10000084
311 Ga0207709_10065410
312 Ga0207670_10001778
313 Ga0207670_10474005
314 Ga0207669_10186371
315 Ga0207704_10010362
316 Ga0207665_10011382
317 Ga0207665_10101864
318 Ga0207689_10001984
319 Ga0207703_10001789
320 Ga0207639_10434806
321 Ga0207708_10000049
322 Ga0207708_10092971
323 Ga0207641_10357957
324 Ga0207648_10000161
325 Ga0207676_10106340
326 Ga0207675_100000176
327 Ga0207675_100477825
328 Ga0207683_10515455
329 Ga0209371_1000127
330 Ga0268266_10000777
331 Ga0268265_10016608
332 Ga0268264_10064701
333 Ga0265338_10001853
334 Ga0265338_10036894
335 Ga0265338_10120846
336 Ga0265324_10000410
337 Ga0268256_1000104
338 Ga0265330_10118077
339 Ga0265332_10000039
340 Ga0265339_10072824
341 Ga0265327_10004802
342 Ga0265316_10010545
343 Ga0265316_10023840
344 Ga0316577_10020281
345 Ga0316580_10102342
346 Ga0373928_0053752
347 Ga0373936_0013276
348 Ga0373955_0384576
349 Ga0373935_0008593
350 Ga0373947_0040794
351 Ga0373947_0674225
352 Ga0316584_0000170
353 Ga0373925_0111148
354 Ga0373925_0662280
355 Ga0436365_0530154
356 Ga0436365_0737905
357 Ga0436365_1342894
358 Ga0436365_1569466
359 Ga0439466_0025046
360 Ga0439432_096719
361 Ga0439464_0010374
362 Ga0451577_0002442
363 Ga0451577_0036565
364 Ga0451577_0235927
365 Ga0451577_0264016
366 Ga0451577_0375484
367 Ga0453684_0005854
368 Ga0453684_0045290
369 Ga0453684_0048804
370 Ga0453684_0094888
371 Ga0451576_0236945
372 Ga0451576_0274091
373 Ga0451576_1206169
374 Ga0495603_0356095
375 Ga0495618_0372899
376 Ga0495586_0450491
377 Ga0495621_0056055
378 Ga0495621_0153779
379 Ga0495684_0618234
380 Ga0495686_0010707
381 Ga0496112_0029043
382 Ga0496118_0266484
383 Ga0496122_0207952
384 Ga0501034_0002683
385 Ga0501047_0091338
386 Ga0501080_0009352
387 Ga0501081_0763014
388 Ga0501083_0031789
389 Ga0501083_0040403
390 Ga0501044_0031232
391 Ga0500566_0355186
392 Ga0500556_0159084
393 Ga0530510_0003746
394 2526211785
395 2548848849
396 3007320398

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

25

218

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.9188 20 218
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.91 19 222
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.8883 19 222
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.8698 20 218
4u7y-assembly1.cif.gz_A structure of the complex of vps4b mit and ist1 mim 0.4244 141 214
ID Description Score Start End Superfamily
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.879 28 210 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8651 28 210 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8474 28 210 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8345 28 210 1.10.1760.20
af_O75351_1_89_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.5406 161 217 1.20.58.80
ID Description Score Start End GO Terms
AF-A0A519LKA4-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9737 19 114 GO:0005886
GO:0008654
GO:0043772
AF-A0A4Q3MXU0-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9679 96 223 GO:0005886
GO:0008654
GO:0043772
AF-A0A1M3IXA0-F1-model_v4 deleted 0.9639 17 203
AF-A0A6G8AGS2-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.963 18 223 GO:0005886
GO:0008654
GO:0043772
AF-A0A3A0E6M6-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9609 17 208 GO:0005886
GO:0008654
GO:0043772

Map