F303649

General Info

Members Datasets Scaffolds Average Seq Length
197 116 394 250

Family's Representative Sequence

Representative Sequence 3300053094|Ga0500566_0001400|Ga0500566_0001400_10777_11631
Length 284
Sequence LRWAFIAITFWLTRIARSSVNRSLSHPWPGPSIGAAAGELSGSTKMAVVTDHHWFEPMADHLGETYLRYSFTKGTAQEVDFLVEALGLEPGMRVLDVGCGPGRHAHELARRGIAVHGIDISQRFIDVAIAADVPGATFDRLDARALAFDSEFDAAISLCQGAFGLLGGSDDGAVLAGMARAVHPGGRVGVSAFSAYFQVRFLEDSTFDADAGVNHERTTVKDPQGNDAEFDLWTTCFTPRELRLLAAAAGLEERGLWSVGPGEYGREPPTIDSYEFLLVAARPG

Samples

Sample ID Description Type Environment
1 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
4 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
32 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
34 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
37 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
40 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
41 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
42 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
43 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
44 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
45 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
46 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
47 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
48 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
49 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
50 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
51 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
52 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
53 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
54 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
55 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
56 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
57 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
58 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
59 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
60 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
61 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
62 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
63 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
64 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
65 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
68 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
69 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
70 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
71 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
72 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
73 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
74 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
88 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
94 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
97 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
103 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
104 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
105 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
112 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
113 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.68
Nodule 0
Rhizoplane 0.51
Rhizosphere 84.26
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500566_0001400 3300053094 Bacteria 14116
2 JGI25407J50210_10000763 3300003373 Bacteria 6770
3 Ga0070705_100015658 3300005440 Bacteria 3924
4 Ga0070681_10031613 3300005458 Bacteria 5314
5 Ga0070706_100049839 3300005467 Bacteria 3863
6 Ga0070707_100313308 3300005468 Bacteria 1525
7 Ga0070698_100459520 3300005471 Bacteria 1209
8 Ga0070679_100259447 3300005530 Bacteria 1693
9 Ga0070695_100022620 3300005545 Bacteria 3857
10 Ga0070696_100220855 3300005546 Bacteria 1422
11 Ga0070704_100149992 3300005549 Bacteria 1832
12 Ga0068860_100008537 3300005843 Bacteria 10207
13 Ga0081455_10005863 3300005937 Bacteria 13357
14 Ga0081455_10006725 3300005937 Bacteria 12279
15 Ga0081455_10043541 3300005937 Bacteria 3925
16 Ga0081538_10000131 3300005981 Bacteria 77253
17 Ga0081538_10031863 3300005981 Bacteria 3546
18 Ga0081538_10088204 3300005981 Bacteria 1616
19 Ga0075365_10013173 3300006038 Bacteria 4933
20 Ga0075365_10046160 3300006038 Bacteria 2860
21 Ga0075365_10087864 3300006038 Bacteria 2114
22 Ga0075365_10106754 3300006038 Bacteria 1922
23 Ga0075365_10274356 3300006038 Bacteria 1186
24 Ga0075364_10028099 3300006051 Bacteria 3599
25 Ga0075364_10053918 3300006051 Bacteria 2629
26 Ga0075364_10251034 3300006051 Bacteria 1202
27 Ga0075364_10297222 3300006051 Bacteria 1099
28 Ga0075367_10176910 3300006178 Bacteria 1330
29 Ga0075428_100003183 3300006844 Bacteria 17948
30 Ga0075428_100016927 3300006844 Bacteria 8051
31 Ga0075430_100000181 3300006846 Bacteria 42043
32 Ga0075430_100007832 3300006846 Bacteria 9027
33 Ga0075431_100000776 3300006847 Bacteria 27744
34 Ga0075431_100001121 3300006847 Bacteria 24005
35 Ga0075431_100016250 3300006847 Bacteria 7551
36 Ga0075431_100119100 3300006847 Bacteria 2724
37 Ga0075431_100366113 3300006847 Bacteria 1447
38 Ga0075434_100606176 3300006871 Bacteria 1114
39 Ga0075429_100065768 3300006880 Bacteria 3156
40 Ga0075429_100074028 3300006880 Bacteria 2967
41 Ga0111539_10423802 3300009094 Bacteria 1550
42 Ga0114129_10000179 3300009147 Bacteria 70108
43 Ga0114129_10075714 3300009147 Bacteria 4686
44 Ga0114129_10084786 3300009147 Bacteria 4398
45 Ga0114129_11352308 3300009147 Bacteria 881
46 Ga0105243_10133616 3300009148 Bacteria 2108
47 Ga0157369_10690111 3300013105 Bacteria 1052
48 Ga0163161_10125333 3300017792 Bacteria 1933
49 Ga0213876_10005540 3300021384 Bacteria 6931
50 Ga0207684_10165270 3300025910 Bacteria 1907
51 Ga0207707_10032435 3300025912 Bacteria 4572
52 Ga0207428_10329622 3300027907 Bacteria 1126
53 Ga0268264_10001330 3300028381 Bacteria 23249
54 Ga0316576_10023040 3300031727 Bacteria 4333
55 Ga0316576_10027390 3300031727 Bacteria 4008
56 Ga0307405_10252824 3300031731 Bacteria 1312
57 Ga0307413_10064296 3300031824 Bacteria 2279
58 Ga0307407_10063169 3300031903 Bacteria 2171
59 Ga0307409_100077227 3300031995 Bacteria 2674
60 Ga0307416_100044807 3300032002 Bacteria 3477
61 Ga0307415_100317019 3300032126 Bacteria 1298
62 Ga0307415_100332911 3300032126 Bacteria 1271
63 Ga0373930_0000395 3300034816 Bacteria 5771
64 Ga0373948_0007075 3300034817 Bacteria 1877
65 Ga0373928_0003326 3300035084 Bacteria 3073
66 Ga0316574_0044723 3300035398 Bacteria 2740
67 Ga0373931_0000005 3300035691 Bacteria 480485
68 Ga0373931_0000019 3300035691 Bacteria 186534
69 Ga0373933_0138464 3300035724 Bacteria 1535
70 Ga0373937_0033544 3300036401 Bacteria 4663
71 Ga0373925_0190088 3300037068 Bacteria 1629
72 Ga0400483_107878 3300039062 Bacteria 3629
73 Ga0400483_283771 3300039062 Bacteria 4166
74 Ga0436365_0064355 3300039437 Bacteria 10072
75 Ga0436365_0417305 3300039437 Bacteria 2199
76 Ga0451837_0969062 3300041494 Bacteria 877
77 Ga0451837_1675265 3300041494 Bacteria 1672
78 Ga0439448_0098727 3300042005 Bacteria 991
79 Ga0439451_004192 3300042009 Bacteria 2925
80 Ga0439452_014541 3300042010 Bacteria 2182
81 Ga0439454_001387 3300042011 Bacteria 2313
82 Ga0439463_002196 3300042016 Bacteria 5029
83 Ga0439434_0009203 3300042435 Bacteria 2904
84 Ga0439464_0002467 3300042439 Bacteria 4552
85 Ga0451577_0015038 3300042876 Bacteria 7200
86 Ga0439440_0006153 3300042993 Bacteria 2405
87 Ga0453684_0030239 3300044712 Bacteria 7657
88 Ga0495651_0007482 3300046462 Bacteria 8353
89 Ga0495653_0388714 3300046463 Bacteria 889
90 Ga0495584_0161208 3300046491 Unclassified 1140
91 Ga0495608_0028610 3300046511 Bacteria 3787
92 Ga0495628_0039532 3300046516 Bacteria 3773
93 Ga0495630_0493550 3300046517 Bacteria 939
94 Ga0495587_0048229 3300046536 Bacteria 2522
95 Ga0495621_0007928 3300046539 Bacteria 3162
96 Ga0495667_0002692 3300046559 Bacteria 11886
97 Ga0495657_0002579 3300046675 Bacteria 15187
98 Ga0495680_0006726 3300047322 Bacteria 10632
99 Ga0495602_0329237 3300048088 Bacteria 1108
100 Ga0496108_0281792 3300048911 Bacteria 1447
101 Ga0501031_0029572 3300049568 Bacteria 3574
102 Ga0501032_0002431 3300049569 Bacteria 14533
103 Ga0501033_0004079 3300049570 Bacteria 11784
104 Ga0501033_0004768 3300049570 Bacteria 10837
105 Ga0501033_0142459 3300049570 Bacteria 1733
106 Ga0501034_0000858 3300049571 Bacteria 44982
107 Ga0501034_0007737 3300049571 Bacteria 11424
108 Ga0501034_0149400 3300049571 Bacteria 2313
109 Ga0501034_0248826 3300049571 Bacteria 1722
110 Ga0501036_0009983 3300049572 Bacteria 7819
111 Ga0501036_0021020 3300049572 Bacteria 5480
112 Ga0501038_0011117 3300049574 Bacteria 8221
113 Ga0501038_0089649 3300049574 Bacteria 2579
114 Ga0501038_0093159 3300049574 Bacteria 2521
115 Ga0501039_0078379 3300049575 Bacteria 2570
116 Ga0501039_0172329 3300049575 Bacteria 1701
117 Ga0501040_0081439 3300049576 Bacteria 2243
118 Ga0501041_0047312 3300049577 Bacteria 2618
119 Ga0501041_0244888 3300049577 Bacteria 1127
120 Ga0501042_0051768 3300049578 Bacteria 2929
121 Ga0501043_0018379 3300049579 Bacteria 5481
122 Ga0501043_0028088 3300049579 Bacteria 4416
123 Ga0501046_0003036 3300049580 Bacteria 15510
124 Ga0501046_0223549 3300049580 Bacteria 1393
125 Ga0501048_0012816 3300049582 Bacteria 6230
126 Ga0501068_0004350 3300049584 Bacteria 7698
127 Ga0501068_0025238 3300049584 Bacteria 3496
128 Ga0501069_0001425 3300049585 Bacteria 11725
129 Ga0501069_0028551 3300049585 Bacteria 3060
130 Ga0501070_0001379 3300049586 Bacteria 21729
131 Ga0501070_0008767 3300049586 Bacteria 8550
132 Ga0501070_0193370 3300049586 Bacteria 1672
133 Ga0501071_0038132 3300049587 Bacteria 3433
134 Ga0501071_0066257 3300049587 Bacteria 2624
135 Ga0501071_0071054 3300049587 Bacteria 2537
136 Ga0501071_0084858 3300049587 Bacteria 2322
137 Ga0501072_0000649 3300049588 Bacteria 25023
138 Ga0501072_0107493 3300049588 Bacteria 2219
139 Ga0501072_0190384 3300049588 Bacteria 1636
140 Ga0501073_0000572 3300049589 Bacteria 25964
141 Ga0501074_0046176 3300049590 Bacteria 3149
142 Ga0501074_0059276 3300049590 Bacteria 2758
143 Ga0501075_0031341 3300049591 Bacteria 3945
144 Ga0501075_0070217 3300049591 Bacteria 2647
145 Ga0501076_0048535 3300049592 Bacteria 3355
146 Ga0501077_0023452 3300049593 Bacteria 3914
147 Ga0501079_0002425 3300049741 Bacteria 13531
148 Ga0501079_0023526 3300049741 Bacteria 4728
149 Ga0501079_0086436 3300049741 Bacteria 2427
150 Ga0501079_0164813 3300049741 Bacteria 1728
151 Ga0501080_0092267 3300049742 Bacteria 2813
152 Ga0501080_0113093 3300049742 Bacteria 2516
153 Ga0501080_0255270 3300049742 Bacteria 1598
154 Ga0501080_0258866 3300049742 Bacteria 1586
155 Ga0501081_0008861 3300049743 Bacteria 6540
156 Ga0501081_0115784 3300049743 Bacteria 1905
157 Ga0501083_0049255 3300049744 Bacteria 2840
158 Ga0501083_0070079 3300049744 Bacteria 2332
159 Ga0501083_0272699 3300049744 Bacteria 1101
160 Ga0501044_0001844 3300049823 Bacteria 24644
161 Ga0501044_0003859 3300049823 Bacteria 16793
162 Ga0501045_0002618 3300049824 Bacteria 12255
163 nmdc:mga00v17_143891_c1 3300050491 Bacteria 1530
164 nmdc:mga00v17_225306_c1 3300050491 Bacteria 1214
165 nmdc:mga00v17_6553_c1 3300050491 Bacteria 3485
166 nmdc:mga0yw44_10106_c1 3300050492 Bacteria 4805
167 nmdc:mga0yw44_193796_c1 3300050492 Bacteria 1341
168 nmdc:mga0yw44_196936_c1 3300050492 Bacteria 1330
169 nmdc:mga0yw44_3846_c1 3300050492 Bacteria 6749
170 nmdc:mga06z11_120641_c1 3300050494 Bacteria 1462
171 nmdc:mga06z11_156327_c1 3300050494 Bacteria 1300
172 nmdc:mga05p37_337_c1 3300050507 Bacteria 50255
173 nmdc:mga05p37_369167_c1 3300050507 Bacteria 1685
174 nmdc:mga05p37_387976_c1 3300050507 Bacteria 1634
175 nmdc:mga05p37_49643_c1 3300050507 Bacteria 5161
176 nmdc:mga05p37_694509_c1 3300050507 Bacteria 1132
177 nmdc:mga09592_1437_c1 3300050508 Bacteria 19085
178 nmdc:mga09592_43966_c1 3300050508 Bacteria 3758
179 nmdc:mga09592_682_c1 3300050508 Bacteria 26003
180 nmdc:mga0qj67_1021_c1 3300050509 Bacteria 19347
181 nmdc:mga0qj67_1966_c1 3300050509 Bacteria 14632
182 nmdc:mga06r32_3063_c1 3300050510 Bacteria 14958
183 nmdc:mga06r32_3215_c1 3300050510 Bacteria 14623
184 nmdc:mga06r32_440093_c1 3300050510 Bacteria 1284
185 nmdc:mga06r32_446748_c1 3300050510 Bacteria 1273
186 nmdc:mga08y16_442897_c1 3300050511 Bacteria 1326
187 Ga0495612_0013928 3300053078 Bacteria 3240
188 Ga0500568_0019047 3300053139 Bacteria 2992
189 Ga0500616_0000398 3300053153 Bacteria 59666
190 Ga0500616_0014712 3300053153 Bacteria 4488
191 Ga0501084_0002302 3300054114 Bacteria 15350
192 Ga0501084_0004399 3300054114 Bacteria 11491
193 Ga0501084_0028889 3300054114 Bacteria 4636
194 Ga0501082_0055898 3300060353 Bacteria 3399
195 Ga0501082_0150014 3300060353 Bacteria 2024
196 Ga0501082_0904829 3300060353 Bacteria 772
197 Ga0530510_0002915 3300061734 Bacteria 11731
198 Ga0500566_0001400
199 JGI25407J50210_10000763
200 Ga0070705_100015658
201 Ga0070681_10031613
202 Ga0070706_100049839
203 Ga0070707_100313308
204 Ga0070698_100459520
205 Ga0070679_100259447
206 Ga0070695_100022620
207 Ga0070696_100220855
208 Ga0070704_100149992
209 Ga0068860_100008537
210 Ga0081455_10005863
211 Ga0081455_10006725
212 Ga0081455_10043541
213 Ga0081538_10000131
214 Ga0081538_10031863
215 Ga0081538_10088204
216 Ga0075365_10013173
217 Ga0075365_10046160
218 Ga0075365_10087864
219 Ga0075365_10106754
220 Ga0075365_10274356
221 Ga0075364_10028099
222 Ga0075364_10053918
223 Ga0075364_10251034
224 Ga0075364_10297222
225 Ga0075367_10176910
226 Ga0075428_100003183
227 Ga0075428_100016927
228 Ga0075430_100000181
229 Ga0075430_100007832
230 Ga0075431_100000776
231 Ga0075431_100001121
232 Ga0075431_100016250
233 Ga0075431_100119100
234 Ga0075431_100366113
235 Ga0075434_100606176
236 Ga0075429_100065768
237 Ga0075429_100074028
238 Ga0111539_10423802
239 Ga0114129_10000179
240 Ga0114129_10075714
241 Ga0114129_10084786
242 Ga0114129_11352308
243 Ga0105243_10133616
244 Ga0157369_10690111
245 Ga0163161_10125333
246 Ga0213876_10005540
247 Ga0207684_10165270
248 Ga0207707_10032435
249 Ga0207428_10329622
250 Ga0268264_10001330
251 Ga0316576_10023040
252 Ga0316576_10027390
253 Ga0307405_10252824
254 Ga0307413_10064296
255 Ga0307407_10063169
256 Ga0307409_100077227
257 Ga0307416_100044807
258 Ga0307415_100317019
259 Ga0307415_100332911
260 Ga0373930_0000395
261 Ga0373948_0007075
262 Ga0373928_0003326
263 Ga0316574_0044723
264 Ga0373931_0000005
265 Ga0373931_0000019
266 Ga0373933_0138464
267 Ga0373937_0033544
268 Ga0373925_0190088
269 Ga0400483_107878
270 Ga0400483_283771
271 Ga0436365_0064355
272 Ga0436365_0417305
273 Ga0451837_0969062
274 Ga0451837_1675265
275 Ga0439448_0098727
276 Ga0439451_004192
277 Ga0439452_014541
278 Ga0439454_001387
279 Ga0439463_002196
280 Ga0439434_0009203
281 Ga0439464_0002467
282 Ga0451577_0015038
283 Ga0439440_0006153
284 Ga0453684_0030239
285 Ga0495651_0007482
286 Ga0495653_0388714
287 Ga0495584_0161208
288 Ga0495608_0028610
289 Ga0495628_0039532
290 Ga0495630_0493550
291 Ga0495587_0048229
292 Ga0495621_0007928
293 Ga0495667_0002692
294 Ga0495657_0002579
295 Ga0495680_0006726
296 Ga0495602_0329237
297 Ga0496108_0281792
298 Ga0501031_0029572
299 Ga0501032_0002431
300 Ga0501033_0004079
301 Ga0501033_0004768
302 Ga0501033_0142459
303 Ga0501034_0000858
304 Ga0501034_0007737
305 Ga0501034_0149400
306 Ga0501034_0248826
307 Ga0501036_0009983
308 Ga0501036_0021020
309 Ga0501038_0011117
310 Ga0501038_0089649
311 Ga0501038_0093159
312 Ga0501039_0078379
313 Ga0501039_0172329
314 Ga0501040_0081439
315 Ga0501041_0047312
316 Ga0501041_0244888
317 Ga0501042_0051768
318 Ga0501043_0018379
319 Ga0501043_0028088
320 Ga0501046_0003036
321 Ga0501046_0223549
322 Ga0501048_0012816
323 Ga0501068_0004350
324 Ga0501068_0025238
325 Ga0501069_0001425
326 Ga0501069_0028551
327 Ga0501070_0001379
328 Ga0501070_0008767
329 Ga0501070_0193370
330 Ga0501071_0038132
331 Ga0501071_0066257
332 Ga0501071_0071054
333 Ga0501071_0084858
334 Ga0501072_0000649
335 Ga0501072_0107493
336 Ga0501072_0190384
337 Ga0501073_0000572
338 Ga0501074_0046176
339 Ga0501074_0059276
340 Ga0501075_0031341
341 Ga0501075_0070217
342 Ga0501076_0048535
343 Ga0501077_0023452
344 Ga0501079_0002425
345 Ga0501079_0023526
346 Ga0501079_0086436
347 Ga0501079_0164813
348 Ga0501080_0092267
349 Ga0501080_0113093
350 Ga0501080_0255270
351 Ga0501080_0258866
352 Ga0501081_0008861
353 Ga0501081_0115784
354 Ga0501083_0049255
355 Ga0501083_0070079
356 Ga0501083_0272699
357 Ga0501044_0001844
358 Ga0501044_0003859
359 Ga0501045_0002618
360 nmdc:mga00v17_143891_c1
361 nmdc:mga00v17_225306_c1
362 nmdc:mga00v17_6553_c1
363 nmdc:mga0yw44_10106_c1
364 nmdc:mga0yw44_193796_c1
365 nmdc:mga0yw44_196936_c1
366 nmdc:mga0yw44_3846_c1
367 nmdc:mga06z11_120641_c1
368 nmdc:mga06z11_156327_c1
369 nmdc:mga05p37_337_c1
370 nmdc:mga05p37_369167_c1
371 nmdc:mga05p37_387976_c1
372 nmdc:mga05p37_49643_c1
373 nmdc:mga05p37_694509_c1
374 nmdc:mga09592_1437_c1
375 nmdc:mga09592_43966_c1
376 nmdc:mga09592_682_c1
377 nmdc:mga0qj67_1021_c1
378 nmdc:mga0qj67_1966_c1
379 nmdc:mga06r32_3063_c1
380 nmdc:mga06r32_3215_c1
381 nmdc:mga06r32_440093_c1
382 nmdc:mga06r32_446748_c1
383 nmdc:mga08y16_442897_c1
384 Ga0495612_0013928
385 Ga0500568_0019047
386 Ga0500616_0000398
387 Ga0500616_0014712
388 Ga0501084_0002302
389 Ga0501084_0004399
390 Ga0501084_0028889
391 Ga0501082_0055898
392 Ga0501082_0150014
393 Ga0501082_0904829
394 Ga0530510_0002915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

94

186

0.92

PF08241

Methyltransf_11

Methyltransferase domain

95

190

0.89

PF02353

CMAS

Mycolic acid cyclopropane synthetase

66

199

0.86

PF13847

Methyltransf_31

Methyltransferase domain

88

236

0.86

PF08242

Methyltransf_12

Methyltransferase domain

95

188

0.85

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

70

207

0.82

PF13489

Methyltransf_23

Methyltransferase domain

66

254

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.8788 46 168
6p3m-assembly1.cif.gz_A-2 tetrahydroprotoberberine n-methyltransferase in complex with s-adenosylhomocysteine 0.8573 48 168
6gkz-assembly2.cif.gz_B-2 crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah 0.8534 44 168
6gkz-assembly1.cif.gz_A crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah 0.8513 44 168
6gkz-assembly2.cif.gz_C crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah 0.8444 44 168
ID Description Score Start End Superfamily
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9177 48 126 3.40.50.150
af_Q4CMB6_37_161_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8785 45 110 3.40.50.150
af_Q4D3E1_216_398_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8676 46 94 3.40.50.150
3egeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8664 46 168 3.40.50.150
af_A0A0N7KI91_1_189_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8493 48 164 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2D6UA81-F1-model_v4 Methyltransferase 0.9861 57 257 GO:0008168
GO:0032259
AF-A0A3C0HN67-F1-model_v4 Class I SAM-dependent methyltransferase 0.9812 43 257 GO:0008168
GO:0032259
AF-A0A2E6E177-F1-model_v4 Methyltransferase 0.9773 31 257 GO:0008168
GO:0032259
AF-A0A7W0LRG2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9742 92 258
AF-A0A2D6UA81-F1-model_v4 Methyltransferase 0.9717 57 257 GO:0008168
GO:0032259

Map