F303592

General Info

Members Datasets Scaffolds Average Seq Length
197 140 394 275

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0111669|Ga0501072_0111669_689_1624
Length 311
Sequence MRLSELGELGLLRELAARGLVTQIADDAALLEGGVVVTHDTLVEGVHFRLDWTSWRDLGYKAAAVNLSDLAASAARPEALIVGLGVPGETPLERVLELYEGIAETGVPVRGGDTAAASSVTLAVTAVGRSVRVPGRGGARPGDLVVVTGPLGGSGAGFRALAAGRTGDPVVARHLRPPLRLAEGLALGEVATAMLDVSDGLGPDARHLAEASGCRLVIDLGAVPREGELEDLGFGEDYELLATTPDPLGFAIVGHVEEGAGVVLRLDGRRVELAGWEHFRRGLRRAPPVRNAPAGCWDSSSDGSSGRSACS

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
73 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
81 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
82 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
83 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
96 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
97 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 2.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.58
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 9.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0111669 3300049588 Bacteria 2176
2 Ga0070666_10212460 3300005335 Unclassified 1363
3 Ga0070680_100123360 3300005336 Bacteria 2163
4 Ga0070661_100051707 3300005344 Bacteria 3007
5 Ga0070671_100106060 3300005355 Bacteria 2358
6 Ga0070671_100484891 3300005355 Bacteria 1062
7 Ga0070659_100031878 3300005366 Bacteria 4085
8 Ga0070667_100009068 3300005367 Bacteria 8233
9 Ga0070714_100402247 3300005435 Unclassified 1294
10 Ga0070710_10198094 3300005437 Unclassified 1266
11 Ga0070708_100156788 3300005445 Bacteria 2120
12 Ga0070663_100060144 3300005455 Bacteria 2732
13 Ga0070681_10142897 3300005458 Bacteria 2322
14 Ga0070707_100154245 3300005468 Bacteria 2237
15 Ga0070679_100088585 3300005530 Bacteria 3082
16 Ga0070679_100271258 3300005530 Bacteria 1651
17 Ga0070684_100029427 3300005535 Bacteria 4654
18 Ga0070684_100051038 3300005535 Bacteria 3593
19 Ga0068853_100025861 3300005539 Bacteria 4927
20 Ga0070686_100172900 3300005544 Bacteria 1529
21 Ga0070696_100022984 3300005546 Bacteria 4239
22 Ga0070693_100003652 3300005547 Bacteria 7186
23 Ga0068856_100132380 3300005614 Bacteria 2499
24 Ga0068856_100231593 3300005614 Bacteria 1863
25 Ga0068856_100606158 3300005614 Unclassified 1116
26 Ga0068852_100003964 3300005616 Bacteria 10400
27 Ga0068852_100328766 3300005616 Bacteria 1487
28 Ga0081455_10016478 3300005937 Bacteria 7133
29 Ga0081455_10082677 3300005937 Bacteria 2626
30 Ga0081538_10000053 3300005981 Bacteria 109213
31 Ga0081539_10000095 3300005985 Bacteria 204474
32 Ga0075432_10017389 3300006058 Bacteria 2452
33 Ga0070715_10143714 3300006163 Unclassified 1162
34 Ga0070716_100130761 3300006173 Bacteria 1586
35 Ga0070712_100093581 3300006175 Bacteria 2206
36 Ga0097621_100023026 3300006237 Bacteria 4844
37 Ga0068871_100203563 3300006358 Bacteria 1710
38 Ga0075428_100193208 3300006844 Bacteria 2201
39 Ga0075431_100091767 3300006847 Bacteria 3134
40 Ga0075429_100271159 3300006880 Bacteria 1486
41 Ga0075435_100105487 3300007076 Bacteria 2339
42 Ga0105240_10126827 3300009093 Bacteria 3065
43 Ga0105240_10166489 3300009093 Bacteria 2614
44 Ga0111539_10218574 3300009094 Bacteria 2219
45 Ga0105241_10034200 3300009174 Bacteria 3817
46 Ga0105242_10066647 3300009176 Bacteria 2974
47 Ga0105239_10422753 3300010375 Bacteria 1510
48 Ga0105239_10492773 3300010375 Unclassified 1393
49 Ga0157370_10041612 3300013104 Bacteria 4430
50 Ga0157370_10087625 3300013104 Bacteria 2924
51 Ga0157370_10168753 3300013104 Bacteria 2034
52 Ga0157369_10189203 3300013105 Bacteria 2163
53 Ga0157372_10037346 3300013307 Bacteria 5357
54 Ga0157372_10150719 3300013307 Bacteria 2684
55 Ga0157376_10161290 3300014969 Unclassified 2033
56 Ga0197907_10158308 3300020069 Bacteria 1387
57 Ga0206356_11813809 3300020070 Bacteria 3389
58 Ga0206353_10056031 3300020082 Bacteria 1178
59 Ga0206353_10909771 3300020082 Bacteria 1778
60 Ga0213876_10025682 3300021384 Bacteria 3107
61 Ga0213875_10174532 3300021388 Bacteria 1010
62 Ga0207699_10323335 3300025906 Unclassified 1083
63 Ga0207705_10039283 3300025909 Bacteria 3391
64 Ga0207707_10063650 3300025912 Bacteria 3210
65 Ga0207695_10149164 3300025913 Bacteria 2279
66 Ga0207695_10269358 3300025913 Bacteria 1599
67 Ga0207671_10060186 3300025914 Bacteria 2817
68 Ga0207693_10053907 3300025915 Bacteria 3155
69 Ga0207663_10006327 3300025916 Bacteria 6048
70 Ga0207657_10003082 3300025919 Bacteria 17832
71 Ga0207657_10012651 3300025919 Bacteria 8318
72 Ga0207657_10036084 3300025919 Bacteria 4427
73 Ga0207649_10107130 3300025920 Unclassified 1861
74 Ga0207652_10061304 3300025921 Bacteria 3248
75 Ga0207700_10118551 3300025928 Bacteria 2142
76 Ga0207664_10019283 3300025929 Bacteria 5038
77 Ga0207664_10355947 3300025929 Unclassified 1296
78 Ga0207644_10026770 3300025931 Bacteria 3978
79 Ga0207644_10177908 3300025931 Bacteria 1665
80 Ga0207690_10016028 3300025932 Bacteria 4555
81 Ga0207686_10065847 3300025934 Bacteria 2312
82 Ga0207665_10042364 3300025939 Bacteria 3043
83 Ga0207661_10206832 3300025944 Bacteria 1728
84 Ga0207667_10327381 3300025949 Bacteria 1564
85 Ga0207667_10335575 3300025949 Bacteria 1543
86 Ga0207678_10026124 3300026067 Bacteria 5095
87 Ga0207678_10085355 3300026067 Bacteria 2699
88 Ga0207702_10017503 3300026078 Bacteria 5929
89 Ga0207702_10216751 3300026078 Bacteria 1782
90 Ga0207674_10004721 3300026116 Bacteria 16335
91 Ga0207698_10042410 3300026142 Bacteria 3399
92 Ga0207698_10078083 3300026142 Bacteria 2657
93 Ga0207428_10009640 3300027907 Bacteria 8648
94 Ga0265326_10025946 3300028558 Bacteria 1672
95 Ga0265319_1001269 3300028563 Bacteria 15335
96 Ga0265319_1064642 3300028563 Unclassified 1181
97 Ga0265334_10013784 3300028573 Bacteria 3378
98 Ga0265338_10000924 3300028800 Bacteria 49511
99 Ga0265338_10052721 3300028800 Bacteria 3646
100 Ga0265324_10019196 3300029957 Bacteria 2464
101 Ga0265340_10115669 3300031247 Bacteria 1236
102 Ga0265327_10065542 3300031251 Bacteria 1836
103 Ga0307416_100238154 3300032002 Bacteria 1761
104 Ga0373958_0010346 3300034819 Unclassified 1555
105 Ga0373959_0010876 3300034820 Unclassified 1598
106 Ga0373939_0047316 3300035114 Bacteria 1320
107 Ga0373941_0017277 3300035115 Bacteria 1974
108 Ga0373945_0006436 3300035116 Bacteria 3788
109 Ga0373960_0003494 3300035121 Bacteria 3563
110 Ga0373946_0010077 3300035171 Bacteria 3494
111 Ga0373961_0005601 3300035241 Bacteria 3016
112 Ga0373931_0064813 3300035691 Bacteria 1978
113 Ga0395899_0065223 3300037312 Bacteria 2676
114 Ga0395900_0002559 3300037418 Bacteria 19942
115 Ga0395900_0010463 3300037418 Bacteria 9487
116 Ga0395900_0415032 3300037418 Unclassified 1308
117 Ga0395905_0012299 3300037471 Bacteria 8239
118 Ga0395905_0042772 3300037471 Bacteria 4250
119 Ga0395905_0136059 3300037471 Bacteria 2311
120 Ga0436364_0466016 3300037853 Bacteria 1408
121 Ga0395901_0000244 3300038443 Bacteria 67684
122 Ga0395901_0006074 3300038443 Bacteria 12239
123 Ga0395901_0024784 3300038443 Bacteria 6159
124 Ga0395901_0285764 3300038443 Unclassified 1713
125 Ga0436365_0432320 3300039437 Bacteria 3603
126 Ga0436365_0453926 3300039437 Bacteria 2173
127 Ga0439455_0055750 3300042012 Bacteria 1040
128 Ga0439458_0002290 3300042157 Bacteria 4698
129 Ga0466969_0030709 3300044656 Bacteria 2738
130 Ga0466972_0223440 3300044658 Bacteria 881
131 Ga0466961_0047201 3300044693 Bacteria 2754
132 Ga0466963_0001823 3300044694 Bacteria 11598
133 Ga0466963_0007555 3300044694 Bacteria 6486
134 Ga0466963_0035926 3300044694 Bacteria 3229
135 Ga0466963_0074171 3300044694 Bacteria 2294
136 Ga0466963_0075936 3300044694 Bacteria 2268
137 Ga0466963_0095718 3300044694 Unclassified 2027
138 Ga0466964_0231220 3300044706 Bacteria 902
139 Ga0466968_0019921 3300044735 Bacteria 2704
140 Ga0466968_0114691 3300044735 Bacteria 1214
141 Ga0466970_0211223 3300044765 Bacteria 1081
142 Ga0466957_0010804 3300044842 Bacteria 5250
143 Ga0466957_0087964 3300044842 Bacteria 1943
144 Ga0466959_0057460 3300045049 Bacteria 2836
145 Ga0466959_0059045 3300045049 Bacteria 2794
146 Ga0451576_0320117 3300045051 Bacteria 1623
147 Ga0466958_0005793 3300045836 Bacteria 6681
148 Ga0466958_0030206 3300045836 Bacteria 3217
149 Ga0466967_0016579 3300045976 Bacteria 5816
150 Ga0466967_0033703 3300045976 Bacteria 4338
151 Ga0466967_0054645 3300045976 Bacteria 3516
152 Ga0466967_0097864 3300045976 Bacteria 2678
153 Ga0466967_0104896 3300045976 Bacteria 2589
154 Ga0466967_0253920 3300045976 Bacteria 1680
155 Ga0466967_0560149 3300045976 Bacteria 1125
156 Ga0466967_0618759 3300045976 Unclassified 1069
157 Ga0495641_0037349 3300046461 Bacteria 2277
158 Ga0495605_0060579 3300046474 Bacteria 1814
159 Ga0495658_0018244 3300046683 Bacteria 3644
160 Ga0495614_0066655 3300048089 Bacteria 1549
161 Ga0496100_0008622 3300048903 Bacteria 5692
162 Ga0496102_0025547 3300048905 Bacteria 5259
163 Ga0496104_0186918 3300048907 Bacteria 1983
164 Ga0496106_0012516 3300048909 Bacteria 6266
165 Ga0496112_0090677 3300048915 Bacteria 3025
166 Ga0496112_0101402 3300048915 Bacteria 2848
167 Ga0496112_0520429 3300048915 Bacteria 1124
168 Ga0496113_0177229 3300048916 Bacteria 1689
169 Ga0496114_0051956 3300048917 Bacteria 3413
170 Ga0496114_0161680 3300048917 Bacteria 1948
171 Ga0496114_0214612 3300048917 Unclassified 1688
172 Ga0501037_0434357 3300049573 Bacteria 897
173 Ga0501038_0415658 3300049574 Bacteria 1038
174 Ga0501039_0023545 3300049575 Bacteria 4726
175 Ga0501040_0252361 3300049576 Bacteria 1258
176 Ga0501042_0091810 3300049578 Bacteria 2180
177 Ga0501042_0112548 3300049578 Bacteria 1960
178 Ga0501048_0027592 3300049582 Bacteria 4125
179 Ga0501067_0017611 3300049583 Bacteria 3954
180 Ga0501067_0018906 3300049583 Bacteria 3811
181 Ga0501069_0004084 3300049585 Bacteria 7529
182 Ga0501069_0028896 3300049585 Bacteria 3041
183 Ga0501070_0121391 3300049586 Bacteria 2160
184 Ga0501071_0033919 3300049587 Bacteria 3629
185 Ga0501075_0046246 3300049591 Bacteria 3269
186 Ga0501075_0072656 3300049591 Bacteria 2601
187 Ga0501076_0044362 3300049592 Bacteria 3506
188 Ga0501077_0091520 3300049593 Bacteria 1927
189 Ga0501079_0075521 3300049741 Bacteria 2606
190 Ga0501045_0014602 3300049824 Bacteria 5569
191 nmdc:mga08y16_249898_c1 3300050511 Bacteria 1833
192 nmdc:mga0n895_174357_c1 3300050512 Bacteria 2182
193 nmdc:mga0rr50_16879_c1 3300050513 Bacteria 4861
194 nmdc:mga0a205_30282_c1 3300050515 Bacteria 5181
195 Ga0501082_0056238 3300060353 Bacteria 3389
196 Ga0466962_0050909 3300061719 Bacteria 1980
197 Ga0466962_0070488 3300061719 Bacteria 1670
198 Ga0501072_0111669
199 Ga0070666_10212460
200 Ga0070680_100123360
201 Ga0070661_100051707
202 Ga0070671_100106060
203 Ga0070671_100484891
204 Ga0070659_100031878
205 Ga0070667_100009068
206 Ga0070714_100402247
207 Ga0070710_10198094
208 Ga0070708_100156788
209 Ga0070663_100060144
210 Ga0070681_10142897
211 Ga0070707_100154245
212 Ga0070679_100088585
213 Ga0070679_100271258
214 Ga0070684_100029427
215 Ga0070684_100051038
216 Ga0068853_100025861
217 Ga0070686_100172900
218 Ga0070696_100022984
219 Ga0070693_100003652
220 Ga0068856_100132380
221 Ga0068856_100231593
222 Ga0068856_100606158
223 Ga0068852_100003964
224 Ga0068852_100328766
225 Ga0081455_10016478
226 Ga0081455_10082677
227 Ga0081538_10000053
228 Ga0081539_10000095
229 Ga0075432_10017389
230 Ga0070715_10143714
231 Ga0070716_100130761
232 Ga0070712_100093581
233 Ga0097621_100023026
234 Ga0068871_100203563
235 Ga0075428_100193208
236 Ga0075431_100091767
237 Ga0075429_100271159
238 Ga0075435_100105487
239 Ga0105240_10126827
240 Ga0105240_10166489
241 Ga0111539_10218574
242 Ga0105241_10034200
243 Ga0105242_10066647
244 Ga0105239_10422753
245 Ga0105239_10492773
246 Ga0157370_10041612
247 Ga0157370_10087625
248 Ga0157370_10168753
249 Ga0157369_10189203
250 Ga0157372_10037346
251 Ga0157372_10150719
252 Ga0157376_10161290
253 Ga0197907_10158308
254 Ga0206356_11813809
255 Ga0206353_10056031
256 Ga0206353_10909771
257 Ga0213876_10025682
258 Ga0213875_10174532
259 Ga0207699_10323335
260 Ga0207705_10039283
261 Ga0207707_10063650
262 Ga0207695_10149164
263 Ga0207695_10269358
264 Ga0207671_10060186
265 Ga0207693_10053907
266 Ga0207663_10006327
267 Ga0207657_10003082
268 Ga0207657_10012651
269 Ga0207657_10036084
270 Ga0207649_10107130
271 Ga0207652_10061304
272 Ga0207700_10118551
273 Ga0207664_10019283
274 Ga0207664_10355947
275 Ga0207644_10026770
276 Ga0207644_10177908
277 Ga0207690_10016028
278 Ga0207686_10065847
279 Ga0207665_10042364
280 Ga0207661_10206832
281 Ga0207667_10327381
282 Ga0207667_10335575
283 Ga0207678_10026124
284 Ga0207678_10085355
285 Ga0207702_10017503
286 Ga0207702_10216751
287 Ga0207674_10004721
288 Ga0207698_10042410
289 Ga0207698_10078083
290 Ga0207428_10009640
291 Ga0265326_10025946
292 Ga0265319_1001269
293 Ga0265319_1064642
294 Ga0265334_10013784
295 Ga0265338_10000924
296 Ga0265338_10052721
297 Ga0265324_10019196
298 Ga0265340_10115669
299 Ga0265327_10065542
300 Ga0307416_100238154
301 Ga0373958_0010346
302 Ga0373959_0010876
303 Ga0373939_0047316
304 Ga0373941_0017277
305 Ga0373945_0006436
306 Ga0373960_0003494
307 Ga0373946_0010077
308 Ga0373961_0005601
309 Ga0373931_0064813
310 Ga0395899_0065223
311 Ga0395900_0002559
312 Ga0395900_0010463
313 Ga0395900_0415032
314 Ga0395905_0012299
315 Ga0395905_0042772
316 Ga0395905_0136059
317 Ga0436364_0466016
318 Ga0395901_0000244
319 Ga0395901_0006074
320 Ga0395901_0024784
321 Ga0395901_0285764
322 Ga0436365_0432320
323 Ga0436365_0453926
324 Ga0439455_0055750
325 Ga0439458_0002290
326 Ga0466969_0030709
327 Ga0466972_0223440
328 Ga0466961_0047201
329 Ga0466963_0001823
330 Ga0466963_0007555
331 Ga0466963_0035926
332 Ga0466963_0074171
333 Ga0466963_0075936
334 Ga0466963_0095718
335 Ga0466964_0231220
336 Ga0466968_0019921
337 Ga0466968_0114691
338 Ga0466970_0211223
339 Ga0466957_0010804
340 Ga0466957_0087964
341 Ga0466959_0057460
342 Ga0466959_0059045
343 Ga0451576_0320117
344 Ga0466958_0005793
345 Ga0466958_0030206
346 Ga0466967_0016579
347 Ga0466967_0033703
348 Ga0466967_0054645
349 Ga0466967_0097864
350 Ga0466967_0104896
351 Ga0466967_0253920
352 Ga0466967_0560149
353 Ga0466967_0618759
354 Ga0495641_0037349
355 Ga0495605_0060579
356 Ga0495658_0018244
357 Ga0495614_0066655
358 Ga0496100_0008622
359 Ga0496102_0025547
360 Ga0496104_0186918
361 Ga0496106_0012516
362 Ga0496112_0090677
363 Ga0496112_0101402
364 Ga0496112_0520429
365 Ga0496113_0177229
366 Ga0496114_0051956
367 Ga0496114_0161680
368 Ga0496114_0214612
369 Ga0501037_0434357
370 Ga0501038_0415658
371 Ga0501039_0023545
372 Ga0501040_0252361
373 Ga0501042_0091810
374 Ga0501042_0112548
375 Ga0501048_0027592
376 Ga0501067_0017611
377 Ga0501067_0018906
378 Ga0501069_0004084
379 Ga0501069_0028896
380 Ga0501070_0121391
381 Ga0501071_0033919
382 Ga0501075_0046246
383 Ga0501075_0072656
384 Ga0501076_0044362
385 Ga0501077_0091520
386 Ga0501079_0075521
387 Ga0501045_0014602
388 nmdc:mga08y16_249898_c1
389 nmdc:mga0n895_174357_c1
390 nmdc:mga0rr50_16879_c1
391 nmdc:mga0a205_30282_c1
392 Ga0501082_0056238
393 Ga0466962_0050909
394 Ga0466962_0070488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

25

130

0.88

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

140

270

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9s-assembly1.cif.gz_B aathil complexed with amppcp 0.9188 1 260
1vqv-assembly1.cif.gz_B crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus 0.9009 1 262
6mfm-assembly1.cif.gz_A structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form 0.8862 27 270
1vqv-assembly1.cif.gz_A crystal structure of thiamine monophosphate kinase (thil) from aquifex aeolicus 0.8768 1 262
3c9s-assembly1.cif.gz_B aathil complexed with amppcp 0.8554 1 260
ID Description Score Start End Superfamily
1yawA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8923 2 133 3.30.1330.10
af_Q60337_1_142_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.885 8 130 3.30.1330.10
1yawA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8796 2 133 3.30.1330.10
2yxzD01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8693 2 131 3.30.1330.10
af_P0AGG0_145_323_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.8574 136 270 3.90.650.10
ID Description Score Start End GO Terms
AF-A0A538BVZ3-F1-model_v4 Thiamine-monophosphate kinase 0.9925 1 196 GO:0009030
GO:0009228
AF-A0A7W1N599-F1-model_v4 Thiamine-phosphate kinase 0.9915 154 270 GO:0016301
AF-A0A538KUP6-F1-model_v4 Thiamine-monophosphate kinase (TMP kinase) (Thiamine-phosphate kinase) (EC 2.7.4.16) 0.9905 1 270 GO:0000287
GO:0005524
GO:0009030
GO:0009228
GO:0009229
AF-A0A538BVZ3-F1-model_v4 Thiamine-monophosphate kinase 0.9875 1 196 GO:0009030
GO:0009228
AF-A0A537W4F2-F1-model_v4 Thiamine-phosphate kinase 0.9843 62 182 GO:0009030
GO:0009228

Map