F303406

General Info

Members Datasets Scaffolds Average Seq Length
197 144 394 158

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_1465095|Ga0466967_1465095_166_627
Length 153
Sequence VVEVRPAEEGDRRAIAELFAAVAEERDGIAAEPPVDRERIEARTDLERTLVAVSGDEILGFLFVVEHFGCGELGMMVARDRRGRGVGSALIATTIDWARGRGLHKLALSVFPHNAAALALYRKFGFVEEGRHVKHMRRANGELWDLIDMGLLL

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
43 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
47 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
51 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
52 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 2.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 6.6
Rhizosphere 92.39
Stem 0
Stem Tuber 0
Unclassified 14.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_1465095 3300045976 Unclassified 680
2 Ga0070682_100869504 3300005337 Bacteria 738
3 Ga0070660_100805606 3300005339 Unclassified 790
4 Ga0070674_100283853 3300005356 Bacteria 1313
5 Ga0070659_100610940 3300005366 Unclassified 938
6 Ga0070703_10230819 3300005406 Unclassified 741
7 Ga0070709_10055828 3300005434 Bacteria 2495
8 Ga0070709_10177287 3300005434 Bacteria 1494
9 Ga0070714_100161576 3300005435 Bacteria 2027
10 Ga0070714_100360108 3300005435 Unclassified 1367
11 Ga0070714_100627196 3300005435 Bacteria 1034
12 Ga0070713_100157817 3300005436 Bacteria 2023
13 Ga0070713_100406006 3300005436 Bacteria 1273
14 Ga0070713_100892145 3300005436 Bacteria 855
15 Ga0070711_100344219 3300005439 Bacteria 1197
16 Ga0070711_100487974 3300005439 Bacteria 1014
17 Ga0070708_100032583 3300005445 Bacteria 4522
18 Ga0070678_100524065 3300005456 Bacteria 1049
19 Ga0070681_10236065 3300005458 Bacteria 1742
20 Ga0070707_100001055 3300005468 Bacteria 27261
21 Ga0070707_100663506 3300005468 Unclassified 1006
22 Ga0070699_100332327 3300005518 Bacteria 1367
23 Ga0070679_100636372 3300005530 Bacteria 1009
24 Ga0068855_101000294 3300005563 Unclassified 879
25 Ga0081540_1003341 3300005983 Bacteria 12720
26 Ga0075365_10113011 3300006038 Bacteria 1868
27 Ga0070712_100231822 3300006175 Bacteria 1467
28 Ga0070712_100389529 3300006175 Unclassified 1149
29 Ga0075434_100894163 3300006871 Unclassified 903
30 Ga0075436_100406835 3300006914 Unclassified 986
31 Ga0105240_10182514 3300009093 Unclassified 2475
32 Ga0105245_10111054 3300009098 Bacteria 2549
33 Ga0114129_10156217 3300009147 Bacteria 3119
34 Ga0105248_11805825 3300009177 Bacteria 693
35 Ga0157372_11076713 3300013307 Unclassified 930
36 Ga0206356_10565301 3300020070 Bacteria 2839
37 Ga0206354_10164120 3300020081 Bacteria 2975
38 Ga0206353_10815130 3300020082 Bacteria 5345
39 Ga0224712_10148963 3300022467 Bacteria 1036
40 Ga0207699_10020288 3300025906 Bacteria 3559
41 Ga0207693_10350551 3300025915 Bacteria 1155
42 Ga0207663_10253029 3300025916 Bacteria 1297
43 Ga0207657_10856824 3300025919 Bacteria 701
44 Ga0207657_11074264 3300025919 Unclassified 616
45 Ga0207646_10004316 3300025922 Bacteria 15512
46 Ga0207646_10266131 3300025922 Bacteria 1549
47 Ga0207687_10270925 3300025927 Unclassified 1357
48 Ga0207700_10622859 3300025928 Bacteria 961
49 Ga0207664_10183470 3300025929 Bacteria 1797
50 Ga0207664_10981218 3300025929 Bacteria 757
51 Ga0207669_11261029 3300025937 Bacteria 627
52 Ga0207683_10259526 3300026121 Bacteria 1587
53 Ga0265326_10049430 3300028558 Unclassified 1192
54 Ga0265319_1023845 3300028563 Bacteria 2211
55 Ga0265334_10011849 3300028573 Bacteria 3663
56 Ga0265318_10004990 3300028577 Bacteria 6316
57 Ga0265318_10007972 3300028577 Bacteria 4751
58 Ga0265323_10049997 3300028653 Bacteria 1487
59 Ga0265322_10003630 3300028654 Bacteria 4641
60 Ga0265338_10150142 3300028800 Bacteria 1811
61 Ga0265338_10576399 3300028800 Bacteria 785
62 Ga0265324_10117590 3300029957 Bacteria 903
63 Ga0265330_10026661 3300031235 Bacteria 2612
64 Ga0265330_10045460 3300031235 Bacteria 1936
65 Ga0265330_10101935 3300031235 Bacteria 1228
66 Ga0265332_10058943 3300031238 Bacteria 1643
67 Ga0265328_10012727 3300031239 Bacteria 3344
68 Ga0265320_10031311 3300031240 Bacteria 2733
69 Ga0265325_10215310 3300031241 Bacteria 881
70 Ga0265340_10053187 3300031247 Bacteria 1955
71 Ga0265340_10068064 3300031247 Bacteria 1691
72 Ga0265339_10159080 3300031249 Bacteria 1137
73 Ga0265331_10096735 3300031250 Bacteria 1361
74 Ga0265331_10355136 3300031250 Bacteria 656
75 Ga0307408_100118803 3300031548 Bacteria 2045
76 Ga0265313_10063321 3300031595 Bacteria 1724
77 Ga0265314_10481004 3300031711 Bacteria 656
78 Ga0265342_10031061 3300031712 Bacteria 3305
79 Ga0265342_10036826 3300031712 Bacteria 2986
80 Ga0265342_10347198 3300031712 Bacteria 773
81 Ga0307405_10046740 3300031731 Bacteria 2662
82 Ga0307407_10946002 3300031903 Unclassified 663
83 Ga0307412_10831356 3300031911 Unclassified 804
84 Ga0307409_100151133 3300031995 Bacteria 2016
85 Ga0307409_100622792 3300031995 Unclassified 1069
86 Ga0307416_100065558 3300032002 Bacteria 2985
87 Ga0307415_100227238 3300032126 Bacteria 1500
88 Ga0373959_0083547 3300034820 Bacteria 739
89 Ga0373937_1176400 3300036401 Unclassified 715
90 Ga0373937_1696959 3300036401 Bacteria 578
91 Ga0395899_0547885 3300037312 Bacteria 744
92 Ga0395900_0317330 3300037418 Bacteria 1540
93 Ga0395900_0610841 3300037418 Bacteria 1030
94 Ga0395900_0636038 3300037418 Bacteria 1005
95 Ga0395898_0452099 3300037466 Bacteria 1223
96 Ga0395898_1297728 3300037466 Bacteria 657
97 Ga0395905_0532368 3300037471 Unclassified 1076
98 Ga0395905_1096700 3300037471 Bacteria 699
99 Ga0395901_0011216 3300038443 Bacteria 9079
100 Ga0395901_0124314 3300038443 Bacteria 2711
101 Ga0395901_0132127 3300038443 Bacteria 2623
102 Ga0395901_0321081 3300038443 Bacteria 1602
103 Ga0436363_1592981 3300039450 Bacteria 1479
104 Ga0439448_0006289 3300042005 Bacteria 3411
105 Ga0439448_0188304 3300042005 Bacteria 722
106 Ga0466966_0022497 3300044684 Bacteria 4135
107 Ga0466966_0240263 3300044684 Unclassified 1092
108 Ga0466963_0027708 3300044694 Bacteria 3631
109 Ga0466963_0037162 3300044694 Bacteria 3178
110 Ga0466963_0154643 3300044694 Bacteria 1594
111 Ga0466964_0317266 3300044706 Bacteria 791
112 Ga0466971_0013780 3300044719 Bacteria 3554
113 Ga0466968_0107434 3300044735 Bacteria 1252
114 Ga0466970_0019818 3300044765 Bacteria 3491
115 Ga0466957_0020710 3300044842 Bacteria 3871
116 Ga0466959_0133492 3300045049 Bacteria 1758
117 Ga0466958_0446144 3300045836 Unclassified 837
118 Ga0466967_0003759 3300045976 Bacteria 10011
119 Ga0466967_0021271 3300045976 Bacteria 5263
120 Ga0466967_0057552 3300045976 Bacteria 3432
121 Ga0466967_0273704 3300045976 Bacteria 1618
122 Ga0466967_0496849 3300045976 Bacteria 1197
123 Ga0466967_1108633 3300045976 Bacteria 789
124 Ga0495641_0119072 3300046461 Bacteria 1178
125 Ga0495651_0789637 3300046462 Unclassified 586
126 Ga0495607_0315059 3300046501 Unclassified 732
127 Ga0495642_0305991 3300046528 Bacteria 697
128 Ga0495587_0352887 3300046536 Bacteria 820
129 Ga0495656_0209490 3300046615 Bacteria 971
130 Ga0495674_0086446 3300047319 Bacteria 2685
131 Ga0495602_0155369 3300048088 Bacteria 1792
132 Ga0496100_0024374 3300048903 Bacteria 3690
133 Ga0496101_0181569 3300048904 Bacteria 1620
134 Ga0496102_0039115 3300048905 Bacteria 4284
135 Ga0496104_0123010 3300048907 Bacteria 2491
136 Ga0496104_0952796 3300048907 Unclassified 763
137 Ga0496105_0629794 3300048908 Bacteria 830
138 Ga0496106_0043988 3300048909 Bacteria 3352
139 Ga0496107_0047745 3300048910 Bacteria 3083
140 Ga0496108_1068963 3300048911 Bacteria 687
141 Ga0496109_0992355 3300048912 Bacteria 777
142 Ga0496109_0994652 3300048912 Unclassified 776
143 Ga0496114_0063633 3300048917 Bacteria 3088
144 Ga0496115_0566127 3300048918 Bacteria 907
145 Ga0501031_0005728 3300049568 Bacteria 8099
146 Ga0501033_0312687 3300049570 Bacteria 1104
147 Ga0501036_0001841 3300049572 Bacteria 16451
148 Ga0501037_0002090 3300049573 Bacteria 14474
149 Ga0501037_0428160 3300049573 Bacteria 905
150 Ga0501038_0034751 3300049574 Bacteria 4430
151 Ga0501038_0047242 3300049574 Bacteria 3729
152 Ga0501039_0057583 3300049575 Bacteria 3009
153 Ga0501040_0004043 3300049576 Bacteria 9534
154 Ga0501040_0025649 3300049576 Bacteria 3964
155 Ga0501041_0012099 3300049577 Bacteria 5108
156 Ga0501042_0001476 3300049578 Bacteria 13871
157 Ga0501043_0081675 3300049579 Bacteria 2540
158 Ga0501043_0173269 3300049579 Bacteria 1683
159 Ga0501046_0012196 3300049580 Bacteria 7324
160 Ga0501047_0214734 3300049581 Bacteria 1781
161 Ga0501047_0486152 3300049581 Bacteria 1062
162 Ga0501048_0050511 3300049582 Bacteria 2961
163 Ga0501068_0004247 3300049584 Bacteria 7776
164 Ga0501070_0010759 3300049586 Bacteria 7732
165 Ga0501070_0952525 3300049586 Bacteria 667
166 Ga0501071_0003099 3300049587 Bacteria 10316
167 Ga0501072_0056099 3300049588 Bacteria 3104
168 Ga0501073_0061394 3300049589 Bacteria 2623
169 Ga0501073_0724102 3300049589 Bacteria 686
170 Ga0501074_0002228 3300049590 Bacteria 13449
171 Ga0501074_0320312 3300049590 Bacteria 1101
172 Ga0501075_0104434 3300049591 Bacteria 2153
173 Ga0501076_0055469 3300049592 Bacteria 3142
174 Ga0501077_0029680 3300049593 Bacteria 3477
175 Ga0501077_0088667 3300049593 Bacteria 1960
176 Ga0501079_0007982 3300049741 Bacteria 8021
177 Ga0501080_0022880 3300049742 Bacteria 5794
178 Ga0501080_0048868 3300049742 Bacteria 3936
179 Ga0501081_0046358 3300049743 Bacteria 2987
180 Ga0501081_0277046 3300049743 Bacteria 1227
181 Ga0501083_0043215 3300049744 Bacteria 3053
182 Ga0501035_0050352 3300049822 Bacteria 3733
183 Ga0501044_0496125 3300049823 Bacteria 1123
184 Ga0501045_0030644 3300049824 Bacteria 3893
185 nmdc:mga05p37_892562_c1 3300050507 Bacteria 960
186 nmdc:mga09592_200762_c1 3300050508 Bacteria 1727
187 nmdc:mga06r32_106792_c1 3300050510 Bacteria 2751
188 nmdc:mga0n895_818977_c1 3300050512 Unclassified 920
189 nmdc:mga08x19_51124_c1 3300050514 Bacteria 2654
190 nmdc:mga08x19_519357_c1 3300050514 Unclassified 841
191 nmdc:mga0a205_31854_c1 3300050515 Bacteria 5054
192 Ga0495619_0052759 3300053085 Unclassified 2689
193 Ga0501084_0057500 3300054114 Bacteria 3254
194 Ga0501084_0147693 3300054114 Bacteria 1980
195 Ga0501082_0013856 3300060353 Bacteria 6932
196 Ga0466962_0017613 3300061719 Bacteria 3439
197 Ga0530510_0002505 3300061734 Bacteria 12623
198 Ga0466967_1465095
199 Ga0070682_100869504
200 Ga0070660_100805606
201 Ga0070674_100283853
202 Ga0070659_100610940
203 Ga0070703_10230819
204 Ga0070709_10055828
205 Ga0070709_10177287
206 Ga0070714_100161576
207 Ga0070714_100360108
208 Ga0070714_100627196
209 Ga0070713_100157817
210 Ga0070713_100406006
211 Ga0070713_100892145
212 Ga0070711_100344219
213 Ga0070711_100487974
214 Ga0070708_100032583
215 Ga0070678_100524065
216 Ga0070681_10236065
217 Ga0070707_100001055
218 Ga0070707_100663506
219 Ga0070699_100332327
220 Ga0070679_100636372
221 Ga0068855_101000294
222 Ga0081540_1003341
223 Ga0075365_10113011
224 Ga0070712_100231822
225 Ga0070712_100389529
226 Ga0075434_100894163
227 Ga0075436_100406835
228 Ga0105240_10182514
229 Ga0105245_10111054
230 Ga0114129_10156217
231 Ga0105248_11805825
232 Ga0157372_11076713
233 Ga0206356_10565301
234 Ga0206354_10164120
235 Ga0206353_10815130
236 Ga0224712_10148963
237 Ga0207699_10020288
238 Ga0207693_10350551
239 Ga0207663_10253029
240 Ga0207657_10856824
241 Ga0207657_11074264
242 Ga0207646_10004316
243 Ga0207646_10266131
244 Ga0207687_10270925
245 Ga0207700_10622859
246 Ga0207664_10183470
247 Ga0207664_10981218
248 Ga0207669_11261029
249 Ga0207683_10259526
250 Ga0265326_10049430
251 Ga0265319_1023845
252 Ga0265334_10011849
253 Ga0265318_10004990
254 Ga0265318_10007972
255 Ga0265323_10049997
256 Ga0265322_10003630
257 Ga0265338_10150142
258 Ga0265338_10576399
259 Ga0265324_10117590
260 Ga0265330_10026661
261 Ga0265330_10045460
262 Ga0265330_10101935
263 Ga0265332_10058943
264 Ga0265328_10012727
265 Ga0265320_10031311
266 Ga0265325_10215310
267 Ga0265340_10053187
268 Ga0265340_10068064
269 Ga0265339_10159080
270 Ga0265331_10096735
271 Ga0265331_10355136
272 Ga0307408_100118803
273 Ga0265313_10063321
274 Ga0265314_10481004
275 Ga0265342_10031061
276 Ga0265342_10036826
277 Ga0265342_10347198
278 Ga0307405_10046740
279 Ga0307407_10946002
280 Ga0307412_10831356
281 Ga0307409_100151133
282 Ga0307409_100622792
283 Ga0307416_100065558
284 Ga0307415_100227238
285 Ga0373959_0083547
286 Ga0373937_1176400
287 Ga0373937_1696959
288 Ga0395899_0547885
289 Ga0395900_0317330
290 Ga0395900_0610841
291 Ga0395900_0636038
292 Ga0395898_0452099
293 Ga0395898_1297728
294 Ga0395905_0532368
295 Ga0395905_1096700
296 Ga0395901_0011216
297 Ga0395901_0124314
298 Ga0395901_0132127
299 Ga0395901_0321081
300 Ga0436363_1592981
301 Ga0439448_0006289
302 Ga0439448_0188304
303 Ga0466966_0022497
304 Ga0466966_0240263
305 Ga0466963_0027708
306 Ga0466963_0037162
307 Ga0466963_0154643
308 Ga0466964_0317266
309 Ga0466971_0013780
310 Ga0466968_0107434
311 Ga0466970_0019818
312 Ga0466957_0020710
313 Ga0466959_0133492
314 Ga0466958_0446144
315 Ga0466967_0003759
316 Ga0466967_0021271
317 Ga0466967_0057552
318 Ga0466967_0273704
319 Ga0466967_0496849
320 Ga0466967_1108633
321 Ga0495641_0119072
322 Ga0495651_0789637
323 Ga0495607_0315059
324 Ga0495642_0305991
325 Ga0495587_0352887
326 Ga0495656_0209490
327 Ga0495674_0086446
328 Ga0495602_0155369
329 Ga0496100_0024374
330 Ga0496101_0181569
331 Ga0496102_0039115
332 Ga0496104_0123010
333 Ga0496104_0952796
334 Ga0496105_0629794
335 Ga0496106_0043988
336 Ga0496107_0047745
337 Ga0496108_1068963
338 Ga0496109_0992355
339 Ga0496109_0994652
340 Ga0496114_0063633
341 Ga0496115_0566127
342 Ga0501031_0005728
343 Ga0501033_0312687
344 Ga0501036_0001841
345 Ga0501037_0002090
346 Ga0501037_0428160
347 Ga0501038_0034751
348 Ga0501038_0047242
349 Ga0501039_0057583
350 Ga0501040_0004043
351 Ga0501040_0025649
352 Ga0501041_0012099
353 Ga0501042_0001476
354 Ga0501043_0081675
355 Ga0501043_0173269
356 Ga0501046_0012196
357 Ga0501047_0214734
358 Ga0501047_0486152
359 Ga0501048_0050511
360 Ga0501068_0004247
361 Ga0501070_0010759
362 Ga0501070_0952525
363 Ga0501071_0003099
364 Ga0501072_0056099
365 Ga0501073_0061394
366 Ga0501073_0724102
367 Ga0501074_0002228
368 Ga0501074_0320312
369 Ga0501075_0104434
370 Ga0501076_0055469
371 Ga0501077_0029680
372 Ga0501077_0088667
373 Ga0501079_0007982
374 Ga0501080_0022880
375 Ga0501080_0048868
376 Ga0501081_0046358
377 Ga0501081_0277046
378 Ga0501083_0043215
379 Ga0501035_0050352
380 Ga0501044_0496125
381 Ga0501045_0030644
382 nmdc:mga05p37_892562_c1
383 nmdc:mga09592_200762_c1
384 nmdc:mga06r32_106792_c1
385 nmdc:mga0n895_818977_c1
386 nmdc:mga08x19_51124_c1
387 nmdc:mga08x19_519357_c1
388 nmdc:mga0a205_31854_c1
389 Ga0495619_0052759
390 Ga0501084_0057500
391 Ga0501084_0147693
392 Ga0501082_0013856
393 Ga0466962_0017613
394 Ga0530510_0002505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

21

139

0.83

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

12

126

0.8

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

45

128

0.8

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

2

127

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ge3-assembly1.cif.gz_B crystal structure of probable acetyltransferase from agrobacterium tumefaciens 0.9204 2 153
2ge3-assembly1.cif.gz_B crystal structure of probable acetyltransferase from agrobacterium tumefaciens 0.9089 2 153
4mbu-assembly1.cif.gz_A crystal structure of n-acetyltransferase from staphylococcus aureus mu50 0.9056 2 152
5wph-assembly1.cif.gz_A crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 0.8992 2 152
3c26-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase (np_394282.1) from thermoplasma acidophilum at 2.00 a resolution 0.899 47 133
ID Description Score Start End Superfamily
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.947 104 153 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9392 87 153 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9386 48 130 3.40.630.30
1y9kD01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9271 48 127 3.40.630.30
af_E7F6N3_74_217_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9236 48 127 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7W0P966-F1-model_v4 GNAT family N-acetyltransferase 0.99 2 153 GO:0016747
AF-A0A1Q8BPD3-F1-model_v4 N-acetyltransferase domain-containing protein 0.9832 2 122 GO:0016747
AF-A0A1Y3T8M7-F1-model_v4 GNAT family N-acetyltransferase 0.9815 48 153 GO:0016747
AF-A0A7W0P966-F1-model_v4 GNAT family N-acetyltransferase 0.9772 2 153 GO:0016747
AF-A0A7V6NJV5-F1-model_v4 GNAT family N-acetyltransferase 0.9707 50 153 GO:0016747

Map