F303375

General Info

Members Datasets Scaffolds Average Seq Length
197 89 394 262

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0065343|Ga0466963_0065343_1374_2195
Length 273
Sequence VGGARADAEDLTESVPDPETIYARTREEGMRRLQRPFLEEASTALAAGFDIVAGIVVLALFTSELQHHFGKHAAHVAGSLGFGIGFVFLIVGRGELFTENFLVPIAGIERRNGDSFRNLLKLWLVSPFFNIIGGLVIILILSTHSVLPYGTGAAMVDLGETVHANGVLALFMSAVFAGALITAMTWFVEGQTSMLVRAVVAWIAGAMLALGSFNHVIVVTLELIFGYRYGAHYPWLFILGNFGLAAAGNMVGGVGLVTLNRLTQGTQGGRKQA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
14 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
19 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
30 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
31 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
32 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
33 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
34 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
35 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
36 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
37 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
38 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
39 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
40 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
41 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
42 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
43 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
44 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
45 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
46 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
47 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
48 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
53 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
54 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
55 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
56 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
57 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
58 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
70 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
71 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
72 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
75 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
76 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
77 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
78 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
79 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
80 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
83 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
84 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
86 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
87 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
88 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
89 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 1.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.05
Rhizosphere 96.45
Stem 0
Stem Tuber 0
Unclassified 3.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0065343 3300044694 Bacteria 2439
2 rootH2_10074497 3300003320 Bacteria 1513
3 Ga0070658_10005202 3300005327 Bacteria 10585
4 Ga0070658_10017933 3300005327 Bacteria 5662
5 Ga0070682_100057699 3300005337 Bacteria 2447
6 Ga0070682_100449902 3300005337 Bacteria 986
7 Ga0070660_100033121 3300005339 Bacteria 3893
8 Ga0070661_100438225 3300005344 Unclassified 1038
9 Ga0070659_100213718 3300005366 Bacteria 1590
10 Ga0070714_100036042 3300005435 Bacteria 4147
11 Ga0070714_100075971 3300005435 Bacteria 2916
12 Ga0070714_100526908 3300005435 Bacteria 1129
13 Ga0070681_10016448 3300005458 Bacteria 7385
14 Ga0070681_10041373 3300005458 Bacteria 4619
15 Ga0070681_10088497 3300005458 Bacteria 3048
16 Ga0070684_100167332 3300005535 Bacteria 1996
17 Ga0068856_100431640 3300005614 Bacteria 1338
18 Ga0105245_10106262 3300009098 Bacteria 2604
19 Ga0157373_10213541 3300013100 Bacteria 1360
20 Ga0157370_10005371 3300013104 Bacteria 14387
21 Ga0157369_10049605 3300013105 Bacteria 4550
22 Ga0157369_10291237 3300013105 Bacteria 1700
23 Ga0157374_10366206 3300013296 Bacteria 1434
24 Ga0157372_10166177 3300013307 Bacteria 2552
25 Ga0157372_10312864 3300013307 Bacteria 1828
26 Ga0206356_11773131 3300020070 Bacteria 1529
27 Ga0224712_10040384 3300022467 Bacteria 1755
28 Ga0207705_10028113 3300025909 Bacteria 4009
29 Ga0207705_10210610 3300025909 Bacteria 1474
30 Ga0207707_10026815 3300025912 Bacteria 5035
31 Ga0207707_10032878 3300025912 Bacteria 4540
32 Ga0207707_10205401 3300025912 Bacteria 1717
33 Ga0207660_10007336 3300025917 Bacteria 7134
34 Ga0207657_10044074 3300025919 Bacteria 3925
35 Ga0207657_10139234 3300025919 Bacteria 1984
36 Ga0207652_10021083 3300025921 Bacteria 5375
37 Ga0207652_10038234 3300025921 Bacteria 4066
38 Ga0207664_10016236 3300025929 Bacteria 5427
39 Ga0207664_10609323 3300025929 Unclassified 981
40 Ga0207661_10036735 3300025944 Bacteria 3826
41 Ga0207639_10360428 3300026041 Unclassified 1301
42 Ga0207702_10174273 3300026078 Bacteria 1975
43 Ga0307408_100923867 3300031548 Unclassified 800
44 Ga0307405_10396806 3300031731 Bacteria 1079
45 Ga0307409_100656043 3300031995 Bacteria 1044
46 Ga0307416_100270688 3300032002 Bacteria 1667
47 Ga0395900_0114051 3300037418 Bacteria 2773
48 Ga0395900_0120582 3300037418 Bacteria 2691
49 Ga0395900_0304217 3300037418 Archaea 1580
50 Ga0395900_0552681 3300037418 Bacteria 1096
51 Ga0395898_0136630 3300037466 Bacteria 2347
52 Ga0395898_0195899 3300037466 Bacteria 1930
53 Ga0395898_0196435 3300037466 Bacteria 1927
54 Ga0395898_0361493 3300037466 Bacteria 1384
55 Ga0395905_0078626 3300037471 Bacteria 3091
56 Ga0395905_0127104 3300037471 Bacteria 2397
57 Ga0395901_0069569 3300038443 Bacteria 3666
58 Ga0395901_0080966 3300038443 Bacteria 3391
59 Ga0395901_0109927 3300038443 Bacteria 2894
60 Ga0436360_0097925 3300039438 Bacteria 3836
61 Ga0466969_0108144 3300044656 Bacteria 1304
62 Ga0466969_0162048 3300044656 Bacteria 1027
63 Ga0466972_0022155 3300044658 Archaea 3164
64 Ga0466965_0024369 3300044683 Bacteria 2927
65 Ga0466965_0048596 3300044683 Bacteria 2102
66 Ga0466966_0031483 3300044684 Bacteria 3439
67 Ga0466966_0068414 3300044684 Bacteria 2229
68 Ga0466966_0103698 3300044684 Bacteria 1757
69 Ga0466961_0004356 3300044693 Bacteria 8868
70 Ga0466961_0035638 3300044693 Bacteria 3194
71 Ga0466961_0051090 3300044693 Bacteria 2641
72 Ga0466961_0073029 3300044693 Bacteria 2175
73 Ga0466961_0113359 3300044693 Bacteria 1705
74 Ga0466963_0002070 3300044694 Bacteria 11073
75 Ga0466963_0003318 3300044694 Bacteria 9185
76 Ga0466963_0004774 3300044694 Bacteria 7905
77 Ga0466963_0011334 3300044694 Bacteria 5426
78 Ga0466963_0016143 3300044694 Bacteria 4640
79 Ga0466963_0017302 3300044694 Bacteria 4492
80 Ga0466963_0044561 3300044694 Bacteria 2920
81 Ga0466963_0044562 3300044694 Bacteria 2920
82 Ga0466963_0045356 3300044694 Bacteria 2895
83 Ga0466963_0051693 3300044694 Bacteria 2724
84 Ga0466963_0089768 3300044694 Bacteria 2091
85 Ga0466963_0117448 3300044694 Bacteria 1828
86 Ga0466963_0152707 3300044694 Bacteria 1604
87 Ga0466963_0160864 3300044694 Unclassified 1562
88 Ga0466963_0167930 3300044694 Bacteria 1529
89 Ga0466964_0006485 3300044706 Bacteria 4365
90 Ga0466964_0010681 3300044706 Bacteria 3465
91 Ga0466964_0014355 3300044706 Bacteria 3011
92 Ga0466964_0019947 3300044706 Bacteria 2579
93 Ga0466964_0079100 3300044706 Bacteria 1407
94 Ga0466971_0005687 3300044719 Bacteria 5419
95 Ga0466971_0016331 3300044719 Bacteria 3274
96 Ga0466971_0064122 3300044719 Bacteria 1663
97 Ga0466971_0114824 3300044719 Bacteria 1244
98 Ga0466968_0005598 3300044735 Bacteria 4704
99 Ga0466968_0007814 3300044735 Bacteria 4080
100 Ga0466968_0045004 3300044735 Bacteria 1872
101 Ga0466968_0048431 3300044735 Bacteria 1809
102 Ga0466970_0052038 3300044765 Bacteria 2186
103 Ga0466957_0002192 3300044842 Bacteria 10466
104 Ga0466957_0003070 3300044842 Bacteria 9085
105 Ga0466957_0055200 3300044842 Bacteria 2427
106 Ga0466957_0075663 3300044842 Bacteria 2089
107 Ga0466957_0086198 3300044842 Bacteria 1962
108 Ga0466957_0116265 3300044842 Bacteria 1701
109 Ga0466957_0153009 3300044842 Bacteria 1493
110 Ga0466957_0184544 3300044842 Bacteria 1363
111 Ga0466960_0007712 3300044901 Bacteria 4385
112 Ga0466960_0050452 3300044901 Bacteria 2006
113 Ga0466959_0009817 3300045049 Bacteria 6819
114 Ga0466959_0033108 3300045049 Bacteria 3824
115 Ga0466959_0155212 3300045049 Bacteria 1611
116 Ga0466958_0003000 3300045836 Bacteria 8652
117 Ga0466958_0008293 3300045836 Bacteria 5753
118 Ga0466958_0018881 3300045836 Bacteria 4007
119 Ga0466958_0026104 3300045836 Bacteria 3450
120 Ga0466958_0038869 3300045836 Bacteria 2856
121 Ga0466958_0065486 3300045836 Bacteria 2217
122 Ga0466958_0079680 3300045836 Bacteria 2014
123 Ga0466958_0105944 3300045836 Bacteria 1753
124 Ga0466958_0151337 3300045836 Bacteria 1463
125 Ga0466967_0002719 3300045976 Bacteria 11183
126 Ga0466967_0026905 3300045976 Bacteria 4775
127 Ga0466967_0041122 3300045976 Bacteria 3982
128 Ga0466967_0048946 3300045976 Bacteria 3694
129 Ga0466967_0056249 3300045976 Bacteria 3468
130 Ga0466967_0058027 3300045976 Bacteria 3419
131 Ga0466967_0064059 3300045976 Bacteria 3268
132 Ga0466967_0078694 3300045976 Bacteria 2971
133 Ga0466967_0130873 3300045976 Bacteria 2329
134 Ga0466967_0131780 3300045976 Bacteria 2321
135 Ga0466967_0136383 3300045976 Bacteria 2282
136 Ga0466967_0137452 3300045976 Bacteria 2273
137 Ga0466967_0141085 3300045976 Bacteria 2244
138 Ga0466967_0161541 3300045976 Bacteria 2103
139 Ga0466967_0194672 3300045976 Bacteria 1917
140 Ga0496104_0081129 3300048907 Bacteria 3093
141 Ga0496109_0357835 3300048912 Bacteria 1379
142 Ga0496110_0021021 3300048913 Bacteria 5516
143 Ga0496111_0151490 3300048914 Bacteria 1720
144 Ga0496112_0736861 3300048915 Bacteria 912
145 Ga0496114_0268274 3300048917 Bacteria 1504
146 Ga0501031_0004975 3300049568 Bacteria 8642
147 Ga0501033_0072840 3300049570 Bacteria 2522
148 Ga0501034_0031935 3300049571 Bacteria 5349
149 Ga0501034_0671530 3300049571 Bacteria 936
150 Ga0501036_0002024 3300049572 Bacteria 15775
151 Ga0501038_0006336 3300049574 Bacteria 10949
152 Ga0501039_0010802 3300049575 Bacteria 6955
153 Ga0501040_0001032 3300049576 Bacteria 17675
154 Ga0501042_0001595 3300049578 Bacteria 13472
155 Ga0501046_0174182 3300049580 Bacteria 1613
156 Ga0501047_0248316 3300049581 Bacteria 1628
157 Ga0501047_0292105 3300049581 Bacteria 1474
158 Ga0501048_0002453 3300049582 Bacteria 14144
159 Ga0501067_0037340 3300049583 Bacteria 2698
160 Ga0501067_0044145 3300049583 Bacteria 2477
161 Ga0501068_0038922 3300049584 Bacteria 2850
162 Ga0501068_0285188 3300049584 Unclassified 1056
163 Ga0501069_0024715 3300049585 Bacteria 3278
164 Ga0501069_0151406 3300049585 Bacteria 1333
165 Ga0501070_0002653 3300049586 Bacteria 15605
166 Ga0501070_0314010 3300049586 Bacteria 1275
167 Ga0501070_0425995 3300049586 Bacteria 1071
168 Ga0501071_0000342 3300049587 Bacteria 22658
169 Ga0501072_0003887 3300049588 Bacteria 11297
170 Ga0501072_0008708 3300049588 Bacteria 7703
171 Ga0501073_0011489 3300049589 Bacteria 6477
172 Ga0501074_0009479 3300049590 Bacteria 7070
173 Ga0501074_0014253 3300049590 Bacteria 5781
174 Ga0501074_0020414 3300049590 Bacteria 4815
175 Ga0501075_0000158 3300049591 Bacteria 34420
176 Ga0501076_0003049 3300049592 Bacteria 11654
177 Ga0501077_0015915 3300049593 Bacteria 4738
178 Ga0501079_0013985 3300049741 Bacteria 6120
179 Ga0501079_0021519 3300049741 Bacteria 4932
180 Ga0501080_0016194 3300049742 Bacteria 6883
181 Ga0501080_0041342 3300049742 Bacteria 4296
182 Ga0501080_0512182 3300049742 Bacteria 1071
183 Ga0501081_0002477 3300049743 Bacteria 11633
184 Ga0501083_0000892 3300049744 Bacteria 19786
185 Ga0501083_0012252 3300049744 Bacteria 6001
186 Ga0501035_0021200 3300049822 Bacteria 5973
187 Ga0501044_0204090 3300049823 Bacteria 1934
188 Ga0501084_0001219 3300054114 Bacteria 20223
189 Ga0501084_0061166 3300054114 Bacteria 3153
190 Ga0501082_0002045 3300060353 Bacteria 17742
191 Ga0466962_0000583 3300061719 Bacteria 16067
192 Ga0466962_0001789 3300061719 Bacteria 10106
193 Ga0466962_0005246 3300061719 Bacteria 6224
194 Ga0466962_0022935 3300061719 Bacteria 3000
195 Ga0466962_0026585 3300061719 Bacteria 2778
196 Ga0466962_0063850 3300061719 Bacteria 1758
197 Ga0530510_0055658 3300061734 Bacteria 2857
198 Ga0466963_0065343
199 rootH2_10074497
200 Ga0070658_10005202
201 Ga0070658_10017933
202 Ga0070682_100057699
203 Ga0070682_100449902
204 Ga0070660_100033121
205 Ga0070661_100438225
206 Ga0070659_100213718
207 Ga0070714_100036042
208 Ga0070714_100075971
209 Ga0070714_100526908
210 Ga0070681_10016448
211 Ga0070681_10041373
212 Ga0070681_10088497
213 Ga0070684_100167332
214 Ga0068856_100431640
215 Ga0105245_10106262
216 Ga0157373_10213541
217 Ga0157370_10005371
218 Ga0157369_10049605
219 Ga0157369_10291237
220 Ga0157374_10366206
221 Ga0157372_10166177
222 Ga0157372_10312864
223 Ga0206356_11773131
224 Ga0224712_10040384
225 Ga0207705_10028113
226 Ga0207705_10210610
227 Ga0207707_10026815
228 Ga0207707_10032878
229 Ga0207707_10205401
230 Ga0207660_10007336
231 Ga0207657_10044074
232 Ga0207657_10139234
233 Ga0207652_10021083
234 Ga0207652_10038234
235 Ga0207664_10016236
236 Ga0207664_10609323
237 Ga0207661_10036735
238 Ga0207639_10360428
239 Ga0207702_10174273
240 Ga0307408_100923867
241 Ga0307405_10396806
242 Ga0307409_100656043
243 Ga0307416_100270688
244 Ga0395900_0114051
245 Ga0395900_0120582
246 Ga0395900_0304217
247 Ga0395900_0552681
248 Ga0395898_0136630
249 Ga0395898_0195899
250 Ga0395898_0196435
251 Ga0395898_0361493
252 Ga0395905_0078626
253 Ga0395905_0127104
254 Ga0395901_0069569
255 Ga0395901_0080966
256 Ga0395901_0109927
257 Ga0436360_0097925
258 Ga0466969_0108144
259 Ga0466969_0162048
260 Ga0466972_0022155
261 Ga0466965_0024369
262 Ga0466965_0048596
263 Ga0466966_0031483
264 Ga0466966_0068414
265 Ga0466966_0103698
266 Ga0466961_0004356
267 Ga0466961_0035638
268 Ga0466961_0051090
269 Ga0466961_0073029
270 Ga0466961_0113359
271 Ga0466963_0002070
272 Ga0466963_0003318
273 Ga0466963_0004774
274 Ga0466963_0011334
275 Ga0466963_0016143
276 Ga0466963_0017302
277 Ga0466963_0044561
278 Ga0466963_0044562
279 Ga0466963_0045356
280 Ga0466963_0051693
281 Ga0466963_0089768
282 Ga0466963_0117448
283 Ga0466963_0152707
284 Ga0466963_0160864
285 Ga0466963_0167930
286 Ga0466964_0006485
287 Ga0466964_0010681
288 Ga0466964_0014355
289 Ga0466964_0019947
290 Ga0466964_0079100
291 Ga0466971_0005687
292 Ga0466971_0016331
293 Ga0466971_0064122
294 Ga0466971_0114824
295 Ga0466968_0005598
296 Ga0466968_0007814
297 Ga0466968_0045004
298 Ga0466968_0048431
299 Ga0466970_0052038
300 Ga0466957_0002192
301 Ga0466957_0003070
302 Ga0466957_0055200
303 Ga0466957_0075663
304 Ga0466957_0086198
305 Ga0466957_0116265
306 Ga0466957_0153009
307 Ga0466957_0184544
308 Ga0466960_0007712
309 Ga0466960_0050452
310 Ga0466959_0009817
311 Ga0466959_0033108
312 Ga0466959_0155212
313 Ga0466958_0003000
314 Ga0466958_0008293
315 Ga0466958_0018881
316 Ga0466958_0026104
317 Ga0466958_0038869
318 Ga0466958_0065486
319 Ga0466958_0079680
320 Ga0466958_0105944
321 Ga0466958_0151337
322 Ga0466967_0002719
323 Ga0466967_0026905
324 Ga0466967_0041122
325 Ga0466967_0048946
326 Ga0466967_0056249
327 Ga0466967_0058027
328 Ga0466967_0064059
329 Ga0466967_0078694
330 Ga0466967_0130873
331 Ga0466967_0131780
332 Ga0466967_0136383
333 Ga0466967_0137452
334 Ga0466967_0141085
335 Ga0466967_0161541
336 Ga0466967_0194672
337 Ga0496104_0081129
338 Ga0496109_0357835
339 Ga0496110_0021021
340 Ga0496111_0151490
341 Ga0496112_0736861
342 Ga0496114_0268274
343 Ga0501031_0004975
344 Ga0501033_0072840
345 Ga0501034_0031935
346 Ga0501034_0671530
347 Ga0501036_0002024
348 Ga0501038_0006336
349 Ga0501039_0010802
350 Ga0501040_0001032
351 Ga0501042_0001595
352 Ga0501046_0174182
353 Ga0501047_0248316
354 Ga0501047_0292105
355 Ga0501048_0002453
356 Ga0501067_0037340
357 Ga0501067_0044145
358 Ga0501068_0038922
359 Ga0501068_0285188
360 Ga0501069_0024715
361 Ga0501069_0151406
362 Ga0501070_0002653
363 Ga0501070_0314010
364 Ga0501070_0425995
365 Ga0501071_0000342
366 Ga0501072_0003887
367 Ga0501072_0008708
368 Ga0501073_0011489
369 Ga0501074_0009479
370 Ga0501074_0014253
371 Ga0501074_0020414
372 Ga0501075_0000158
373 Ga0501076_0003049
374 Ga0501077_0015915
375 Ga0501079_0013985
376 Ga0501079_0021519
377 Ga0501080_0016194
378 Ga0501080_0041342
379 Ga0501080_0512182
380 Ga0501081_0002477
381 Ga0501083_0000892
382 Ga0501083_0012252
383 Ga0501035_0021200
384 Ga0501044_0204090
385 Ga0501084_0001219
386 Ga0501084_0061166
387 Ga0501082_0002045
388 Ga0466962_0000583
389 Ga0466962_0001789
390 Ga0466962_0005246
391 Ga0466962_0022935
392 Ga0466962_0026585
393 Ga0466962_0063850
394 Ga0530510_0055658

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01226

Form_Nir_trans

Formate/nitrite transporter

20

262

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3te1-assembly1.cif.gz_B crystal structure of hsc t84a 0.8765 9 251
3tdo-assembly1.cif.gz_C crystal structure of hsc at ph 9.0 0.8562 8 252
3klz-assembly1.cif.gz_A pentameric formate channel with formate bound 0.8522 27 253
3te0-assembly1.cif.gz_C crystal structure of hsc k148e 0.8514 8 252
3tds-assembly1.cif.gz_E crystal structure of hsc f194i 0.8514 8 252
ID Description Score Start End Superfamily
af_P37327_33_270_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9175 10 242 1.20.1080.10
af_Q5A4N6_2_250_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8879 4 242 1.20.1080.10
3tdrG00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8811 9 252 1.20.1080.10
af_P37327_33_270_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.881 10 242 1.20.1080.10
af_Q2G1V0_12_273_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8625 10 251 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A538HYJ6-F1-model_v4 Formate/nitrite transporter family protein 0.9792 50 264 GO:0005886
GO:0015499
AF-A0A538HYJ6-F1-model_v4 Formate/nitrite transporter family protein 0.9703 50 264 GO:0005886
GO:0015499
AF-A0A538H7I2-F1-model_v4 Formate/nitrite transporter family protein 0.9688 1 259 GO:0005886
GO:0015499
AF-A0A7W1N6L0-F1-model_v4 Formate/nitrite transporter family protein 0.9657 2 264 GO:0005886
GO:0015499
AF-A0A1S8CE19-F1-model_v4 Transport 0.9657 1 255 GO:0005886
GO:0015499

Map