F303375
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 197 | 89 | 394 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0065343|Ga0466963_0065343_1374_2195 |
| Length | 273 |
| Sequence | VGGARADAEDLTESVPDPETIYARTREEGMRRLQRPFLEEASTALAAGFDIVAGIVVLALFTSELQHHFGKHAAHVAGSLGFGIGFVFLIVGRGELFTENFLVPIAGIERRNGDSFRNLLKLWLVSPFFNIIGGLVIILILSTHSVLPYGTGAAMVDLGETVHANGVLALFMSAVFAGALITAMTWFVEGQTSMLVRAVVAWIAGAMLALGSFNHVIVVTLELIFGYRYGAHYPWLFILGNFGLAAAGNMVGGVGLVTLNRLTQGTQGGRKQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 12 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 13 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 14 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 15 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 16 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 17 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 18 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 19 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 20 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 30 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 31 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 32 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 33 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 34 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 35 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 36 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 37 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 38 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 39 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 40 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 41 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 42 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 43 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 44 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 45 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 46 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 47 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 48 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 49 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 50 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 51 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 52 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 53 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 54 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 55 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 56 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 57 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 58 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 59 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 60 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 61 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 62 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 63 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 64 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 65 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 66 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 67 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 68 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 69 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 70 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 71 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 72 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 73 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 74 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 75 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 76 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 77 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 78 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 79 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 80 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 81 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 82 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 83 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 84 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 85 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 86 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 87 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 88 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 89 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.98 |
| Metatranscriptomes | 1.02 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.05 |
| Rhizosphere | 96.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466963_0065343 | 3300044694 | Bacteria | 2439 |
| 2 | rootH2_10074497 | 3300003320 | Bacteria | 1513 |
| 3 | Ga0070658_10005202 | 3300005327 | Bacteria | 10585 |
| 4 | Ga0070658_10017933 | 3300005327 | Bacteria | 5662 |
| 5 | Ga0070682_100057699 | 3300005337 | Bacteria | 2447 |
| 6 | Ga0070682_100449902 | 3300005337 | Bacteria | 986 |
| 7 | Ga0070660_100033121 | 3300005339 | Bacteria | 3893 |
| 8 | Ga0070661_100438225 | 3300005344 | Unclassified | 1038 |
| 9 | Ga0070659_100213718 | 3300005366 | Bacteria | 1590 |
| 10 | Ga0070714_100036042 | 3300005435 | Bacteria | 4147 |
| 11 | Ga0070714_100075971 | 3300005435 | Bacteria | 2916 |
| 12 | Ga0070714_100526908 | 3300005435 | Bacteria | 1129 |
| 13 | Ga0070681_10016448 | 3300005458 | Bacteria | 7385 |
| 14 | Ga0070681_10041373 | 3300005458 | Bacteria | 4619 |
| 15 | Ga0070681_10088497 | 3300005458 | Bacteria | 3048 |
| 16 | Ga0070684_100167332 | 3300005535 | Bacteria | 1996 |
| 17 | Ga0068856_100431640 | 3300005614 | Bacteria | 1338 |
| 18 | Ga0105245_10106262 | 3300009098 | Bacteria | 2604 |
| 19 | Ga0157373_10213541 | 3300013100 | Bacteria | 1360 |
| 20 | Ga0157370_10005371 | 3300013104 | Bacteria | 14387 |
| 21 | Ga0157369_10049605 | 3300013105 | Bacteria | 4550 |
| 22 | Ga0157369_10291237 | 3300013105 | Bacteria | 1700 |
| 23 | Ga0157374_10366206 | 3300013296 | Bacteria | 1434 |
| 24 | Ga0157372_10166177 | 3300013307 | Bacteria | 2552 |
| 25 | Ga0157372_10312864 | 3300013307 | Bacteria | 1828 |
| 26 | Ga0206356_11773131 | 3300020070 | Bacteria | 1529 |
| 27 | Ga0224712_10040384 | 3300022467 | Bacteria | 1755 |
| 28 | Ga0207705_10028113 | 3300025909 | Bacteria | 4009 |
| 29 | Ga0207705_10210610 | 3300025909 | Bacteria | 1474 |
| 30 | Ga0207707_10026815 | 3300025912 | Bacteria | 5035 |
| 31 | Ga0207707_10032878 | 3300025912 | Bacteria | 4540 |
| 32 | Ga0207707_10205401 | 3300025912 | Bacteria | 1717 |
| 33 | Ga0207660_10007336 | 3300025917 | Bacteria | 7134 |
| 34 | Ga0207657_10044074 | 3300025919 | Bacteria | 3925 |
| 35 | Ga0207657_10139234 | 3300025919 | Bacteria | 1984 |
| 36 | Ga0207652_10021083 | 3300025921 | Bacteria | 5375 |
| 37 | Ga0207652_10038234 | 3300025921 | Bacteria | 4066 |
| 38 | Ga0207664_10016236 | 3300025929 | Bacteria | 5427 |
| 39 | Ga0207664_10609323 | 3300025929 | Unclassified | 981 |
| 40 | Ga0207661_10036735 | 3300025944 | Bacteria | 3826 |
| 41 | Ga0207639_10360428 | 3300026041 | Unclassified | 1301 |
| 42 | Ga0207702_10174273 | 3300026078 | Bacteria | 1975 |
| 43 | Ga0307408_100923867 | 3300031548 | Unclassified | 800 |
| 44 | Ga0307405_10396806 | 3300031731 | Bacteria | 1079 |
| 45 | Ga0307409_100656043 | 3300031995 | Bacteria | 1044 |
| 46 | Ga0307416_100270688 | 3300032002 | Bacteria | 1667 |
| 47 | Ga0395900_0114051 | 3300037418 | Bacteria | 2773 |
| 48 | Ga0395900_0120582 | 3300037418 | Bacteria | 2691 |
| 49 | Ga0395900_0304217 | 3300037418 | Archaea | 1580 |
| 50 | Ga0395900_0552681 | 3300037418 | Bacteria | 1096 |
| 51 | Ga0395898_0136630 | 3300037466 | Bacteria | 2347 |
| 52 | Ga0395898_0195899 | 3300037466 | Bacteria | 1930 |
| 53 | Ga0395898_0196435 | 3300037466 | Bacteria | 1927 |
| 54 | Ga0395898_0361493 | 3300037466 | Bacteria | 1384 |
| 55 | Ga0395905_0078626 | 3300037471 | Bacteria | 3091 |
| 56 | Ga0395905_0127104 | 3300037471 | Bacteria | 2397 |
| 57 | Ga0395901_0069569 | 3300038443 | Bacteria | 3666 |
| 58 | Ga0395901_0080966 | 3300038443 | Bacteria | 3391 |
| 59 | Ga0395901_0109927 | 3300038443 | Bacteria | 2894 |
| 60 | Ga0436360_0097925 | 3300039438 | Bacteria | 3836 |
| 61 | Ga0466969_0108144 | 3300044656 | Bacteria | 1304 |
| 62 | Ga0466969_0162048 | 3300044656 | Bacteria | 1027 |
| 63 | Ga0466972_0022155 | 3300044658 | Archaea | 3164 |
| 64 | Ga0466965_0024369 | 3300044683 | Bacteria | 2927 |
| 65 | Ga0466965_0048596 | 3300044683 | Bacteria | 2102 |
| 66 | Ga0466966_0031483 | 3300044684 | Bacteria | 3439 |
| 67 | Ga0466966_0068414 | 3300044684 | Bacteria | 2229 |
| 68 | Ga0466966_0103698 | 3300044684 | Bacteria | 1757 |
| 69 | Ga0466961_0004356 | 3300044693 | Bacteria | 8868 |
| 70 | Ga0466961_0035638 | 3300044693 | Bacteria | 3194 |
| 71 | Ga0466961_0051090 | 3300044693 | Bacteria | 2641 |
| 72 | Ga0466961_0073029 | 3300044693 | Bacteria | 2175 |
| 73 | Ga0466961_0113359 | 3300044693 | Bacteria | 1705 |
| 74 | Ga0466963_0002070 | 3300044694 | Bacteria | 11073 |
| 75 | Ga0466963_0003318 | 3300044694 | Bacteria | 9185 |
| 76 | Ga0466963_0004774 | 3300044694 | Bacteria | 7905 |
| 77 | Ga0466963_0011334 | 3300044694 | Bacteria | 5426 |
| 78 | Ga0466963_0016143 | 3300044694 | Bacteria | 4640 |
| 79 | Ga0466963_0017302 | 3300044694 | Bacteria | 4492 |
| 80 | Ga0466963_0044561 | 3300044694 | Bacteria | 2920 |
| 81 | Ga0466963_0044562 | 3300044694 | Bacteria | 2920 |
| 82 | Ga0466963_0045356 | 3300044694 | Bacteria | 2895 |
| 83 | Ga0466963_0051693 | 3300044694 | Bacteria | 2724 |
| 84 | Ga0466963_0089768 | 3300044694 | Bacteria | 2091 |
| 85 | Ga0466963_0117448 | 3300044694 | Bacteria | 1828 |
| 86 | Ga0466963_0152707 | 3300044694 | Bacteria | 1604 |
| 87 | Ga0466963_0160864 | 3300044694 | Unclassified | 1562 |
| 88 | Ga0466963_0167930 | 3300044694 | Bacteria | 1529 |
| 89 | Ga0466964_0006485 | 3300044706 | Bacteria | 4365 |
| 90 | Ga0466964_0010681 | 3300044706 | Bacteria | 3465 |
| 91 | Ga0466964_0014355 | 3300044706 | Bacteria | 3011 |
| 92 | Ga0466964_0019947 | 3300044706 | Bacteria | 2579 |
| 93 | Ga0466964_0079100 | 3300044706 | Bacteria | 1407 |
| 94 | Ga0466971_0005687 | 3300044719 | Bacteria | 5419 |
| 95 | Ga0466971_0016331 | 3300044719 | Bacteria | 3274 |
| 96 | Ga0466971_0064122 | 3300044719 | Bacteria | 1663 |
| 97 | Ga0466971_0114824 | 3300044719 | Bacteria | 1244 |
| 98 | Ga0466968_0005598 | 3300044735 | Bacteria | 4704 |
| 99 | Ga0466968_0007814 | 3300044735 | Bacteria | 4080 |
| 100 | Ga0466968_0045004 | 3300044735 | Bacteria | 1872 |
| 101 | Ga0466968_0048431 | 3300044735 | Bacteria | 1809 |
| 102 | Ga0466970_0052038 | 3300044765 | Bacteria | 2186 |
| 103 | Ga0466957_0002192 | 3300044842 | Bacteria | 10466 |
| 104 | Ga0466957_0003070 | 3300044842 | Bacteria | 9085 |
| 105 | Ga0466957_0055200 | 3300044842 | Bacteria | 2427 |
| 106 | Ga0466957_0075663 | 3300044842 | Bacteria | 2089 |
| 107 | Ga0466957_0086198 | 3300044842 | Bacteria | 1962 |
| 108 | Ga0466957_0116265 | 3300044842 | Bacteria | 1701 |
| 109 | Ga0466957_0153009 | 3300044842 | Bacteria | 1493 |
| 110 | Ga0466957_0184544 | 3300044842 | Bacteria | 1363 |
| 111 | Ga0466960_0007712 | 3300044901 | Bacteria | 4385 |
| 112 | Ga0466960_0050452 | 3300044901 | Bacteria | 2006 |
| 113 | Ga0466959_0009817 | 3300045049 | Bacteria | 6819 |
| 114 | Ga0466959_0033108 | 3300045049 | Bacteria | 3824 |
| 115 | Ga0466959_0155212 | 3300045049 | Bacteria | 1611 |
| 116 | Ga0466958_0003000 | 3300045836 | Bacteria | 8652 |
| 117 | Ga0466958_0008293 | 3300045836 | Bacteria | 5753 |
| 118 | Ga0466958_0018881 | 3300045836 | Bacteria | 4007 |
| 119 | Ga0466958_0026104 | 3300045836 | Bacteria | 3450 |
| 120 | Ga0466958_0038869 | 3300045836 | Bacteria | 2856 |
| 121 | Ga0466958_0065486 | 3300045836 | Bacteria | 2217 |
| 122 | Ga0466958_0079680 | 3300045836 | Bacteria | 2014 |
| 123 | Ga0466958_0105944 | 3300045836 | Bacteria | 1753 |
| 124 | Ga0466958_0151337 | 3300045836 | Bacteria | 1463 |
| 125 | Ga0466967_0002719 | 3300045976 | Bacteria | 11183 |
| 126 | Ga0466967_0026905 | 3300045976 | Bacteria | 4775 |
| 127 | Ga0466967_0041122 | 3300045976 | Bacteria | 3982 |
| 128 | Ga0466967_0048946 | 3300045976 | Bacteria | 3694 |
| 129 | Ga0466967_0056249 | 3300045976 | Bacteria | 3468 |
| 130 | Ga0466967_0058027 | 3300045976 | Bacteria | 3419 |
| 131 | Ga0466967_0064059 | 3300045976 | Bacteria | 3268 |
| 132 | Ga0466967_0078694 | 3300045976 | Bacteria | 2971 |
| 133 | Ga0466967_0130873 | 3300045976 | Bacteria | 2329 |
| 134 | Ga0466967_0131780 | 3300045976 | Bacteria | 2321 |
| 135 | Ga0466967_0136383 | 3300045976 | Bacteria | 2282 |
| 136 | Ga0466967_0137452 | 3300045976 | Bacteria | 2273 |
| 137 | Ga0466967_0141085 | 3300045976 | Bacteria | 2244 |
| 138 | Ga0466967_0161541 | 3300045976 | Bacteria | 2103 |
| 139 | Ga0466967_0194672 | 3300045976 | Bacteria | 1917 |
| 140 | Ga0496104_0081129 | 3300048907 | Bacteria | 3093 |
| 141 | Ga0496109_0357835 | 3300048912 | Bacteria | 1379 |
| 142 | Ga0496110_0021021 | 3300048913 | Bacteria | 5516 |
| 143 | Ga0496111_0151490 | 3300048914 | Bacteria | 1720 |
| 144 | Ga0496112_0736861 | 3300048915 | Bacteria | 912 |
| 145 | Ga0496114_0268274 | 3300048917 | Bacteria | 1504 |
| 146 | Ga0501031_0004975 | 3300049568 | Bacteria | 8642 |
| 147 | Ga0501033_0072840 | 3300049570 | Bacteria | 2522 |
| 148 | Ga0501034_0031935 | 3300049571 | Bacteria | 5349 |
| 149 | Ga0501034_0671530 | 3300049571 | Bacteria | 936 |
| 150 | Ga0501036_0002024 | 3300049572 | Bacteria | 15775 |
| 151 | Ga0501038_0006336 | 3300049574 | Bacteria | 10949 |
| 152 | Ga0501039_0010802 | 3300049575 | Bacteria | 6955 |
| 153 | Ga0501040_0001032 | 3300049576 | Bacteria | 17675 |
| 154 | Ga0501042_0001595 | 3300049578 | Bacteria | 13472 |
| 155 | Ga0501046_0174182 | 3300049580 | Bacteria | 1613 |
| 156 | Ga0501047_0248316 | 3300049581 | Bacteria | 1628 |
| 157 | Ga0501047_0292105 | 3300049581 | Bacteria | 1474 |
| 158 | Ga0501048_0002453 | 3300049582 | Bacteria | 14144 |
| 159 | Ga0501067_0037340 | 3300049583 | Bacteria | 2698 |
| 160 | Ga0501067_0044145 | 3300049583 | Bacteria | 2477 |
| 161 | Ga0501068_0038922 | 3300049584 | Bacteria | 2850 |
| 162 | Ga0501068_0285188 | 3300049584 | Unclassified | 1056 |
| 163 | Ga0501069_0024715 | 3300049585 | Bacteria | 3278 |
| 164 | Ga0501069_0151406 | 3300049585 | Bacteria | 1333 |
| 165 | Ga0501070_0002653 | 3300049586 | Bacteria | 15605 |
| 166 | Ga0501070_0314010 | 3300049586 | Bacteria | 1275 |
| 167 | Ga0501070_0425995 | 3300049586 | Bacteria | 1071 |
| 168 | Ga0501071_0000342 | 3300049587 | Bacteria | 22658 |
| 169 | Ga0501072_0003887 | 3300049588 | Bacteria | 11297 |
| 170 | Ga0501072_0008708 | 3300049588 | Bacteria | 7703 |
| 171 | Ga0501073_0011489 | 3300049589 | Bacteria | 6477 |
| 172 | Ga0501074_0009479 | 3300049590 | Bacteria | 7070 |
| 173 | Ga0501074_0014253 | 3300049590 | Bacteria | 5781 |
| 174 | Ga0501074_0020414 | 3300049590 | Bacteria | 4815 |
| 175 | Ga0501075_0000158 | 3300049591 | Bacteria | 34420 |
| 176 | Ga0501076_0003049 | 3300049592 | Bacteria | 11654 |
| 177 | Ga0501077_0015915 | 3300049593 | Bacteria | 4738 |
| 178 | Ga0501079_0013985 | 3300049741 | Bacteria | 6120 |
| 179 | Ga0501079_0021519 | 3300049741 | Bacteria | 4932 |
| 180 | Ga0501080_0016194 | 3300049742 | Bacteria | 6883 |
| 181 | Ga0501080_0041342 | 3300049742 | Bacteria | 4296 |
| 182 | Ga0501080_0512182 | 3300049742 | Bacteria | 1071 |
| 183 | Ga0501081_0002477 | 3300049743 | Bacteria | 11633 |
| 184 | Ga0501083_0000892 | 3300049744 | Bacteria | 19786 |
| 185 | Ga0501083_0012252 | 3300049744 | Bacteria | 6001 |
| 186 | Ga0501035_0021200 | 3300049822 | Bacteria | 5973 |
| 187 | Ga0501044_0204090 | 3300049823 | Bacteria | 1934 |
| 188 | Ga0501084_0001219 | 3300054114 | Bacteria | 20223 |
| 189 | Ga0501084_0061166 | 3300054114 | Bacteria | 3153 |
| 190 | Ga0501082_0002045 | 3300060353 | Bacteria | 17742 |
| 191 | Ga0466962_0000583 | 3300061719 | Bacteria | 16067 |
| 192 | Ga0466962_0001789 | 3300061719 | Bacteria | 10106 |
| 193 | Ga0466962_0005246 | 3300061719 | Bacteria | 6224 |
| 194 | Ga0466962_0022935 | 3300061719 | Bacteria | 3000 |
| 195 | Ga0466962_0026585 | 3300061719 | Bacteria | 2778 |
| 196 | Ga0466962_0063850 | 3300061719 | Bacteria | 1758 |
| 197 | Ga0530510_0055658 | 3300061734 | Bacteria | 2857 |
| 198 | Ga0466963_0065343 | |||
| 199 | rootH2_10074497 | |||
| 200 | Ga0070658_10005202 | |||
| 201 | Ga0070658_10017933 | |||
| 202 | Ga0070682_100057699 | |||
| 203 | Ga0070682_100449902 | |||
| 204 | Ga0070660_100033121 | |||
| 205 | Ga0070661_100438225 | |||
| 206 | Ga0070659_100213718 | |||
| 207 | Ga0070714_100036042 | |||
| 208 | Ga0070714_100075971 | |||
| 209 | Ga0070714_100526908 | |||
| 210 | Ga0070681_10016448 | |||
| 211 | Ga0070681_10041373 | |||
| 212 | Ga0070681_10088497 | |||
| 213 | Ga0070684_100167332 | |||
| 214 | Ga0068856_100431640 | |||
| 215 | Ga0105245_10106262 | |||
| 216 | Ga0157373_10213541 | |||
| 217 | Ga0157370_10005371 | |||
| 218 | Ga0157369_10049605 | |||
| 219 | Ga0157369_10291237 | |||
| 220 | Ga0157374_10366206 | |||
| 221 | Ga0157372_10166177 | |||
| 222 | Ga0157372_10312864 | |||
| 223 | Ga0206356_11773131 | |||
| 224 | Ga0224712_10040384 | |||
| 225 | Ga0207705_10028113 | |||
| 226 | Ga0207705_10210610 | |||
| 227 | Ga0207707_10026815 | |||
| 228 | Ga0207707_10032878 | |||
| 229 | Ga0207707_10205401 | |||
| 230 | Ga0207660_10007336 | |||
| 231 | Ga0207657_10044074 | |||
| 232 | Ga0207657_10139234 | |||
| 233 | Ga0207652_10021083 | |||
| 234 | Ga0207652_10038234 | |||
| 235 | Ga0207664_10016236 | |||
| 236 | Ga0207664_10609323 | |||
| 237 | Ga0207661_10036735 | |||
| 238 | Ga0207639_10360428 | |||
| 239 | Ga0207702_10174273 | |||
| 240 | Ga0307408_100923867 | |||
| 241 | Ga0307405_10396806 | |||
| 242 | Ga0307409_100656043 | |||
| 243 | Ga0307416_100270688 | |||
| 244 | Ga0395900_0114051 | |||
| 245 | Ga0395900_0120582 | |||
| 246 | Ga0395900_0304217 | |||
| 247 | Ga0395900_0552681 | |||
| 248 | Ga0395898_0136630 | |||
| 249 | Ga0395898_0195899 | |||
| 250 | Ga0395898_0196435 | |||
| 251 | Ga0395898_0361493 | |||
| 252 | Ga0395905_0078626 | |||
| 253 | Ga0395905_0127104 | |||
| 254 | Ga0395901_0069569 | |||
| 255 | Ga0395901_0080966 | |||
| 256 | Ga0395901_0109927 | |||
| 257 | Ga0436360_0097925 | |||
| 258 | Ga0466969_0108144 | |||
| 259 | Ga0466969_0162048 | |||
| 260 | Ga0466972_0022155 | |||
| 261 | Ga0466965_0024369 | |||
| 262 | Ga0466965_0048596 | |||
| 263 | Ga0466966_0031483 | |||
| 264 | Ga0466966_0068414 | |||
| 265 | Ga0466966_0103698 | |||
| 266 | Ga0466961_0004356 | |||
| 267 | Ga0466961_0035638 | |||
| 268 | Ga0466961_0051090 | |||
| 269 | Ga0466961_0073029 | |||
| 270 | Ga0466961_0113359 | |||
| 271 | Ga0466963_0002070 | |||
| 272 | Ga0466963_0003318 | |||
| 273 | Ga0466963_0004774 | |||
| 274 | Ga0466963_0011334 | |||
| 275 | Ga0466963_0016143 | |||
| 276 | Ga0466963_0017302 | |||
| 277 | Ga0466963_0044561 | |||
| 278 | Ga0466963_0044562 | |||
| 279 | Ga0466963_0045356 | |||
| 280 | Ga0466963_0051693 | |||
| 281 | Ga0466963_0089768 | |||
| 282 | Ga0466963_0117448 | |||
| 283 | Ga0466963_0152707 | |||
| 284 | Ga0466963_0160864 | |||
| 285 | Ga0466963_0167930 | |||
| 286 | Ga0466964_0006485 | |||
| 287 | Ga0466964_0010681 | |||
| 288 | Ga0466964_0014355 | |||
| 289 | Ga0466964_0019947 | |||
| 290 | Ga0466964_0079100 | |||
| 291 | Ga0466971_0005687 | |||
| 292 | Ga0466971_0016331 | |||
| 293 | Ga0466971_0064122 | |||
| 294 | Ga0466971_0114824 | |||
| 295 | Ga0466968_0005598 | |||
| 296 | Ga0466968_0007814 | |||
| 297 | Ga0466968_0045004 | |||
| 298 | Ga0466968_0048431 | |||
| 299 | Ga0466970_0052038 | |||
| 300 | Ga0466957_0002192 | |||
| 301 | Ga0466957_0003070 | |||
| 302 | Ga0466957_0055200 | |||
| 303 | Ga0466957_0075663 | |||
| 304 | Ga0466957_0086198 | |||
| 305 | Ga0466957_0116265 | |||
| 306 | Ga0466957_0153009 | |||
| 307 | Ga0466957_0184544 | |||
| 308 | Ga0466960_0007712 | |||
| 309 | Ga0466960_0050452 | |||
| 310 | Ga0466959_0009817 | |||
| 311 | Ga0466959_0033108 | |||
| 312 | Ga0466959_0155212 | |||
| 313 | Ga0466958_0003000 | |||
| 314 | Ga0466958_0008293 | |||
| 315 | Ga0466958_0018881 | |||
| 316 | Ga0466958_0026104 | |||
| 317 | Ga0466958_0038869 | |||
| 318 | Ga0466958_0065486 | |||
| 319 | Ga0466958_0079680 | |||
| 320 | Ga0466958_0105944 | |||
| 321 | Ga0466958_0151337 | |||
| 322 | Ga0466967_0002719 | |||
| 323 | Ga0466967_0026905 | |||
| 324 | Ga0466967_0041122 | |||
| 325 | Ga0466967_0048946 | |||
| 326 | Ga0466967_0056249 | |||
| 327 | Ga0466967_0058027 | |||
| 328 | Ga0466967_0064059 | |||
| 329 | Ga0466967_0078694 | |||
| 330 | Ga0466967_0130873 | |||
| 331 | Ga0466967_0131780 | |||
| 332 | Ga0466967_0136383 | |||
| 333 | Ga0466967_0137452 | |||
| 334 | Ga0466967_0141085 | |||
| 335 | Ga0466967_0161541 | |||
| 336 | Ga0466967_0194672 | |||
| 337 | Ga0496104_0081129 | |||
| 338 | Ga0496109_0357835 | |||
| 339 | Ga0496110_0021021 | |||
| 340 | Ga0496111_0151490 | |||
| 341 | Ga0496112_0736861 | |||
| 342 | Ga0496114_0268274 | |||
| 343 | Ga0501031_0004975 | |||
| 344 | Ga0501033_0072840 | |||
| 345 | Ga0501034_0031935 | |||
| 346 | Ga0501034_0671530 | |||
| 347 | Ga0501036_0002024 | |||
| 348 | Ga0501038_0006336 | |||
| 349 | Ga0501039_0010802 | |||
| 350 | Ga0501040_0001032 | |||
| 351 | Ga0501042_0001595 | |||
| 352 | Ga0501046_0174182 | |||
| 353 | Ga0501047_0248316 | |||
| 354 | Ga0501047_0292105 | |||
| 355 | Ga0501048_0002453 | |||
| 356 | Ga0501067_0037340 | |||
| 357 | Ga0501067_0044145 | |||
| 358 | Ga0501068_0038922 | |||
| 359 | Ga0501068_0285188 | |||
| 360 | Ga0501069_0024715 | |||
| 361 | Ga0501069_0151406 | |||
| 362 | Ga0501070_0002653 | |||
| 363 | Ga0501070_0314010 | |||
| 364 | Ga0501070_0425995 | |||
| 365 | Ga0501071_0000342 | |||
| 366 | Ga0501072_0003887 | |||
| 367 | Ga0501072_0008708 | |||
| 368 | Ga0501073_0011489 | |||
| 369 | Ga0501074_0009479 | |||
| 370 | Ga0501074_0014253 | |||
| 371 | Ga0501074_0020414 | |||
| 372 | Ga0501075_0000158 | |||
| 373 | Ga0501076_0003049 | |||
| 374 | Ga0501077_0015915 | |||
| 375 | Ga0501079_0013985 | |||
| 376 | Ga0501079_0021519 | |||
| 377 | Ga0501080_0016194 | |||
| 378 | Ga0501080_0041342 | |||
| 379 | Ga0501080_0512182 | |||
| 380 | Ga0501081_0002477 | |||
| 381 | Ga0501083_0000892 | |||
| 382 | Ga0501083_0012252 | |||
| 383 | Ga0501035_0021200 | |||
| 384 | Ga0501044_0204090 | |||
| 385 | Ga0501084_0001219 | |||
| 386 | Ga0501084_0061166 | |||
| 387 | Ga0501082_0002045 | |||
| 388 | Ga0466962_0000583 | |||
| 389 | Ga0466962_0001789 | |||
| 390 | Ga0466962_0005246 | |||
| 391 | Ga0466962_0022935 | |||
| 392 | Ga0466962_0026585 | |||
| 393 | Ga0466962_0063850 | |||
| 394 | Ga0530510_0055658 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3te1-assembly1.cif.gz_B | crystal structure of hsc t84a | 0.8765 | 9 | 251 |
| 3tdo-assembly1.cif.gz_C | crystal structure of hsc at ph 9.0 | 0.8562 | 8 | 252 |
| 3klz-assembly1.cif.gz_A | pentameric formate channel with formate bound | 0.8522 | 27 | 253 |
| 3te0-assembly1.cif.gz_C | crystal structure of hsc k148e | 0.8514 | 8 | 252 |
| 3tds-assembly1.cif.gz_E | crystal structure of hsc f194i | 0.8514 | 8 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37327_33_270_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.9175 | 10 | 242 | 1.20.1080.10 |
| af_Q5A4N6_2_250_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.8879 | 4 | 242 | 1.20.1080.10 |
| 3tdrG00 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.8811 | 9 | 252 | 1.20.1080.10 |
| af_P37327_33_270_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.881 | 10 | 242 | 1.20.1080.10 |
| af_Q2G1V0_12_273_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.8625 | 10 | 251 | 1.20.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538HYJ6-F1-model_v4 | Formate/nitrite transporter family protein | 0.9792 | 50 | 264 |
GO:0005886
GO:0015499 |
| AF-A0A538HYJ6-F1-model_v4 | Formate/nitrite transporter family protein | 0.9703 | 50 | 264 |
GO:0005886
GO:0015499 |
| AF-A0A538H7I2-F1-model_v4 | Formate/nitrite transporter family protein | 0.9688 | 1 | 259 |
GO:0005886
GO:0015499 |
| AF-A0A7W1N6L0-F1-model_v4 | Formate/nitrite transporter family protein | 0.9657 | 2 | 264 |
GO:0005886
GO:0015499 |
| AF-A0A1S8CE19-F1-model_v4 | Transport | 0.9657 | 1 | 255 |
GO:0005886
GO:0015499 |