F302997

General Info

Members Datasets Scaffolds Average Seq Length
197 139 394 135

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_11732070|Ga0105249_117320701
Length 154
Sequence MNIDSGRTHTSSQPTAKEKSVSTQAIINLPVADLPKSMAFFKALGYSHNPQSTDDTGACIVVSDTILAMLLTYARFRDFTPKAVCDTSKATEVLLTLSCESREQVDDLVAKAVAAGGSTYDKPEDYGFMYTHSFVDPDGHGWGLVHMSAMPAQT

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
87 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
90 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
102 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
125 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
129 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
139 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.66
Nodule 0
Rhizoplane 2.03
Rhizosphere 85.28
Stem 0
Stem Tuber 0
Unclassified 11.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_11732070 3300009553 Bacteria 697
2 JGI25162J39368_1001934 3300002737 Bacteria 9383
3 JGI25164J39214_1001897 3300002772 Bacteria 3892
4 rootH1_10387903 3300003323 Unclassified 1135
5 Ga0070670_100083472 3300005331 Bacteria 2745
6 Ga0068869_101149218 3300005334 Unclassified 681
7 Ga0070660_100040121 3300005339 Bacteria 3561
8 Ga0070660_100501218 3300005339 Bacteria 1010
9 Ga0070687_100050338 3300005343 Bacteria 2151
10 Ga0070692_10195023 3300005345 Bacteria 1182
11 Ga0070668_100667468 3300005347 Bacteria 914
12 Ga0070659_100132826 3300005366 Bacteria 2022
13 Ga0070714_100000409 3300005435 Bacteria 31605
14 Ga0070714_100001867 3300005435 Bacteria 15353
15 Ga0070708_101360483 3300005445 Bacteria 663
16 Ga0070678_100026577 3300005456 Bacteria 3916
17 Ga0070662_100117612 3300005457 Bacteria 2033
18 Ga0068853_100150377 3300005539 Bacteria 2096
19 Ga0068857_100219140 3300005577 Bacteria 1738
20 Ga0068856_100309074 3300005614 Bacteria 1598
21 Ga0070702_101764291 3300005615 Unclassified 516
22 Ga0068852_101983734 3300005616 Bacteria 604
23 Ga0068859_102163236 3300005617 Bacteria 614
24 Ga0068861_100467952 3300005719 Bacteria 1133
25 Ga0068863_100448725 3300005841 Bacteria 1266
26 Ga0068860_100572700 3300005843 Bacteria 1133
27 Ga0068862_100081821 3300005844 Unclassified 2802
28 Ga0068862_101263060 3300005844 Bacteria 739
29 Ga0075368_10003092 3300006042 Bacteria 5518
30 Ga0075369_10158471 3300006186 Bacteria 1037
31 Ga0097621_101401396 3300006237 Unclassified 662
32 Ga0075370_10015149 3300006353 Bacteria 4121
33 Ga0075370_10097832 3300006353 Unclassified 1697
34 Ga0075428_100352413 3300006844 Unclassified 1580
35 Ga0075430_100071367 3300006846 Bacteria 2913
36 Ga0075431_100603148 3300006847 Bacteria 1082
37 Ga0075433_10235473 3300006852 Bacteria 1625
38 Ga0075429_100909433 3300006880 Bacteria 770
39 Ga0068865_101643104 3300006881 Unclassified 578
40 Ga0097620_102124325 3300006931 Bacteria 620
41 Ga0097620_102164417 3300006931 Bacteria 614
42 Ga0105240_10432148 3300009093 Bacteria 1477
43 Ga0111539_12568763 3300009094 Bacteria 591
44 Ga0105247_11037787 3300009101 Unclassified 643
45 Ga0105247_11411815 3300009101 Bacteria 564
46 Ga0114129_10515709 3300009147 Bacteria 1559
47 Ga0105242_10215221 3300009176 Unclassified 1714
48 Ga0105248_10224447 3300009177 Bacteria 2115
49 Ga0105238_10221010 3300009551 Bacteria 1870
50 Ga0105238_10741126 3300009551 Bacteria 996
51 Ga0105249_11480874 3300009553 Bacteria 751
52 Ga0105239_11345124 3300010375 Bacteria 824
53 Ga0157371_11074150 3300013102 Bacteria 616
54 Ga0157370_10095918 3300013104 Bacteria 2782
55 Ga0157378_10000935 3300013297 Bacteria 26867
56 Ga0163162_11583697 3300013306 Bacteria 747
57 Ga0157372_10851476 3300013307 Bacteria 1058
58 Ga0163163_10100001 3300014325 Bacteria 2922
59 Ga0163163_11803449 3300014325 Bacteria 672
60 Ga0163163_12628098 3300014325 Bacteria 561
61 Ga0157380_12496109 3300014326 Unclassified 583
62 Ga0182008_10124524 3300014497 Bacteria 1282
63 Ga0182006_1140683 3300015261 Bacteria 825
64 Ga0182007_10056090 3300015262 Bacteria 1294
65 Ga0182007_10063856 3300015262 Bacteria 1207
66 Ga0163161_10370319 3300017792 Bacteria 1143
67 Ga0207427_100105 3300025231 Bacteria 118241
68 Ga0209437_100129 3300025233 Bacteria 184661
69 Ga0209233_1000227 3300025261 Bacteria 102833
70 Ga0209233_1000300 3300025261 Bacteria 59294
71 Ga0209025_1041566 3300025294 Bacteria 1967
72 Ga0207688_10929464 3300025901 Bacteria 550
73 Ga0207647_10023042 3300025904 Bacteria 4125
74 Ga0207705_10097119 3300025909 Bacteria 2163
75 Ga0207707_11021498 3300025912 Bacteria 678
76 Ga0207695_10285880 3300025913 Unclassified 1542
77 Ga0207695_10479924 3300025913 Bacteria 1125
78 Ga0207662_10275464 3300025918 Unclassified 1112
79 Ga0207657_10072239 3300025919 Bacteria 2919
80 Ga0207694_10306565 3300025924 Bacteria 1308
81 Ga0207694_10442110 3300025924 Bacteria 1085
82 Ga0207664_10000021 3300025929 Bacteria 216875
83 Ga0207664_10001642 3300025929 Bacteria 14728
84 Ga0207690_10000125 3300025932 Bacteria 63317
85 Ga0207690_10793667 3300025932 Bacteria 782
86 Ga0207686_10004522 3300025934 Bacteria 7452
87 Ga0207689_11771082 3300025942 Unclassified 510
88 Ga0207639_11067566 3300026041 Bacteria 757
89 Ga0207648_10760860 3300026089 Unclassified 900
90 Ga0207674_10142786 3300026116 Bacteria 2353
91 Ga0207683_10035692 3300026121 Bacteria 4325
92 Ga0209813_10041181 3300027866 Bacteria 1407
93 Ga0209974_10192841 3300027876 Unclassified 750
94 Ga0268265_10887485 3300028380 Bacteria 875
95 Ga0268264_10359602 3300028381 Bacteria 1388
96 Ga0307515_10489239 3300028794 Bacteria 842
97 Ga0265338_10008998 3300028800 Bacteria 12011
98 Ga0265324_10003643 3300029957 Bacteria 7230
99 Ga0307508_10001365 3300031616 Bacteria 27494
100 Ga0316579_10026224 3300031691 Unclassified 2637
101 Ga0265314_10108117 3300031711 Bacteria 1773
102 Ga0316578_10053068 3300031728 Unclassified 2375
103 Ga0316577_10206396 3300031733 Bacteria 1110
104 Ga0307416_101680632 3300032002 Bacteria 740
105 Ga0316585_10026241 3300032137 Bacteria 1811
106 Ga0316574_0023329 3300035398 Bacteria 3694
107 Ga0316584_0226548 3300036712 Bacteria 1371
108 Ga0395899_0000452 3300037312 Bacteria 46830
109 Ga0395899_0290289 3300037312 Bacteria 1110
110 Ga0395900_0004754 3300037418 Bacteria 14317
111 Ga0395900_0396598 3300037418 Bacteria 1345
112 Ga0395898_0020735 3300037466 Bacteria 6673
113 Ga0395898_0188525 3300037466 Bacteria 1971
114 Ga0395905_0408446 3300037471 Bacteria 1253
115 Ga0395901_0003399 3300038443 Bacteria 16031
116 Ga0451577_0000192 3300042876 Bacteria 128752
117 Ga0451577_0000227 3300042876 Bacteria 114840
118 Ga0451577_0002859 3300042876 Bacteria 19848
119 Ga0451577_0426134 3300042876 Unclassified 1205
120 Ga0453683_0035093 3300044673 Bacteria 3161
121 Ga0453683_0941308 3300044673 Bacteria 572
122 Ga0453684_0000033 3300044712 Bacteria 734012
123 Ga0453684_0009424 3300044712 Bacteria 17076
124 Ga0453684_0015819 3300044712 Bacteria 11862
125 Ga0453684_0021892 3300044712 Bacteria 9513
126 Ga0453684_0069303 3300044712 Bacteria 4474
127 Ga0453684_0167867 3300044712 Bacteria 2589
128 Ga0453684_0277652 3300044712 Bacteria 1912
129 Ga0453684_0796046 3300044712 Bacteria 1020
130 Ga0453684_1134938 3300044712 Unclassified 824
131 Ga0453684_1342196 3300044712 Bacteria 744
132 Ga0451576_0018349 3300045051 Bacteria 7671
133 Ga0451576_0085260 3300045051 Bacteria 3286
134 Ga0451576_0159727 3300045051 Bacteria 2352
135 Ga0451576_0610545 3300045051 Bacteria 1146
136 Ga0495656_0173704 3300046615 Bacteria 1055
137 Ga0495670_0267328 3300046691 Bacteria 913
138 Ga0496100_0796837 3300048903 Bacteria 740
139 Ga0496106_1040883 3300048909 Bacteria 643
140 Ga0496109_0025685 3300048912 Bacteria 5250
141 Ga0496113_0173774 3300048916 Bacteria 1707
142 Ga0501032_0003579 3300049569 Bacteria 11846
143 Ga0501032_0129776 3300049569 Bacteria 1663
144 Ga0501033_0000310 3300049570 Bacteria 46064
145 Ga0501033_0037375 3300049570 Bacteria 3634
146 Ga0501034_0047898 3300049571 Bacteria 4314
147 Ga0501036_0014256 3300049572 Bacteria 6614
148 Ga0501036_1638149 3300049572 Bacteria 519
149 Ga0501037_0011005 3300049573 Bacteria 6654
150 Ga0501037_0077065 3300049573 Bacteria 2419
151 Ga0501038_0120130 3300049574 Bacteria 2168
152 Ga0501039_0292994 3300049575 Bacteria 1279
153 Ga0501042_0511561 3300049578 Bacteria 872
154 Ga0501043_0040093 3300049579 Bacteria 3681
155 Ga0501043_0263210 3300049579 Bacteria 1325
156 Ga0501046_0000524 3300049580 Bacteria 38016
157 Ga0501046_0001079 3300049580 Bacteria 26742
158 Ga0501046_0013311 3300049580 Bacteria 6968
159 Ga0501046_0204640 3300049580 Bacteria 1467
160 Ga0501047_0017164 3300049581 Bacteria 6927
161 Ga0501047_0034280 3300049581 Unclassified 4901
162 Ga0501047_0111009 3300049581 Bacteria 2624
163 Ga0501047_0169229 3300049581 Bacteria 2054
164 Ga0501047_0311543 3300049581 Bacteria 1414
165 Ga0501047_0464040 3300049581 Bacteria 1095
166 Ga0501047_0863898 3300049581 Bacteria 718
167 Ga0501048_0111976 3300049582 Bacteria 1927
168 Ga0501048_0284699 3300049582 Bacteria 1175
169 Ga0501070_0368832 3300049586 Bacteria 1164
170 Ga0501075_0923080 3300049591 Bacteria 664
171 Ga0501243_000031 3300049675 Bacteria 12333
172 Ga0501035_0059007 3300049822 Bacteria 3418
173 Ga0501035_0080709 3300049822 Bacteria 2871
174 Ga0501035_0301969 3300049822 Bacteria 1349
175 Ga0501044_0000838 3300049823 Bacteria 36846
176 Ga0501044_0108729 3300049823 Bacteria 2782
177 Ga0501044_0185023 3300049823 Bacteria 2048
178 Ga0501044_0704049 3300049823 Bacteria 895
179 nmdc:mga03683_186933_c1 3300050489 Bacteria 947
180 nmdc:mga03n38_20478_c1 3300050490 Bacteria 2647
181 nmdc:mga00v17_36067_c1 3300050491 Bacteria 2946
182 nmdc:mga0k408_747118_c1 3300050493 Bacteria 572
183 nmdc:mga06z11_6988_c1 3300050494 Bacteria 4627
184 nmdc:mga04h51_5456_c1 3300050495 Bacteria 3244
185 nmdc:mga07m45_22700_c1 3300050496 Bacteria 3428
186 nmdc:mga07m45_5598_c1 3300050496 Bacteria 6273
187 nmdc:mga05p37_403538_c1 3300050507 Bacteria 1595
188 nmdc:mga05p37_730996_c1 3300050507 Bacteria 1094
189 nmdc:mga0qj67_61269_c1 3300050509 Bacteria 2987
190 nmdc:mga06r32_335073_c1 3300050510 Unclassified 1498
191 nmdc:mga06r32_530785_c1 3300050510 Bacteria 1152
192 nmdc:mga08y16_1668360_c1 3300050511 Bacteria 593
193 nmdc:mga0n895_1333756_c1 3300050512 Bacteria 687
194 nmdc:mga0sz30_25653_c1 3300050516 Bacteria 2411
195 Ga0501082_0805383 3300060353 Bacteria 822
196 2866556541 2866552031 Bacteria 5824618
197 2939614693 2939611941 Bacteria 3892017
198 Ga0105249_11732070
199 JGI25162J39368_1001934
200 JGI25164J39214_1001897
201 rootH1_10387903
202 Ga0070670_100083472
203 Ga0068869_101149218
204 Ga0070660_100040121
205 Ga0070660_100501218
206 Ga0070687_100050338
207 Ga0070692_10195023
208 Ga0070668_100667468
209 Ga0070659_100132826
210 Ga0070714_100000409
211 Ga0070714_100001867
212 Ga0070708_101360483
213 Ga0070678_100026577
214 Ga0070662_100117612
215 Ga0068853_100150377
216 Ga0068857_100219140
217 Ga0068856_100309074
218 Ga0070702_101764291
219 Ga0068852_101983734
220 Ga0068859_102163236
221 Ga0068861_100467952
222 Ga0068863_100448725
223 Ga0068860_100572700
224 Ga0068862_100081821
225 Ga0068862_101263060
226 Ga0075368_10003092
227 Ga0075369_10158471
228 Ga0097621_101401396
229 Ga0075370_10015149
230 Ga0075370_10097832
231 Ga0075428_100352413
232 Ga0075430_100071367
233 Ga0075431_100603148
234 Ga0075433_10235473
235 Ga0075429_100909433
236 Ga0068865_101643104
237 Ga0097620_102124325
238 Ga0097620_102164417
239 Ga0105240_10432148
240 Ga0111539_12568763
241 Ga0105247_11037787
242 Ga0105247_11411815
243 Ga0114129_10515709
244 Ga0105242_10215221
245 Ga0105248_10224447
246 Ga0105238_10221010
247 Ga0105238_10741126
248 Ga0105249_11480874
249 Ga0105239_11345124
250 Ga0157371_11074150
251 Ga0157370_10095918
252 Ga0157378_10000935
253 Ga0163162_11583697
254 Ga0157372_10851476
255 Ga0163163_10100001
256 Ga0163163_11803449
257 Ga0163163_12628098
258 Ga0157380_12496109
259 Ga0182008_10124524
260 Ga0182006_1140683
261 Ga0182007_10056090
262 Ga0182007_10063856
263 Ga0163161_10370319
264 Ga0207427_100105
265 Ga0209437_100129
266 Ga0209233_1000227
267 Ga0209233_1000300
268 Ga0209025_1041566
269 Ga0207688_10929464
270 Ga0207647_10023042
271 Ga0207705_10097119
272 Ga0207707_11021498
273 Ga0207695_10285880
274 Ga0207695_10479924
275 Ga0207662_10275464
276 Ga0207657_10072239
277 Ga0207694_10306565
278 Ga0207694_10442110
279 Ga0207664_10000021
280 Ga0207664_10001642
281 Ga0207690_10000125
282 Ga0207690_10793667
283 Ga0207686_10004522
284 Ga0207689_11771082
285 Ga0207639_11067566
286 Ga0207648_10760860
287 Ga0207674_10142786
288 Ga0207683_10035692
289 Ga0209813_10041181
290 Ga0209974_10192841
291 Ga0268265_10887485
292 Ga0268264_10359602
293 Ga0307515_10489239
294 Ga0265338_10008998
295 Ga0265324_10003643
296 Ga0307508_10001365
297 Ga0316579_10026224
298 Ga0265314_10108117
299 Ga0316578_10053068
300 Ga0316577_10206396
301 Ga0307416_101680632
302 Ga0316585_10026241
303 Ga0316574_0023329
304 Ga0316584_0226548
305 Ga0395899_0000452
306 Ga0395899_0290289
307 Ga0395900_0004754
308 Ga0395900_0396598
309 Ga0395898_0020735
310 Ga0395898_0188525
311 Ga0395905_0408446
312 Ga0395901_0003399
313 Ga0451577_0000192
314 Ga0451577_0000227
315 Ga0451577_0002859
316 Ga0451577_0426134
317 Ga0453683_0035093
318 Ga0453683_0941308
319 Ga0453684_0000033
320 Ga0453684_0009424
321 Ga0453684_0015819
322 Ga0453684_0021892
323 Ga0453684_0069303
324 Ga0453684_0167867
325 Ga0453684_0277652
326 Ga0453684_0796046
327 Ga0453684_1134938
328 Ga0453684_1342196
329 Ga0451576_0018349
330 Ga0451576_0085260
331 Ga0451576_0159727
332 Ga0451576_0610545
333 Ga0495656_0173704
334 Ga0495670_0267328
335 Ga0496100_0796837
336 Ga0496106_1040883
337 Ga0496109_0025685
338 Ga0496113_0173774
339 Ga0501032_0003579
340 Ga0501032_0129776
341 Ga0501033_0000310
342 Ga0501033_0037375
343 Ga0501034_0047898
344 Ga0501036_0014256
345 Ga0501036_1638149
346 Ga0501037_0011005
347 Ga0501037_0077065
348 Ga0501038_0120130
349 Ga0501039_0292994
350 Ga0501042_0511561
351 Ga0501043_0040093
352 Ga0501043_0263210
353 Ga0501046_0000524
354 Ga0501046_0001079
355 Ga0501046_0013311
356 Ga0501046_0204640
357 Ga0501047_0017164
358 Ga0501047_0034280
359 Ga0501047_0111009
360 Ga0501047_0169229
361 Ga0501047_0311543
362 Ga0501047_0464040
363 Ga0501047_0863898
364 Ga0501048_0111976
365 Ga0501048_0284699
366 Ga0501070_0368832
367 Ga0501075_0923080
368 Ga0501243_000031
369 Ga0501035_0059007
370 Ga0501035_0080709
371 Ga0501035_0301969
372 Ga0501044_0000838
373 Ga0501044_0108729
374 Ga0501044_0185023
375 Ga0501044_0704049
376 nmdc:mga03683_186933_c1
377 nmdc:mga03n38_20478_c1
378 nmdc:mga00v17_36067_c1
379 nmdc:mga0k408_747118_c1
380 nmdc:mga06z11_6988_c1
381 nmdc:mga04h51_5456_c1
382 nmdc:mga07m45_22700_c1
383 nmdc:mga07m45_5598_c1
384 nmdc:mga05p37_403538_c1
385 nmdc:mga05p37_730996_c1
386 nmdc:mga0qj67_61269_c1
387 nmdc:mga06r32_335073_c1
388 nmdc:mga06r32_530785_c1
389 nmdc:mga08y16_1668360_c1
390 nmdc:mga0n895_1333756_c1
391 nmdc:mga0sz30_25653_c1
392 Ga0501082_0805383
393 2866556541
394 2939614693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9311 1 134
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9286 1 134
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9244 1 134
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9219 1 134
4pav-assembly1.cif.gz_A structure of hypothetical protein sa1046 from s. aureus. 0.8774 1 127
ID Description Score Start End Superfamily
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9109 1 134 3.10.180.10
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8975 1 134 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8816 73 129 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.868 73 129 3.30.720.110
3bqxA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8504 1 126 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4U9WAT0-F1-model_v4 Predicted lactoylglutathione lyase 0.9917 73 127 GO:0016829
AF-A0A0V8TBW8-F1-model_v4 VOC domain-containing protein 0.9915 1 129
AF-A0A853QHL7-F1-model_v4 deleted 0.9907 1 96
AF-A0A832H4X3-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9903 1 116 GO:0051213
AF-A0A3L7PMW8-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.99 1 108 GO:0051213

Map