F302968

General Info

Members Datasets Scaffolds Average Seq Length
197 145 394 225

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10752059|Ga0105241_107520591
Length 264
Sequence MRPSVIAFDVNETLSDLSPLGARFLEVGASASAAPLWFASVLRDGFALTAAGANPPFAAVAREQLLSQLAAVQLNRSLEEAAQHVMAGFASLELHADVANGLDLLHEDGFRLVTLSNGATSVADRLLTSANVRDRFERLLSVEDAGAWKPAARAYEYAAQECDVKPEDMLLVAVHPWDVHGARRAGLRSAWVNRSGGAFPATFLEPTYTVAGVDQLVELWVVRRGHGHWFTPASMSAARSRSNPERIRLFTVPSGSSSSVATSR

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
89 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
90 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
131 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
135 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
136 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
137 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
138 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
139 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
140 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
141 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
142 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
143 2920879853 Kocuria salina CV6 Isolate Unclassified
144 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
145 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.42
Metatranscriptomes 0
Isolates 5.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 12.69
Rhizosphere 82.74
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10752059 3300009174 Bacteria 894
2 JGI24744J21845_10010558 3300002077 Bacteria 1892
3 rootH2_10158060 3300003320 Bacteria 2400
4 Ga0070658_10193924 3300005327 Bacteria 1713
5 Ga0070683_100019252 3300005329 Bacteria 6064
6 Ga0070683_100409369 3300005329 Bacteria 1293
7 Ga0070682_100008981 3300005337 Bacteria 5648
8 Ga0070682_100600163 3300005337 Bacteria 869
9 Ga0070687_100471669 3300005343 Bacteria 839
10 Ga0070692_10003018 3300005345 Bacteria 6709
11 Ga0070675_100095450 3300005354 Bacteria 2497
12 Ga0070673_100032004 3300005364 Bacteria 3954
13 Ga0070688_100146308 3300005365 Bacteria 1610
14 Ga0070659_100196606 3300005366 Bacteria 1659
15 Ga0070714_100094143 3300005435 Bacteria 2629
16 Ga0070714_100123564 3300005435 Bacteria 2305
17 Ga0070701_10014972 3300005438 Bacteria 3568
18 Ga0070700_100012062 3300005441 Bacteria 4805
19 Ga0070678_100404993 3300005456 Bacteria 1186
20 Ga0070662_100203824 3300005457 Bacteria 1571
21 Ga0068867_100048461 3300005459 Bacteria 3126
22 Ga0070684_100093643 3300005535 Bacteria 2675
23 Ga0070684_100300521 3300005535 Bacteria 1473
24 Ga0070684_100576130 3300005535 Bacteria 1045
25 Ga0070684_100772211 3300005535 Bacteria 898
26 Ga0070684_100908036 3300005535 Bacteria 825
27 Ga0070672_100011271 3300005543 Bacteria 6234
28 Ga0070686_100244642 3300005544 Bacteria 1308
29 Ga0068855_100001495 3300005563 Bacteria 29278
30 Ga0068856_100091133 3300005614 Bacteria 3033
31 Ga0068852_100009713 3300005616 Bacteria 7149
32 Ga0068861_100010339 3300005719 Bacteria 6473
33 Ga0068862_100235739 3300005844 Bacteria 1662
34 Ga0081455_10122844 3300005937 Bacteria 2043
35 Ga0081538_10002048 3300005981 Bacteria 20113
36 Ga0081539_10004382 3300005985 Bacteria 15698
37 Ga0070717_10151783 3300006028 Bacteria 2004
38 Ga0070712_100156879 3300006175 Bacteria 1753
39 Ga0097621_100554238 3300006237 Bacteria 1046
40 Ga0068865_100302242 3300006881 Bacteria 1281
41 Ga0111539_10090254 3300009094 Bacteria 3601
42 Ga0105245_10118642 3300009098 Bacteria 2469
43 Ga0105245_10171161 3300009098 Bacteria 2068
44 Ga0105245_10253215 3300009098 Bacteria 1711
45 Ga0105245_10289380 3300009098 Bacteria 1604
46 Ga0114129_10452343 3300009147 Bacteria 1684
47 Ga0105243_10028128 3300009148 Bacteria 4313
48 Ga0105248_10062797 3300009177 Bacteria 4170
49 Ga0105238_10126878 3300009551 Bacteria 2530
50 Ga0105249_10018120 3300009553 Bacteria 6259
51 Ga0105239_10377608 3300010375 Bacteria 1602
52 Ga0105246_10433896 3300011119 Bacteria 1100
53 Ga0157369_10111612 3300013105 Bacteria 2906
54 Ga0157369_10400347 3300013105 Bacteria 1424
55 Ga0163162_10097028 3300013306 Bacteria 3036
56 Ga0157372_10450609 3300013307 Bacteria 1500
57 Ga0157375_10105134 3300013308 Bacteria 2913
58 Ga0163163_10043017 3300014325 Bacteria 4427
59 Ga0157380_10451788 3300014326 Bacteria 1234
60 Ga0182008_10081369 3300014497 Bacteria 1594
61 Ga0182008_10300088 3300014497 Bacteria 840
62 Ga0157377_10004147 3300014745 Bacteria 6619
63 Ga0157379_10361459 3300014968 Bacteria 1330
64 Ga0157376_11394812 3300014969 Bacteria 732
65 Ga0209148_1002078 3300025254 Bacteria 7652
66 Ga0207643_10013983 3300025908 Bacteria 4354
67 Ga0207693_10066289 3300025915 Bacteria 2827
68 Ga0207659_10300368 3300025926 Bacteria 1318
69 Ga0207687_10060178 3300025927 Bacteria 2678
70 Ga0207687_10431805 3300025927 Bacteria 1089
71 Ga0207664_10086575 3300025929 Bacteria 2560
72 Ga0207706_10305725 3300025933 Bacteria 1385
73 Ga0207709_10107081 3300025935 Bacteria 1861
74 Ga0207670_10507014 3300025936 Bacteria 980
75 Ga0207669_10177691 3300025937 Bacteria 1522
76 Ga0207704_10079860 3300025938 Bacteria 2110
77 Ga0207691_10020207 3300025940 Bacteria 6298
78 Ga0207661_10068547 3300025944 Bacteria 2889
79 Ga0207667_10002803 3300025949 Bacteria 21585
80 Ga0207651_10404891 3300025960 Bacteria 1161
81 Ga0207640_10019796 3300025981 Bacteria 3983
82 Ga0207708_10009484 3300026075 Bacteria 7210
83 Ga0207648_10039020 3300026089 Bacteria 4177
84 Ga0207676_10556024 3300026095 Bacteria 1097
85 Ga0207674_10425588 3300026116 Bacteria 1283
86 Ga0207675_100017415 3300026118 Bacteria 6707
87 Ga0207683_10517338 3300026121 Bacteria 1103
88 Ga0207698_10022784 3300026142 Bacteria 4362
89 Ga0265316_10499219 3300031344 Unclassified 869
90 Ga0307408_100217805 3300031548 Bacteria 1556
91 Ga0307405_10452058 3300031731 Bacteria 1019
92 Ga0307406_10487188 3300031901 Bacteria 997
93 Ga0307406_10652816 3300031901 Bacteria 873
94 Ga0307407_10013135 3300031903 Bacteria 4007
95 Ga0307407_10218502 3300031903 Bacteria 1287
96 Ga0307409_100099623 3300031995 Bacteria 2407
97 Ga0307409_100344228 3300031995 Bacteria 1404
98 Ga0307409_101161290 3300031995 Bacteria 795
99 Ga0307416_101381318 3300032002 Bacteria 810
100 Ga0307415_100462790 3300032126 Bacteria 1099
101 Ga0395899_0010452 3300037312 Bacteria 7109
102 Ga0395899_0011489 3300037312 Bacteria 6778
103 Ga0395899_0022525 3300037312 Bacteria 4775
104 Ga0395899_0061292 3300037312 Bacteria 2771
105 Ga0395899_0079844 3300037312 Bacteria 2382
106 Ga0395900_0002776 3300037418 Bacteria 19141
107 Ga0395900_0116850 3300037418 Bacteria 2737
108 Ga0395898_0000978 3300037466 Bacteria 44946
109 Ga0395898_0037851 3300037466 Bacteria 4782
110 Ga0395898_0092278 3300037466 Bacteria 2912
111 Ga0395898_0092807 3300037466 Bacteria 2903
112 Ga0395898_0218720 3300037466 Bacteria 1817
113 Ga0395898_0222597 3300037466 Bacteria 1800
114 Ga0395898_0309230 3300037466 Bacteria 1507
115 Ga0395901_0000702 3300038443 Bacteria 38241
116 Ga0395901_0022938 3300038443 Bacteria 6398
117 Ga0395901_0033874 3300038443 Bacteria 5275
118 Ga0395901_0118647 3300038443 Bacteria 2780
119 Ga0395901_0204112 3300038443 Bacteria 2071
120 Ga0439433_0054941 3300041999 Bacteria 943
121 Ga0439449_0001084 3300042007 Bacteria 10708
122 Ga0439462_0013842 3300042015 Bacteria 2071
123 Ga0466961_0140500 3300044693 Bacteria 1512
124 Ga0466961_0353752 3300044693 Unclassified 894
125 Ga0466963_0013379 3300044694 Bacteria 5038
126 Ga0466964_0031263 3300044706 Bacteria 2110
127 Ga0466971_0212731 3300044719 Bacteria 915
128 Ga0466970_0019268 3300044765 Bacteria 3537
129 Ga0466957_0116553 3300044842 Bacteria 1699
130 Ga0466959_0444985 3300045049 Bacteria 879
131 Ga0466958_0050832 3300045836 Bacteria 2509
132 Ga0466958_0121444 3300045836 Bacteria 1636
133 Ga0466967_0024779 3300045976 Bacteria 4938
134 Ga0466967_0078176 3300045976 Bacteria 2980
135 Ga0466967_1183379 3300045976 Bacteria 762
136 Ga0495580_0045708 3300046472 Bacteria 3109
137 Ga0495640_0233526 3300046533 Bacteria 1156
138 Ga0495586_0182012 3300046535 Bacteria 1189
139 Ga0496100_0180597 3300048903 Bacteria 1526
140 Ga0496100_0678916 3300048903 Bacteria 803
141 Ga0496102_0091644 3300048905 Bacteria 2813
142 Ga0496103_0004301 3300048906 Bacteria 8655
143 Ga0496103_0048810 3300048906 Bacteria 2616
144 Ga0496104_0080118 3300048907 Bacteria 3113
145 Ga0496106_0021715 3300048909 Bacteria 4767
146 Ga0496106_0213093 3300048909 Bacteria 1539
147 Ga0496107_0070370 3300048910 Bacteria 2540
148 Ga0496108_0001701 3300048911 Bacteria 17446
149 Ga0496108_0151172 3300048911 Bacteria 2003
150 Ga0496109_0000674 3300048912 Bacteria 28327
151 Ga0496109_0060389 3300048912 Bacteria 3464
152 Ga0496109_0635193 3300048912 Bacteria 1004
153 Ga0496110_0047005 3300048913 Bacteria 3777
154 Ga0496110_0066777 3300048913 Bacteria 3181
155 Ga0496110_0623111 3300048913 Bacteria 978
156 Ga0496110_0735109 3300048913 Bacteria 889
157 Ga0496111_0080205 3300048914 Bacteria 2381
158 Ga0496111_0129785 3300048914 Bacteria 1865
159 Ga0496112_0238389 3300048915 Bacteria 1772
160 Ga0496113_0068837 3300048916 Bacteria 2687
161 Ga0496114_0119969 3300048917 Bacteria 2261
162 Ga0496114_0189301 3300048917 Bacteria 1800
163 Ga0496114_0255017 3300048917 Bacteria 1544
164 Ga0501032_0000032 3300049569 Bacteria 122607
165 Ga0501033_0317621 3300049570 Bacteria 1094
166 Ga0501036_0008817 3300049572 Bacteria 8279
167 Ga0501036_0712722 3300049572 Bacteria 829
168 Ga0501037_0150706 3300049573 Bacteria 1662
169 Ga0501038_0000132 3300049574 Bacteria 63743
170 Ga0501039_0000036 3300049575 Bacteria 123633
171 Ga0501041_0349530 3300049577 Bacteria 934
172 Ga0501043_0003016 3300049579 Bacteria 14008
173 Ga0501067_0027384 3300049583 Bacteria 3157
174 Ga0501067_0041720 3300049583 Bacteria 2548
175 Ga0501068_0029659 3300049584 Bacteria 3241
176 Ga0501069_0021076 3300049585 Bacteria 3535
177 Ga0501069_0132657 3300049585 Bacteria 1427
178 Ga0501070_0002628 3300049586 Bacteria 15685
179 Ga0501073_0475133 3300049589 Bacteria 864
180 Ga0501076_0449543 3300049592 Bacteria 1061
181 Ga0501221_072130 3300049704 Bacteria 817
182 Ga0501271_012977 3300049768 Unclassified 908
183 Ga0501044_0030879 3300049823 Bacteria 5643
184 Ga0501045_0239117 3300049824 Bacteria 1352
185 Ga0466962_0043250 3300061719 Bacteria 2156
186 Ga0466962_0230564 3300061719 Bacteria 908
187 2643850131 2643221567 Bacteria 4163945
188 2644136132 2643221624 Bacteria 4384879
189 2808828282 2808606357 Bacteria 4466944
190 2808849525 2808606360 Bacteria 4404006
191 2808877880 2808606366 Bacteria 4415912
192 2808895389 2808606371 Bacteria 4251511
193 2919054999 2919051321 Bacteria 4210889
194 2919449038 2919446982 Bacteria 3994487
195 2920882991 2920879853 Bacteria 4216831
196 2939599615 2939598168 Bacteria 4687164
197 2945957474 2945956166 Bacteria 5110334
198 Ga0105241_10752059
199 JGI24744J21845_10010558
200 rootH2_10158060
201 Ga0070658_10193924
202 Ga0070683_100019252
203 Ga0070683_100409369
204 Ga0070682_100008981
205 Ga0070682_100600163
206 Ga0070687_100471669
207 Ga0070692_10003018
208 Ga0070675_100095450
209 Ga0070673_100032004
210 Ga0070688_100146308
211 Ga0070659_100196606
212 Ga0070714_100094143
213 Ga0070714_100123564
214 Ga0070701_10014972
215 Ga0070700_100012062
216 Ga0070678_100404993
217 Ga0070662_100203824
218 Ga0068867_100048461
219 Ga0070684_100093643
220 Ga0070684_100300521
221 Ga0070684_100576130
222 Ga0070684_100772211
223 Ga0070684_100908036
224 Ga0070672_100011271
225 Ga0070686_100244642
226 Ga0068855_100001495
227 Ga0068856_100091133
228 Ga0068852_100009713
229 Ga0068861_100010339
230 Ga0068862_100235739
231 Ga0081455_10122844
232 Ga0081538_10002048
233 Ga0081539_10004382
234 Ga0070717_10151783
235 Ga0070712_100156879
236 Ga0097621_100554238
237 Ga0068865_100302242
238 Ga0111539_10090254
239 Ga0105245_10118642
240 Ga0105245_10171161
241 Ga0105245_10253215
242 Ga0105245_10289380
243 Ga0114129_10452343
244 Ga0105243_10028128
245 Ga0105248_10062797
246 Ga0105238_10126878
247 Ga0105249_10018120
248 Ga0105239_10377608
249 Ga0105246_10433896
250 Ga0157369_10111612
251 Ga0157369_10400347
252 Ga0163162_10097028
253 Ga0157372_10450609
254 Ga0157375_10105134
255 Ga0163163_10043017
256 Ga0157380_10451788
257 Ga0182008_10081369
258 Ga0182008_10300088
259 Ga0157377_10004147
260 Ga0157379_10361459
261 Ga0157376_11394812
262 Ga0209148_1002078
263 Ga0207643_10013983
264 Ga0207693_10066289
265 Ga0207659_10300368
266 Ga0207687_10060178
267 Ga0207687_10431805
268 Ga0207664_10086575
269 Ga0207706_10305725
270 Ga0207709_10107081
271 Ga0207670_10507014
272 Ga0207669_10177691
273 Ga0207704_10079860
274 Ga0207691_10020207
275 Ga0207661_10068547
276 Ga0207667_10002803
277 Ga0207651_10404891
278 Ga0207640_10019796
279 Ga0207708_10009484
280 Ga0207648_10039020
281 Ga0207676_10556024
282 Ga0207674_10425588
283 Ga0207675_100017415
284 Ga0207683_10517338
285 Ga0207698_10022784
286 Ga0265316_10499219
287 Ga0307408_100217805
288 Ga0307405_10452058
289 Ga0307406_10487188
290 Ga0307406_10652816
291 Ga0307407_10013135
292 Ga0307407_10218502
293 Ga0307409_100099623
294 Ga0307409_100344228
295 Ga0307409_101161290
296 Ga0307416_101381318
297 Ga0307415_100462790
298 Ga0395899_0010452
299 Ga0395899_0011489
300 Ga0395899_0022525
301 Ga0395899_0061292
302 Ga0395899_0079844
303 Ga0395900_0002776
304 Ga0395900_0116850
305 Ga0395898_0000978
306 Ga0395898_0037851
307 Ga0395898_0092278
308 Ga0395898_0092807
309 Ga0395898_0218720
310 Ga0395898_0222597
311 Ga0395898_0309230
312 Ga0395901_0000702
313 Ga0395901_0022938
314 Ga0395901_0033874
315 Ga0395901_0118647
316 Ga0395901_0204112
317 Ga0439433_0054941
318 Ga0439449_0001084
319 Ga0439462_0013842
320 Ga0466961_0140500
321 Ga0466961_0353752
322 Ga0466963_0013379
323 Ga0466964_0031263
324 Ga0466971_0212731
325 Ga0466970_0019268
326 Ga0466957_0116553
327 Ga0466959_0444985
328 Ga0466958_0050832
329 Ga0466958_0121444
330 Ga0466967_0024779
331 Ga0466967_0078176
332 Ga0466967_1183379
333 Ga0495580_0045708
334 Ga0495640_0233526
335 Ga0495586_0182012
336 Ga0496100_0180597
337 Ga0496100_0678916
338 Ga0496102_0091644
339 Ga0496103_0004301
340 Ga0496103_0048810
341 Ga0496104_0080118
342 Ga0496106_0021715
343 Ga0496106_0213093
344 Ga0496107_0070370
345 Ga0496108_0001701
346 Ga0496108_0151172
347 Ga0496109_0000674
348 Ga0496109_0060389
349 Ga0496109_0635193
350 Ga0496110_0047005
351 Ga0496110_0066777
352 Ga0496110_0623111
353 Ga0496110_0735109
354 Ga0496111_0080205
355 Ga0496111_0129785
356 Ga0496112_0238389
357 Ga0496113_0068837
358 Ga0496114_0119969
359 Ga0496114_0189301
360 Ga0496114_0255017
361 Ga0501032_0000032
362 Ga0501033_0317621
363 Ga0501036_0008817
364 Ga0501036_0712722
365 Ga0501037_0150706
366 Ga0501038_0000132
367 Ga0501039_0000036
368 Ga0501041_0349530
369 Ga0501043_0003016
370 Ga0501067_0027384
371 Ga0501067_0041720
372 Ga0501068_0029659
373 Ga0501069_0021076
374 Ga0501069_0132657
375 Ga0501070_0002628
376 Ga0501073_0475133
377 Ga0501076_0449543
378 Ga0501221_072130
379 Ga0501271_012977
380 Ga0501044_0030879
381 Ga0501045_0239117
382 Ga0466962_0043250
383 Ga0466962_0230564
384 2643850131
385 2644136132
386 2808828282
387 2808849525
388 2808877880
389 2808895389
390 2919054999
391 2919449038
392 2920882991
393 2939599615
394 2945957474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

53

192

0.86

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

3

186

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jud-assembly1.cif.gz_A l-2-haloacid dehalogenase 0.9231 7 224
2no4-assembly1.cif.gz_B crystal structure analysis of a dehalogenase 0.9222 5 221
2no5-assembly1.cif.gz_B crystal structure analysis of a dehalogenase with intermediate complex 0.9219 6 221
1zrm-assembly1.cif.gz_A crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate 0.9133 7 224
1jud-assembly1.cif.gz_A l-2-haloacid dehalogenase 0.911 7 224
ID Description Score Start End Superfamily
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9411 97 224 3.40.50.1000
2w43A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9351 97 227 3.40.50.1000
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9328 97 221 3.40.50.1000
1qq7B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.901 97 224 3.40.50.1000
3vayB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8946 7 227 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A0K2R3C7-F1-model_v4 deleted 0.9866 104 227
AF-A0A1R1LBR5-F1-model_v4 Haloacid dehalogenase, type II 0.9846 6 218 GO:0019120
AF-A0A7Y9F1E3-F1-model_v4 2-haloacid dehalogenase (EC 3.8.1.2) 0.9803 1 227 GO:0018784
AF-A0A1H1R666-F1-model_v4 2-haloacid dehalogenase 0.98 6 226 GO:0019120
AF-A0A4Q5ISV7-F1-model_v4 Haloacid dehalogenase type II 0.9784 7 225 GO:0019120

Map