F302730

General Info

Members Datasets Scaffolds Average Seq Length
197 134 394 159

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100001166|Ga0070686_10000116610
Length 181
Sequence MKRAVSRLTFTFARAAPCSILRPMNFVGIGYDVHQLVTGRKLVLGGVEIPHPKGLDGHSDADALMHAICGESDIGTFFPNTDSRWRGVPSSTFLREAARQVTFRGGRIINIDATLIAQQPKISPHVAAMKENIARALEMTAARVGIKATTNEHLGFIGREEGIAAMAVASVELPEHLYGTS

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
79 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.02
Rhizosphere 98.48
Stem 0
Stem Tuber 0
Unclassified 15.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100001166 3300005544 Bacteria 14980
2 rootL2_10166802 3300003322 Bacteria 2923
3 Ga0070658_10038169 3300005327 Unclassified 3874
4 Ga0070683_100063173 3300005329 Unclassified 3444
5 Ga0070683_100409468 3300005329 Bacteria 1293
6 Ga0070683_101065427 3300005329 Unclassified 776
7 Ga0070690_100235425 3300005330 Bacteria 1289
8 Ga0070670_100042390 3300005331 Bacteria 3912
9 Ga0070670_100341523 3300005331 Unclassified 1314
10 Ga0070680_100192566 3300005336 Bacteria 1718
11 Ga0068868_100094340 3300005338 Bacteria 2414
12 Ga0070660_100376941 3300005339 Bacteria 1171
13 Ga0070689_100192294 3300005340 Archaea 1662
14 Ga0070675_100214274 3300005354 Bacteria 1675
15 Ga0070675_100590613 3300005354 Unclassified 1007
16 Ga0070673_100232264 3300005364 Bacteria 1600
17 Ga0070667_100182026 3300005367 Bacteria 1859
18 Ga0070705_101378734 3300005440 Bacteria 587
19 Ga0070707_100546304 3300005468 Bacteria 1121
20 Ga0070684_101074049 3300005535 Bacteria 756
21 Ga0068853_100524680 3300005539 Bacteria 1120
22 Ga0070695_100464534 3300005545 Unclassified 972
23 Ga0070665_100486419 3300005548 Bacteria 1245
24 Ga0068855_100225726 3300005563 Unclassified 2099
25 Ga0068855_100410353 3300005563 Bacteria 1483
26 Ga0068854_101372276 3300005578 Unclassified 638
27 Ga0068856_100457582 3300005614 Bacteria 1297
28 Ga0070702_100028600 3300005615 Bacteria 3022
29 Ga0068864_101019299 3300005618 Bacteria 821
30 Ga0068866_10317907 3300005718 Unclassified 978
31 Ga0068863_100285557 3300005841 Bacteria 1599
32 Ga0068863_100662901 3300005841 Bacteria 1035
33 Ga0068860_100861349 3300005843 Bacteria 921
34 Ga0070712_101128742 3300006175 Unclassified 681
35 Ga0097621_100013197 3300006237 Bacteria 6147
36 Ga0068871_100015335 3300006358 Bacteria 5731
37 Ga0068871_100045544 3300006358 Bacteria 3531
38 Ga0075428_100016715 3300006844 Bacteria 8101
39 Ga0075431_100248180 3300006847 Bacteria 1809
40 Ga0075433_10130600 3300006852 Bacteria 2232
41 Ga0075434_100135508 3300006871 Bacteria 2481
42 Ga0075434_100269753 3300006871 Bacteria 1721
43 Ga0075434_100291343 3300006871 Bacteria 1652
44 Ga0075435_100316677 3300007076 Bacteria 1335
45 Ga0075435_101049288 3300007076 Unclassified 712
46 Ga0105240_10225428 3300009093 Bacteria 2181
47 Ga0105240_10239026 3300009093 Bacteria 2107
48 Ga0105240_11016594 3300009093 Bacteria 886
49 Ga0111539_10024145 3300009094 Bacteria 7465
50 Ga0111539_10297141 3300009094 Bacteria 1879
51 Ga0111539_12801410 3300009094 Unclassified 565
52 Ga0105245_10053439 3300009098 Unclassified 3626
53 Ga0105245_12049243 3300009098 Unclassified 626
54 Ga0105249_13355317 3300009553 Bacteria 515
55 Ga0105239_11098469 3300010375 Bacteria 916
56 Ga0157371_10175193 3300013102 Unclassified 1533
57 Ga0157374_10005675 3300013296 Bacteria 10522
58 Ga0157378_10127148 3300013297 Unclassified 2355
59 Ga0157378_12120135 3300013297 Bacteria 613
60 Ga0163162_10024202 3300013306 Bacteria 5992
61 Ga0157372_10079276 3300013307 Bacteria 3713
62 Ga0157375_10005752 3300013308 Bacteria 10785
63 Ga0163163_10000086 3300014325 Bacteria 102881
64 Ga0163163_10694364 3300014325 Bacteria 1081
65 Ga0157379_10568600 3300014968 Bacteria 1056
66 Ga0157376_10121683 3300014969 Bacteria 2314
67 Ga0207688_10119689 3300025901 Bacteria 1536
68 Ga0207645_10093599 3300025907 Bacteria 1934
69 Ga0207705_10065000 3300025909 Unclassified 2637
70 Ga0207684_10458052 3300025910 Bacteria 1095
71 Ga0207663_10002716 3300025916 Bacteria 8523
72 Ga0207660_10163685 3300025917 Bacteria 1718
73 Ga0207660_10289747 3300025917 Bacteria 1301
74 Ga0207662_10425927 3300025918 Bacteria 904
75 Ga0207657_10527970 3300025919 Bacteria 923
76 Ga0207646_10199691 3300025922 Bacteria 1806
77 Ga0207694_10210245 3300025924 Bacteria 1585
78 Ga0207650_10576073 3300025925 Unclassified 945
79 Ga0207659_10482470 3300025926 Bacteria 1047
80 Ga0207659_11283826 3300025926 Bacteria 629
81 Ga0207687_10198147 3300025927 Bacteria 1567
82 Ga0207664_10117433 3300025929 Bacteria 2221
83 Ga0207670_10018360 3300025936 Bacteria 4251
84 Ga0207670_10598394 3300025936 Unclassified 905
85 Ga0207661_10225885 3300025944 Unclassified 1656
86 Ga0207667_10350912 3300025949 Bacteria 1505
87 Ga0207651_10335976 3300025960 Bacteria 1268
88 Ga0207712_12027655 3300025961 Bacteria 515
89 Ga0207658_10269555 3300025986 Bacteria 1454
90 Ga0207639_10386013 3300026041 Bacteria 1259
91 Ga0207702_10417565 3300026078 Bacteria 1297
92 Ga0207641_10561315 3300026088 Bacteria 1114
93 Ga0207641_10766546 3300026088 Bacteria 953
94 Ga0207676_10605321 3300026095 Bacteria 1053
95 Ga0207674_10031042 3300026116 Bacteria 5615
96 Ga0207428_10097489 3300027907 Bacteria 2275
97 Ga0265337_1021222 3300028556 Bacteria 2026
98 Ga0265326_10041087 3300028558 Unclassified 1313
99 Ga0265326_10097149 3300028558 Bacteria 835
100 Ga0265323_10026759 3300028653 Bacteria 2172
101 Ga0265323_10132063 3300028653 Bacteria 808
102 Ga0265322_10063081 3300028654 Bacteria 1051
103 Ga0265338_10000382 3300028800 Bacteria 79298
104 Ga0265338_10004243 3300028800 Bacteria 19510
105 Ga0265338_10007158 3300028800 Bacteria 13968
106 Ga0265338_10010512 3300028800 Bacteria 10832
107 Ga0265338_10011393 3300028800 Bacteria 10279
108 Ga0265338_10103885 3300028800 Bacteria 2307
109 Ga0265338_10107510 3300028800 Bacteria 2256
110 Ga0265338_10417899 3300028800 Bacteria 954
111 Ga0265332_10154173 3300031238 Bacteria 960
112 Ga0265328_10015327 3300031239 Bacteria 3004
113 Ga0265328_10068284 3300031239 Bacteria 1306
114 Ga0265320_10001635 3300031240 Bacteria 16021
115 Ga0265320_10048975 3300031240 Unclassified 2059
116 Ga0265325_10077342 3300031241 Unclassified 1659
117 Ga0265329_10003135 3300031242 Bacteria 7281
118 Ga0265327_10011209 3300031251 Bacteria 6209
119 Ga0265316_10004791 3300031344 Bacteria 13343
120 Ga0265316_10143909 3300031344 Bacteria 1789
121 Ga0265316_10144672 3300031344 Bacteria 1783
122 Ga0265316_10214286 3300031344 Bacteria 1423
123 Ga0265316_10339670 3300031344 Bacteria 1088
124 Ga0265316_10495482 3300031344 Bacteria 873
125 Ga0265316_10506737 3300031344 Unclassified 862
126 Ga0265314_10000070 3300031711 Bacteria 153096
127 Ga0265314_10082509 3300031711 Bacteria 2115
128 Ga0265342_10270797 3300031712 Bacteria 901
129 Ga0265342_10477941 3300031712 Bacteria 637
130 Ga0265342_10521881 3300031712 Bacteria 604
131 Ga0373944_0259756 3300035089 Unclassified 643
132 Ga0373954_0182076 3300035118 Bacteria 1030
133 Ga0373956_0053309 3300035119 Bacteria 1821
134 Ga0373956_0153954 3300035119 Bacteria 1082
135 Ga0373937_0211655 3300036401 Bacteria 1824
136 Ga0373937_0719757 3300036401 Unclassified 945
137 Ga0436360_0474292 3300039438 Bacteria 950
138 Ga0436361_0847881 3300039447 Bacteria 11283
139 Ga0439435_0068294 3300042436 Bacteria 1048
140 Ga0451577_0015744 3300042876 Bacteria 7021
141 Ga0451577_0051532 3300042876 Bacteria 3674
142 Ga0451577_0462500 3300042876 Unclassified 1152
143 Ga0451577_1016533 3300042876 Bacteria 744
144 Ga0453684_0767282 3300044712 Bacteria 1043
145 Ga0466959_0324992 3300045049 Bacteria 1051
146 Ga0451576_0060162 3300045051 Bacteria 3963
147 Ga0451576_0139399 3300045051 Bacteria 2530
148 Ga0451576_0284941 3300045051 Bacteria 1727
149 Ga0495651_0751015 3300046462 Eukaryota 605
150 Ga0495582_0086438 3300046473 Bacteria 1745
151 Ga0495582_0584394 3300046473 Bacteria 646
152 Ga0495639_0099745 3300046475 Bacteria 1370
153 Ga0495664_0198717 3300046477 Bacteria 1215
154 Ga0495618_0510133 3300046514 Bacteria 724
155 Ga0495628_0060648 3300046516 Bacteria 2968
156 Ga0495628_0494308 3300046516 Bacteria 884
157 Ga0495628_0622440 3300046516 Bacteria 769
158 Ga0495630_0016360 3300046517 Bacteria 5418
159 Ga0495666_0052335 3300046526 Bacteria 1960
160 Ga0495586_0008919 3300046535 Bacteria 5338
161 Ga0495586_0462770 3300046535 Bacteria 731
162 Ga0495598_0151181 3300046537 Bacteria 810
163 Ga0495645_0052530 3300046543 Bacteria 2964
164 Ga0495645_0102910 3300046543 Bacteria 2029
165 Ga0495634_0408063 3300046642 Bacteria 806
166 Ga0495659_0000992 3300046664 Bacteria 9938
167 Ga0495599_0047900 3300046678 Unclassified 2679
168 Ga0495599_0085730 3300046678 Bacteria 1967
169 Ga0495658_0092626 3300046683 Bacteria 1792
170 Ga0495658_0393074 3300046683 Unclassified 883
171 Ga0495613_0210916 3300046689 Unclassified 1366
172 Ga0495613_0575159 3300046689 Bacteria 752
173 Ga0495624_0061477 3300046690 Bacteria 2353
174 Ga0495581_0063316 3300047315 Bacteria 2137
175 Ga0495674_0004942 3300047319 Bacteria 12819
176 Ga0495674_0176141 3300047319 Bacteria 1782
177 Ga0495676_0050839 3300047321 Bacteria 3321
178 Ga0495680_0342376 3300047322 Bacteria 1043
179 Ga0495675_0522221 3300047444 Bacteria 680
180 Ga0495684_0347405 3300047471 Bacteria 1054
181 Ga0495602_1018360 3300048088 Bacteria 546
182 Ga0496113_1012670 3300048916 Bacteria 654
183 Ga0496115_0045406 3300048918 Bacteria 3507
184 Ga0501034_0421824 3300049571 Bacteria 1255
185 Ga0501034_0971363 3300049571 Bacteria 734
186 nmdc:mga09592_510807_c1 3300050508 Bacteria 1034
187 nmdc:mga0qj67_306078_c1 3300050509 Bacteria 1287
188 nmdc:mga08y16_1172424_c1 3300050511 Unclassified 740
189 nmdc:mga08y16_18863_c1 3300050511 Bacteria 7266
190 nmdc:mga08y16_258626_c1 3300050511 Bacteria 1798
191 nmdc:mga0n895_1229021_c1 3300050512 Bacteria 722
192 nmdc:mga0n895_252305_c1 3300050512 Bacteria 1790
193 nmdc:mga0n895_270968_c1 3300050512 Bacteria 1722
194 nmdc:mga0n895_557122_c1 3300050512 Bacteria 1152
195 nmdc:mga0rr50_901100_c1 3300050513 Bacteria 754
196 nmdc:mga0a205_41721_c1 3300050515 Bacteria 4420
197 Ga0495601_0357755 3300053077 Bacteria 949
198 Ga0070686_100001166
199 rootL2_10166802
200 Ga0070658_10038169
201 Ga0070683_100063173
202 Ga0070683_100409468
203 Ga0070683_101065427
204 Ga0070690_100235425
205 Ga0070670_100042390
206 Ga0070670_100341523
207 Ga0070680_100192566
208 Ga0068868_100094340
209 Ga0070660_100376941
210 Ga0070689_100192294
211 Ga0070675_100214274
212 Ga0070675_100590613
213 Ga0070673_100232264
214 Ga0070667_100182026
215 Ga0070705_101378734
216 Ga0070707_100546304
217 Ga0070684_101074049
218 Ga0068853_100524680
219 Ga0070695_100464534
220 Ga0070665_100486419
221 Ga0068855_100225726
222 Ga0068855_100410353
223 Ga0068854_101372276
224 Ga0068856_100457582
225 Ga0070702_100028600
226 Ga0068864_101019299
227 Ga0068866_10317907
228 Ga0068863_100285557
229 Ga0068863_100662901
230 Ga0068860_100861349
231 Ga0070712_101128742
232 Ga0097621_100013197
233 Ga0068871_100015335
234 Ga0068871_100045544
235 Ga0075428_100016715
236 Ga0075431_100248180
237 Ga0075433_10130600
238 Ga0075434_100135508
239 Ga0075434_100269753
240 Ga0075434_100291343
241 Ga0075435_100316677
242 Ga0075435_101049288
243 Ga0105240_10225428
244 Ga0105240_10239026
245 Ga0105240_11016594
246 Ga0111539_10024145
247 Ga0111539_10297141
248 Ga0111539_12801410
249 Ga0105245_10053439
250 Ga0105245_12049243
251 Ga0105249_13355317
252 Ga0105239_11098469
253 Ga0157371_10175193
254 Ga0157374_10005675
255 Ga0157378_10127148
256 Ga0157378_12120135
257 Ga0163162_10024202
258 Ga0157372_10079276
259 Ga0157375_10005752
260 Ga0163163_10000086
261 Ga0163163_10694364
262 Ga0157379_10568600
263 Ga0157376_10121683
264 Ga0207688_10119689
265 Ga0207645_10093599
266 Ga0207705_10065000
267 Ga0207684_10458052
268 Ga0207663_10002716
269 Ga0207660_10163685
270 Ga0207660_10289747
271 Ga0207662_10425927
272 Ga0207657_10527970
273 Ga0207646_10199691
274 Ga0207694_10210245
275 Ga0207650_10576073
276 Ga0207659_10482470
277 Ga0207659_11283826
278 Ga0207687_10198147
279 Ga0207664_10117433
280 Ga0207670_10018360
281 Ga0207670_10598394
282 Ga0207661_10225885
283 Ga0207667_10350912
284 Ga0207651_10335976
285 Ga0207712_12027655
286 Ga0207658_10269555
287 Ga0207639_10386013
288 Ga0207702_10417565
289 Ga0207641_10561315
290 Ga0207641_10766546
291 Ga0207676_10605321
292 Ga0207674_10031042
293 Ga0207428_10097489
294 Ga0265337_1021222
295 Ga0265326_10041087
296 Ga0265326_10097149
297 Ga0265323_10026759
298 Ga0265323_10132063
299 Ga0265322_10063081
300 Ga0265338_10000382
301 Ga0265338_10004243
302 Ga0265338_10007158
303 Ga0265338_10010512
304 Ga0265338_10011393
305 Ga0265338_10103885
306 Ga0265338_10107510
307 Ga0265338_10417899
308 Ga0265332_10154173
309 Ga0265328_10015327
310 Ga0265328_10068284
311 Ga0265320_10001635
312 Ga0265320_10048975
313 Ga0265325_10077342
314 Ga0265329_10003135
315 Ga0265327_10011209
316 Ga0265316_10004791
317 Ga0265316_10143909
318 Ga0265316_10144672
319 Ga0265316_10214286
320 Ga0265316_10339670
321 Ga0265316_10495482
322 Ga0265316_10506737
323 Ga0265314_10000070
324 Ga0265314_10082509
325 Ga0265342_10270797
326 Ga0265342_10477941
327 Ga0265342_10521881
328 Ga0373944_0259756
329 Ga0373954_0182076
330 Ga0373956_0053309
331 Ga0373956_0153954
332 Ga0373937_0211655
333 Ga0373937_0719757
334 Ga0436360_0474292
335 Ga0436361_0847881
336 Ga0439435_0068294
337 Ga0451577_0015744
338 Ga0451577_0051532
339 Ga0451577_0462500
340 Ga0451577_1016533
341 Ga0453684_0767282
342 Ga0466959_0324992
343 Ga0451576_0060162
344 Ga0451576_0139399
345 Ga0451576_0284941
346 Ga0495651_0751015
347 Ga0495582_0086438
348 Ga0495582_0584394
349 Ga0495639_0099745
350 Ga0495664_0198717
351 Ga0495618_0510133
352 Ga0495628_0060648
353 Ga0495628_0494308
354 Ga0495628_0622440
355 Ga0495630_0016360
356 Ga0495666_0052335
357 Ga0495586_0008919
358 Ga0495586_0462770
359 Ga0495598_0151181
360 Ga0495645_0052530
361 Ga0495645_0102910
362 Ga0495634_0408063
363 Ga0495659_0000992
364 Ga0495599_0047900
365 Ga0495599_0085730
366 Ga0495658_0092626
367 Ga0495658_0393074
368 Ga0495613_0210916
369 Ga0495613_0575159
370 Ga0495624_0061477
371 Ga0495581_0063316
372 Ga0495674_0004942
373 Ga0495674_0176141
374 Ga0495676_0050839
375 Ga0495680_0342376
376 Ga0495675_0522221
377 Ga0495684_0347405
378 Ga0495602_1018360
379 Ga0496113_1012670
380 Ga0496115_0045406
381 Ga0501034_0421824
382 Ga0501034_0971363
383 nmdc:mga09592_510807_c1
384 nmdc:mga0qj67_306078_c1
385 nmdc:mga08y16_1172424_c1
386 nmdc:mga08y16_18863_c1
387 nmdc:mga08y16_258626_c1
388 nmdc:mga0n895_1229021_c1
389 nmdc:mga0n895_252305_c1
390 nmdc:mga0n895_270968_c1
391 nmdc:mga0n895_557122_c1
392 nmdc:mga0rr50_901100_c1
393 nmdc:mga0a205_41721_c1
394 Ga0495601_0357755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

25

172

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k2x-assembly1.cif.gz_B crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine 0.9592 2 156
3ikf-assembly1.cif.gz_B crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 717, imidazo[2,,1-b][1,3]thiazol-6-ylmethanol 0.9581 2 156
3f0f-assembly1.cif.gz_C co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with hydrolyzed cdp 0.9577 2 158
3k14-assembly1.cif.gz_B co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 535, ethyl 3-methyl-5,6-dihydroimidazo[2,1-b][1,3]thiazole-2-carboxylate 0.9574 2 156
3jvh-assembly1.cif.gz_B crystal structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase from burkholderia pseudomallei with fol fragment 8395 0.9572 2 156
ID Description Score Start End Superfamily
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9434 1 158 3.30.1330.50
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9394 2 158 3.30.1330.50
1iv1B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9383 4 156 3.30.1330.50
3t80F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9334 1 155 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9321 1 158 3.30.1330.50
ID Description Score Start End GO Terms
AF-A0A258NW46-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9634 2 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A7Y0C2Q5-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9631 1 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A1WR07-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9614 1 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A495FEQ5-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9609 1 158 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A554WDP3-F1-model_v4 Bifunctional enzyme IspD/IspF [Includes: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT); 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12)] 0.9598 2 157 GO:0008685
GO:0016114
GO:0019288
GO:0046872
GO:0050518

Map