F302674

General Info

Members Datasets Scaffolds Average Seq Length
197 130 394 90

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101853537|Ga0070708_1018535372
Length 106
Sequence MAEFFKRDSLAVMDDVNALRERIKNLMVENLMLQVTAAEIKDDQPLFGPGSLGLDSVDALQLVVALDKHFGLKIPDPAAAKEVLQSVNTIVAALQNKLSGPQGSPL

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 1.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 0.51
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 26.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_101853537 3300005445 Bacteria 559
2 Ga0065707_10892248 3300005295 Unclassified 569
3 Ga0070683_100664901 3300005329 Bacteria 997
4 Ga0070690_100874603 3300005330 Bacteria 701
5 Ga0070690_101357602 3300005330 Unclassified 571
6 Ga0070690_101497566 3300005330 Unclassified 545
7 Ga0070677_10320824 3300005333 Bacteria 793
8 Ga0070682_101235358 3300005337 Bacteria 632
9 Ga0068868_102243017 3300005338 Unclassified 520
10 Ga0070660_100744005 3300005339 Bacteria 823
11 Ga0070689_100052083 3300005340 Bacteria 3165
12 Ga0070689_100218323 3300005340 Bacteria 1563
13 Ga0070689_100250155 3300005340 Bacteria 1462
14 Ga0070669_100871881 3300005353 Bacteria 768
15 Ga0070667_102260933 3300005367 Unclassified 512
16 Ga0070709_11311213 3300005434 Bacteria 584
17 Ga0070714_100394944 3300005435 Unclassified 1306
18 Ga0070714_101459147 3300005435 Bacteria 668
19 Ga0070714_102375185 3300005435 Bacteria 515
20 Ga0070701_10302310 3300005438 Bacteria 984
21 Ga0070711_100988804 3300005439 Bacteria 721
22 Ga0070705_101046232 3300005440 Bacteria 665
23 Ga0070700_100314240 3300005441 Bacteria 1148
24 Ga0070708_101053251 3300005445 Bacteria 762
25 Ga0070681_10357128 3300005458 Bacteria 1371
26 Ga0070681_10621611 3300005458 Bacteria 995
27 Ga0070681_10978446 3300005458 Bacteria 766
28 Ga0070685_10079426 3300005466 Bacteria 1963
29 Ga0070685_10303354 3300005466 Bacteria 1077
30 Ga0070706_100337057 3300005467 Bacteria 1406
31 Ga0070706_101056881 3300005467 Bacteria 748
32 Ga0070698_100573547 3300005471 Bacteria 1068
33 Ga0070679_100650575 3300005530 Bacteria 997
34 Ga0070679_100967399 3300005530 Bacteria 795
35 Ga0070684_100429856 3300005535 Bacteria 1219
36 Ga0068853_100362357 3300005539 Bacteria 1351
37 Ga0068853_101500541 3300005539 Bacteria 653
38 Ga0070686_100091317 3300005544 Bacteria 2037
39 Ga0070695_100537448 3300005545 Bacteria 909
40 Ga0070696_100748713 3300005546 Bacteria 800
41 Ga0070704_100058293 3300005549 Bacteria 2750
42 Ga0068855_100022515 3300005563 Bacteria 7552
43 Ga0070664_102098585 3300005564 Unclassified 536
44 Ga0068856_100961004 3300005614 Unclassified 873
45 Ga0070702_100217167 3300005615 Bacteria 1276
46 Ga0068859_100735122 3300005617 Unclassified 1076
47 Ga0068859_101266538 3300005617 Bacteria 812
48 Ga0068864_101311844 3300005618 Bacteria 724
49 Ga0068858_101659702 3300005842 Unclassified 631
50 Ga0068858_102535674 3300005842 Unclassified 506
51 Ga0068862_102040457 3300005844 Bacteria 584
52 Ga0081455_10630432 3300005937 Bacteria 694
53 Ga0075363_100283432 3300006048 Bacteria 959
54 Ga0070716_100272195 3300006173 Bacteria 1164
55 Ga0097621_100177902 3300006237 Unclassified 1837
56 Ga0097621_101437962 3300006237 Unclassified 653
57 Ga0068871_100102728 3300006358 Bacteria 2396
58 Ga0068871_101258152 3300006358 Bacteria 695
59 Ga0075428_100448407 3300006844 Bacteria 1382
60 Ga0075433_10932115 3300006852 Bacteria 757
61 Ga0068865_100775749 3300006881 Bacteria 825
62 Ga0097620_100735211 3300006931 Unclassified 1076
63 Ga0097620_101267084 3300006931 Bacteria 812
64 Ga0105240_10185437 3300009093 Bacteria 2451
65 Ga0105240_10202174 3300009093 Bacteria 2327
66 Ga0105240_10203378 3300009093 Bacteria 2319
67 Ga0105240_11541040 3300009093 Unclassified 696
68 Ga0111539_10235624 3300009094 Bacteria 2131
69 Ga0111539_10392492 3300009094 Bacteria 1616
70 Ga0111539_11109597 3300009094 Bacteria 919
71 Ga0111539_11195911 3300009094 Bacteria 883
72 Ga0111539_12994864 3300009094 Bacteria 546
73 Ga0105241_10398023 3300009174 Bacteria 1207
74 Ga0105242_11851481 3300009176 Unclassified 643
75 Ga0105237_12229894 3300009545 Bacteria 557
76 Ga0105238_10582755 3300009551 Unclassified 1125
77 Ga0105238_11292598 3300009551 Unclassified 755
78 Ga0105238_11342661 3300009551 Unclassified 741
79 Ga0105239_12483133 3300010375 Bacteria 604
80 Ga0105246_11380411 3300011119 Bacteria 656
81 Ga0157371_11621736 3300013102 Bacteria 507
82 Ga0157370_10635681 3300013104 Unclassified 976
83 Ga0157369_11215484 3300013105 Unclassified 769
84 Ga0157369_11290813 3300013105 Bacteria 744
85 Ga0157374_11005889 3300013296 Bacteria 853
86 Ga0157374_11109225 3300013296 Bacteria 812
87 Ga0157374_11347336 3300013296 Bacteria 736
88 Ga0157374_11530260 3300013296 Bacteria 691
89 Ga0157374_12078949 3300013296 Bacteria 594
90 Ga0157378_10405867 3300013297 Unclassified 1344
91 Ga0157378_10856989 3300013297 Bacteria 937
92 Ga0157378_13153801 3300013297 Bacteria 512
93 Ga0157378_13243015 3300013297 Unclassified 505
94 Ga0157372_10153582 3300013307 Bacteria 2658
95 Ga0157372_10685377 3300013307 Bacteria 1193
96 Ga0157372_11015497 3300013307 Bacteria 960
97 Ga0157375_10000116 3300013308 Bacteria 77874
98 Ga0163163_11757339 3300014325 Bacteria 681
99 Ga0157379_11568876 3300014968 Bacteria 642
100 Ga0163161_11733442 3300017792 Unclassified 554
101 Ga0206356_10041366 3300020070 Bacteria 734
102 Ga0224712_10639759 3300022467 Archaea 521
103 Ga0207680_10171422 3300025903 Bacteria 1462
104 Ga0207705_10254241 3300025909 Bacteria 1340
105 Ga0207684_11399706 3300025910 Unclassified 572
106 Ga0207707_10202913 3300025912 Bacteria 1728
107 Ga0207707_11299087 3300025912 Bacteria 585
108 Ga0207695_10546778 3300025913 Bacteria 1039
109 Ga0207695_10780265 3300025913 Bacteria 836
110 Ga0207695_11587265 3300025913 Bacteria 535
111 Ga0207660_10739334 3300025917 Bacteria 803
112 Ga0207652_10371390 3300025921 Bacteria 1291
113 Ga0207652_11088907 3300025921 Bacteria 699
114 Ga0207646_11042629 3300025922 Bacteria 721
115 Ga0207694_10022048 3300025924 Bacteria 4830
116 Ga0207694_10422627 3300025924 Unclassified 1110
117 Ga0207650_11014166 3300025925 Bacteria 706
118 Ga0207664_10484148 3300025929 Unclassified 1107
119 Ga0207670_11225354 3300025936 Bacteria 635
120 Ga0207704_10665227 3300025938 Bacteria 859
121 Ga0207711_11387045 3300025941 Unclassified 645
122 Ga0207661_10685697 3300025944 Bacteria 942
123 Ga0207661_10822108 3300025944 Bacteria 855
124 Ga0207667_10366115 3300025949 Unclassified 1470
125 Ga0207651_10303149 3300025960 Bacteria 1329
126 Ga0207658_11573064 3300025986 Unclassified 601
127 Ga0207639_10578889 3300026041 Bacteria 1033
128 Ga0207708_10144168 3300026075 Unclassified 1871
129 Ga0207702_10043439 3300026078 Unclassified 3773
130 Ga0207641_10939059 3300026088 Bacteria 860
131 Ga0207641_11028146 3300026088 Unclassified 821
132 Ga0207641_11152530 3300026088 Bacteria 774
133 Ga0207674_10289020 3300026116 Bacteria 1588
134 Ga0207698_12516336 3300026142 Bacteria 525
135 Ga0207428_11213944 3300027907 Bacteria 524
136 Ga0265326_10014928 3300028558 Bacteria 2259
137 Ga0265326_10156557 3300028558 Unclassified 651
138 Ga0265334_10042249 3300028573 Bacteria 1778
139 Ga0265334_10191166 3300028573 Unclassified 713
140 Ga0265334_10260840 3300028573 Unclassified 596
141 Ga0265318_10105625 3300028577 Bacteria 1036
142 Ga0265336_10001840 3300028666 Bacteria 9241
143 Ga0265338_10000243 3300028800 Bacteria 100885
144 Ga0265338_10000399 3300028800 Bacteria 77917
145 Ga0265338_10000420 3300028800 Bacteria 75959
146 Ga0265338_10001031 3300028800 Bacteria 46585
147 Ga0265338_10027242 3300028800 Bacteria 5738
148 Ga0265338_10459742 3300028800 Bacteria 900
149 Ga0265324_10000328 3300029957 Bacteria 34898
150 Ga0265324_10058050 3300029957 Unclassified 1324
151 Ga0265339_10157042 3300031249 Bacteria 1147
152 Ga0265327_10004810 3300031251 Bacteria 11723
153 Ga0265314_10422711 3300031711 Bacteria 716
154 Ga0307413_12037264 3300031824 Bacteria 518
155 Ga0307411_10028621 3300032005 Unclassified 3391
156 Ga0373944_0016840 3300035089 Bacteria 2067
157 Ga0373923_0379407 3300035111 Unclassified 678
158 Ga0373935_0527688 3300035692 Bacteria 859
159 Ga0373925_0261366 3300037068 Bacteria 1391
160 Ga0373925_0699620 3300037068 Bacteria 836
161 Ga0451849_0409484 3300041505 Unclassified 504
162 Ga0451577_0257864 3300042876 Bacteria 1579
163 Ga0453684_0003475 3300044712 Bacteria 35376
164 Ga0453684_2384844 3300044712 Bacteria 524
165 Ga0451576_0018567 3300045051 Bacteria 7615
166 Ga0451576_0171955 3300045051 Bacteria 2261
167 Ga0451576_0361638 3300045051 Bacteria 1520
168 Ga0451576_0577900 3300045051 Bacteria 1181
169 Ga0451576_1178009 3300045051 Bacteria 801
170 Ga0451576_1530508 3300045051 Unclassified 693
171 Ga0451576_1770456 3300045051 Bacteria 639
172 Ga0451576_2698053 3300045051 Unclassified 506
173 Ga0495629_0990226 3300046459 Unclassified 548
174 Ga0495653_0225094 3300046463 Bacteria 1259
175 Ga0495653_0885182 3300046463 Unclassified 533
176 Ga0495628_0058333 3300046516 Bacteria 3034
177 Ga0495630_0387080 3300046517 Bacteria 1071
178 Ga0495652_0090237 3300046529 Unclassified 2508
179 Ga0495586_0859627 3300046535 Unclassified 523
180 Ga0495659_0174613 3300046664 Unclassified 873
181 Ga0495657_0282385 3300046675 Bacteria 993
182 Ga0495599_0563714 3300046678 Unclassified 666
183 Ga0495646_0325825 3300046680 Unclassified 808
184 Ga0495624_0125843 3300046690 Bacteria 1573
185 Ga0495675_0062686 3300047444 Unclassified 2354
186 Ga0495684_0587957 3300047471 Unclassified 753
187 Ga0496115_0246448 3300048918 Unclassified 1472
188 Ga0501033_0025734 3300049570 Bacteria 4433
189 Ga0501034_0211278 3300049571 Bacteria 1896
190 Ga0501257_228349 3300049686 Bacteria 545
191 nmdc:mga03n38_282760_c1 3300050490 Bacteria 886
192 nmdc:mga06r32_320504_c1 3300050510 Bacteria 1535
193 nmdc:mga08y16_1849944_c1 3300050511 Bacteria 556
194 nmdc:mga08y16_262247_c1 3300050511 Bacteria 1784
195 nmdc:mga08y16_430147_c1 3300050511 Unclassified 1348
196 nmdc:mga08y16_515462_c1 3300050511 Bacteria 1213
197 nmdc:mga0a205_858504_c1 3300050515 Bacteria 755
198 Ga0070708_101853537
199 Ga0065707_10892248
200 Ga0070683_100664901
201 Ga0070690_100874603
202 Ga0070690_101357602
203 Ga0070690_101497566
204 Ga0070677_10320824
205 Ga0070682_101235358
206 Ga0068868_102243017
207 Ga0070660_100744005
208 Ga0070689_100052083
209 Ga0070689_100218323
210 Ga0070689_100250155
211 Ga0070669_100871881
212 Ga0070667_102260933
213 Ga0070709_11311213
214 Ga0070714_100394944
215 Ga0070714_101459147
216 Ga0070714_102375185
217 Ga0070701_10302310
218 Ga0070711_100988804
219 Ga0070705_101046232
220 Ga0070700_100314240
221 Ga0070708_101053251
222 Ga0070681_10357128
223 Ga0070681_10621611
224 Ga0070681_10978446
225 Ga0070685_10079426
226 Ga0070685_10303354
227 Ga0070706_100337057
228 Ga0070706_101056881
229 Ga0070698_100573547
230 Ga0070679_100650575
231 Ga0070679_100967399
232 Ga0070684_100429856
233 Ga0068853_100362357
234 Ga0068853_101500541
235 Ga0070686_100091317
236 Ga0070695_100537448
237 Ga0070696_100748713
238 Ga0070704_100058293
239 Ga0068855_100022515
240 Ga0070664_102098585
241 Ga0068856_100961004
242 Ga0070702_100217167
243 Ga0068859_100735122
244 Ga0068859_101266538
245 Ga0068864_101311844
246 Ga0068858_101659702
247 Ga0068858_102535674
248 Ga0068862_102040457
249 Ga0081455_10630432
250 Ga0075363_100283432
251 Ga0070716_100272195
252 Ga0097621_100177902
253 Ga0097621_101437962
254 Ga0068871_100102728
255 Ga0068871_101258152
256 Ga0075428_100448407
257 Ga0075433_10932115
258 Ga0068865_100775749
259 Ga0097620_100735211
260 Ga0097620_101267084
261 Ga0105240_10185437
262 Ga0105240_10202174
263 Ga0105240_10203378
264 Ga0105240_11541040
265 Ga0111539_10235624
266 Ga0111539_10392492
267 Ga0111539_11109597
268 Ga0111539_11195911
269 Ga0111539_12994864
270 Ga0105241_10398023
271 Ga0105242_11851481
272 Ga0105237_12229894
273 Ga0105238_10582755
274 Ga0105238_11292598
275 Ga0105238_11342661
276 Ga0105239_12483133
277 Ga0105246_11380411
278 Ga0157371_11621736
279 Ga0157370_10635681
280 Ga0157369_11215484
281 Ga0157369_11290813
282 Ga0157374_11005889
283 Ga0157374_11109225
284 Ga0157374_11347336
285 Ga0157374_11530260
286 Ga0157374_12078949
287 Ga0157378_10405867
288 Ga0157378_10856989
289 Ga0157378_13153801
290 Ga0157378_13243015
291 Ga0157372_10153582
292 Ga0157372_10685377
293 Ga0157372_11015497
294 Ga0157375_10000116
295 Ga0163163_11757339
296 Ga0157379_11568876
297 Ga0163161_11733442
298 Ga0206356_10041366
299 Ga0224712_10639759
300 Ga0207680_10171422
301 Ga0207705_10254241
302 Ga0207684_11399706
303 Ga0207707_10202913
304 Ga0207707_11299087
305 Ga0207695_10546778
306 Ga0207695_10780265
307 Ga0207695_11587265
308 Ga0207660_10739334
309 Ga0207652_10371390
310 Ga0207652_11088907
311 Ga0207646_11042629
312 Ga0207694_10022048
313 Ga0207694_10422627
314 Ga0207650_11014166
315 Ga0207664_10484148
316 Ga0207670_11225354
317 Ga0207704_10665227
318 Ga0207711_11387045
319 Ga0207661_10685697
320 Ga0207661_10822108
321 Ga0207667_10366115
322 Ga0207651_10303149
323 Ga0207658_11573064
324 Ga0207639_10578889
325 Ga0207708_10144168
326 Ga0207702_10043439
327 Ga0207641_10939059
328 Ga0207641_11028146
329 Ga0207641_11152530
330 Ga0207674_10289020
331 Ga0207698_12516336
332 Ga0207428_11213944
333 Ga0265326_10014928
334 Ga0265326_10156557
335 Ga0265334_10042249
336 Ga0265334_10191166
337 Ga0265334_10260840
338 Ga0265318_10105625
339 Ga0265336_10001840
340 Ga0265338_10000243
341 Ga0265338_10000399
342 Ga0265338_10000420
343 Ga0265338_10001031
344 Ga0265338_10027242
345 Ga0265338_10459742
346 Ga0265324_10000328
347 Ga0265324_10058050
348 Ga0265339_10157042
349 Ga0265327_10004810
350 Ga0265314_10422711
351 Ga0307413_12037264
352 Ga0307411_10028621
353 Ga0373944_0016840
354 Ga0373923_0379407
355 Ga0373935_0527688
356 Ga0373925_0261366
357 Ga0373925_0699620
358 Ga0451849_0409484
359 Ga0451577_0257864
360 Ga0453684_0003475
361 Ga0453684_2384844
362 Ga0451576_0018567
363 Ga0451576_0171955
364 Ga0451576_0361638
365 Ga0451576_0577900
366 Ga0451576_1178009
367 Ga0451576_1530508
368 Ga0451576_1770456
369 Ga0451576_2698053
370 Ga0495629_0990226
371 Ga0495653_0225094
372 Ga0495653_0885182
373 Ga0495628_0058333
374 Ga0495630_0387080
375 Ga0495652_0090237
376 Ga0495586_0859627
377 Ga0495659_0174613
378 Ga0495657_0282385
379 Ga0495599_0563714
380 Ga0495646_0325825
381 Ga0495624_0125843
382 Ga0495675_0062686
383 Ga0495684_0587957
384 Ga0496115_0246448
385 Ga0501033_0025734
386 Ga0501034_0211278
387 Ga0501257_228349
388 nmdc:mga03n38_282760_c1
389 nmdc:mga06r32_320504_c1
390 nmdc:mga08y16_1849944_c1
391 nmdc:mga08y16_262247_c1
392 nmdc:mga08y16_430147_c1
393 nmdc:mga08y16_515462_c1
394 nmdc:mga0a205_858504_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

21

94

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eje-assembly1.cif.gz_A crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein 0.9127 7 85
3eje-assembly4.cif.gz_G crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein 0.9055 7 80
7pdi-assembly1.cif.gz_A crystal structure of the holo-acyl carrier protein (holo-acpp) from pseudomonas putida kt2440. produced as an apo/holo mixture. 0.9044 7 86
2fac-assembly1.cif.gz_A crystal structure of e. coli hexanoyl-acp 0.9029 7 85
8jfh-assembly1.cif.gz_E crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery 0.8998 6 84
ID Description Score Start End Superfamily
af_Q7KWJ1_42_137_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9154 4 87 1.10.1200.10
3ejeA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9127 7 85 1.10.1200.10
3gzmA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9075 4 84 1.10.1200.10
af_P0A6A8_1_78_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9039 7 86 1.10.1200.10
3gzmB00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8957 4 84 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A7C4KJT2-F1-model_v4 Acyl carrier protein 1.001 4 86
AF-A0A4Q2XDK9-F1-model_v4 Acyl carrier protein 1 6 86
AF-A0A2V5JTH9-F1-model_v4 Phosphopantetheine-binding protein 0.9935 7 88
AF-A0A5R8K9W2-F1-model_v4 Acyl carrier protein 0.9931 1 88
AF-A0A6N6QD03-F1-model_v4 Acyl carrier protein 0.9924 6 88

Map