F302316

General Info

Members Datasets Scaffolds Average Seq Length
196 146 392 232

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006393351|3006393939
Length 257
Sequence AVLEVIALDVEDAVAAQAGGADRLELVTEMAADGLTPAPAVVAAIRDAVGIDLRVMLRLSDGFAAGDVERLVGVAGELRDAGADQFVLGFLDPVGDVDLAAVERLVGALDGSPWTFHRAIDRAADRDALRKTLSGLPGLDTYLTAGAPGGVDDGLDTLIAEAAHTGRPGYEPRIMVGGGLRLDHVPRLRAAGIDAFHIGGAARPGGWQGPVSAEAVARWRAELDGETARDGETVRTGETARTGETARVGPAVRRAGN

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
8 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
9 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
10 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
11 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
12 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
13 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
14 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
18 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
19 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
20 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
21 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
22 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
23 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
24 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
25 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
26 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
27 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
28 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
29 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
30 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
31 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
32 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
33 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
34 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
35 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
36 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
37 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
38 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
39 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
40 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
41 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
42 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
43 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
44 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
45 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
46 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
47 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
48 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
49 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
50 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
51 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
52 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
53 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
54 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
55 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
56 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
57 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
58 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
59 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
60 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
61 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
62 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
65 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
66 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
67 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
68 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
69 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
70 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
71 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
72 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
73 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
78 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
79 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
80 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
81 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
82 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
83 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
86 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
89 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
90 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
91 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
92 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
96 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
97 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
113 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
114 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
115 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
116 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
117 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
118 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
119 2643221578 Streptomyces sp. Root63 Isolate Unclassified
120 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
121 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
122 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
123 2808606448 Streptomyces sp. 193411 Isolate Unclassified
124 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
125 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
126 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
127 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
128 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
129 2862574272 Streptomyces sp. AcE210 Isolate Nodule
130 2867369537 Streptomyces sp. Z26 Isolate Unclassified
131 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
132 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
133 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
134 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
135 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
136 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
137 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
138 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
139 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
140 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
141 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
142 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
143 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
144 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
145 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
146 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.65
Metatranscriptomes 0
Isolates 17.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 1.02
Rhizoplane 0.51
Rhizosphere 79.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10011459 3300003316 Bacteria 9953
2 rootH2_10012573 3300003320 Bacteria 8488
3 rootH1_10004479 3300003323 Bacteria 10663
4 rootH1_10023036 3300003323 Bacteria 2845
5 Ga0068868_100529276 3300005338 Bacteria 1036
6 Ga0068853_100372580 3300005539 Bacteria 1332
7 Ga0070665_100454988 3300005548 Bacteria 1290
8 Ga0105244_10061092 3300009036 Bacteria 1897
9 Ga0105245_10483719 3300009098 Bacteria 1252
10 Ga0105246_10001000 3300011119 Bacteria 16237
11 Ga0182006_1063761 3300015261 Bacteria 1383
12 Ga0182007_10005492 3300015262 Bacteria 5561
13 Ga0209758_1034411 3300025297 Bacteria 2016
14 Ga0207426_1016133 3300025302 Bacteria 2691
15 Ga0207687_10471096 3300025927 Bacteria 1044
16 Ga0207639_10102076 3300026041 Bacteria 2321
17 Ga0207678_10565799 3300026067 Bacteria 995
18 Ga0307515_10000315 3300028794 Bacteria 119286
19 Ga0307515_10000732 3300028794 Bacteria 75720
20 Ga0307515_10338523 3300028794 Bacteria 1158
21 Ga0307511_10001033 3300030521 Bacteria 29558
22 Ga0307512_10002037 3300030522 Bacteria 26685
23 Ga0307512_10110777 3300030522 Bacteria 1810
24 Ga0307512_10142433 3300030522 Bacteria 1462
25 Ga0307513_10042373 3300031456 Bacteria 5013
26 Ga0307513_10299174 3300031456 Bacteria 1376
27 Ga0307508_10021767 3300031616 Bacteria 5833
28 Ga0307514_10151106 3300031649 Bacteria 1557
29 Ga0307514_10252193 3300031649 Bacteria 1043
30 Ga0307516_10003793 3300031730 Bacteria 19187
31 Ga0307516_10005429 3300031730 Bacteria 15262
32 Ga0307516_10024574 3300031730 Bacteria 6154
33 Ga0307516_10064168 3300031730 Bacteria 3553
34 Ga0307413_10368498 3300031824 Bacteria 1115
35 Ga0307518_10075451 3300031838 Bacteria 2438
36 Ga0307510_10005521 3300033180 Bacteria 15076
37 Ga0395900_0030175 3300037418 Bacteria 5566
38 Ga0395898_0007727 3300037466 Bacteria 11416
39 Ga0395898_0159894 3300037466 Bacteria 2154
40 Ga0395901_0031315 3300038443 Bacteria 5485
41 Ga0439436_0019223 3300041404 Bacteria 2039
42 Ga0439439_0037709 3300041406 Bacteria 1247
43 Ga0451853_3511591 3300041512 Bacteria 2611
44 Ga0439433_0007844 3300041999 Bacteria 2309
45 Ga0466972_0001145 3300044658 Bacteria 12695
46 Ga0466965_0010043 3300044683 Bacteria 4406
47 Ga0466966_0004330 3300044684 Bacteria 9355
48 Ga0466961_0003595 3300044693 Bacteria 9676
49 Ga0466963_0002564 3300044694 Bacteria 10191
50 Ga0466964_0003469 3300044706 Bacteria 5755
51 Ga0466971_0003308 3300044719 Bacteria 6883
52 Ga0466971_0069851 3300044719 Bacteria 1594
53 Ga0466971_0150637 3300044719 Bacteria 1086
54 Ga0466970_0002452 3300044765 Bacteria 8965
55 Ga0466960_0233372 3300044901 Bacteria 1016
56 Ga0466959_0000404 3300045049 Bacteria 25274
57 Ga0466958_0000992 3300045836 Bacteria 12828
58 Ga0466967_0139816 3300045976 Bacteria 2254
59 Ga0495603_0000900 3300046455 Bacteria 17124
60 Ga0495629_0006972 3300046459 Bacteria 8332
61 Ga0495629_0037718 3300046459 Bacteria 3405
62 Ga0495641_0162239 3300046461 Bacteria 1000
63 Ga0495605_0002215 3300046474 Bacteria 12139
64 Ga0495662_0038321 3300046476 Bacteria 2316
65 Ga0495664_0040433 3300046477 Bacteria 2757
66 Ga0495585_0062654 3300046492 Bacteria 2042
67 Ga0495585_0154553 3300046492 Bacteria 1194
68 Ga0495594_0002761 3300046499 Bacteria 9109
69 Ga0495594_0019673 3300046499 Bacteria 3590
70 Ga0495596_0163766 3300046500 Bacteria 864
71 Ga0495607_0184566 3300046501 Bacteria 1043
72 Ga0495583_0022644 3300046506 Bacteria 3199
73 Ga0495606_0129251 3300046507 Bacteria 1503
74 Ga0495608_0029512 3300046511 Bacteria 3719
75 Ga0495610_0042533 3300046512 Bacteria 2271
76 Ga0495616_0021427 3300046513 Bacteria 3500
77 Ga0495620_0003173 3300046515 Bacteria 9431
78 Ga0495628_0088749 3300046516 Bacteria 2395
79 Ga0495643_0007450 3300046522 Bacteria 7050
80 Ga0495643_0047678 3300046522 Bacteria 2319
81 Ga0495648_0035699 3300046524 Bacteria 3219
82 Ga0495648_0049206 3300046524 Bacteria 2586
83 Ga0495642_0140255 3300046528 Bacteria 1043
84 Ga0495642_0159368 3300046528 Bacteria 978
85 Ga0495652_0071546 3300046529 Bacteria 2894
86 Ga0495652_0282263 3300046529 Bacteria 1215
87 Ga0495640_0006969 3300046533 Bacteria 8898
88 Ga0495597_0023714 3300046542 Bacteria 2837
89 Ga0495622_0017617 3300046557 Bacteria 3325
90 Ga0495668_0039448 3300046616 Bacteria 2636
91 Ga0495625_0007428 3300046660 Bacteria 9536
92 Ga0495625_0102304 3300046660 Bacteria 1966
93 Ga0495635_0077641 3300046663 Bacteria 2274
94 Ga0495588_0006246 3300046674 Bacteria 5354
95 Ga0495588_0084418 3300046674 Bacteria 1659
96 Ga0495657_0041606 3300046675 Bacteria 3143
97 Ga0495657_0160425 3300046675 Bacteria 1391
98 Ga0495623_0074505 3300046679 Bacteria 2109
99 Ga0495613_0003620 3300046689 Bacteria 11579
100 Ga0495613_0048162 3300046689 Bacteria 3147
101 Ga0495613_0083438 3300046689 Bacteria 2320
102 Ga0495613_0096446 3300046689 Bacteria 2138
103 Ga0495613_0407563 3300046689 Bacteria 927
104 Ga0495624_0024021 3300046690 Bacteria 4014
105 Ga0495624_0162398 3300046690 Bacteria 1364
106 Ga0495671_0014081 3300046692 Bacteria 4312
107 Ga0495671_0145816 3300046692 Bacteria 1153
108 Ga0495649_0038502 3300046694 Bacteria 2623
109 Ga0495649_0097785 3300046694 Bacteria 1561
110 Ga0495589_0034476 3300046794 Bacteria 2540
111 Ga0495589_0052386 3300046794 Bacteria 2016
112 Ga0495600_0145295 3300046809 Bacteria 1537
113 Ga0495660_0043477 3300046810 Bacteria 2477
114 Ga0495581_0159459 3300047315 Bacteria 1319
115 Ga0495604_0114677 3300047317 Bacteria 1959
116 Ga0495636_0035517 3300047318 Bacteria 2053
117 Ga0495674_0354077 3300047319 Bacteria 1191
118 Ga0495676_0003615 3300047321 Bacteria 14031
119 Ga0495676_0005286 3300047321 Bacteria 11820
120 Ga0495676_0144940 3300047321 Bacteria 1697
121 Ga0495680_0070194 3300047322 Bacteria 2671
122 Ga0495683_0068538 3300047323 Bacteria 1744
123 Ga0495687_020205 3300047443 Bacteria 3250
124 Ga0495687_032670 3300047443 Bacteria 2371
125 Ga0495687_038294 3300047443 Bacteria 2128
126 Ga0495687_043463 3300047443 Bacteria 1957
127 Ga0495685_005670 3300047447 Bacteria 4081
128 Ga0495685_051718 3300047447 Bacteria 1392
129 Ga0495685_122449 3300047447 Bacteria 853
130 Ga0495681_0001415 3300047470 Bacteria 18048
131 Ga0495681_0012682 3300047470 Bacteria 4939
132 Ga0495684_0115492 3300047471 Bacteria 2024
133 Ga0495686_0029115 3300047472 Bacteria 3594
134 Ga0495593_0012884 3300047673 Bacteria 4777
135 Ga0495593_0099039 3300047673 Bacteria 1496
136 Ga0495602_0037703 3300048088 Bacteria 4481
137 Ga0495614_0004424 3300048089 Bacteria 6333
138 Ga0495614_0004619 3300048089 Bacteria 6202
139 Ga0496106_0048365 3300048909 Bacteria 3203
140 Ga0501032_0164540 3300049569 Bacteria 1456
141 Ga0501033_0063740 3300049570 Bacteria 2712
142 Ga0501034_0021234 3300049571 Bacteria 6622
143 Ga0501036_0002108 3300049572 Bacteria 15531
144 Ga0501036_0043538 3300049572 Bacteria 3802
145 Ga0501036_0529395 3300049572 Bacteria 980
146 Ga0501037_0007483 3300049573 Bacteria 7991
147 Ga0501038_0003501 3300049574 Bacteria 14615
148 Ga0501042_0053143 3300049578 Bacteria 2890
149 Ga0501043_0019896 3300049579 Bacteria 5271
150 Ga0501043_0232739 3300049579 Bacteria 1423
151 Ga0501047_0001456 3300049581 Bacteria 23127
152 Ga0501047_0088324 3300049581 Bacteria 2977
153 Ga0501070_0002053 3300049586 Bacteria 17681
154 Ga0501074_0005958 3300049590 Bacteria 8793
155 Ga0501035_0032617 3300049822 Bacteria 4737
156 Ga0501035_0316009 3300049822 Bacteria 1313
157 Ga0501035_0483464 3300049822 Bacteria 1021
158 Ga0501044_0009465 3300049823 Bacteria 10608
159 Ga0501044_0124372 3300049823 Bacteria 2577
160 Ga0466962_0002246 3300061719 Bacteria 9145
161 Ga0466962_0076698 3300061719 Bacteria 1597
162 Ga0466962_0077871 3300061719 Bacteria 1585
163 3006393939 3006393351 Bacteria 6615579
164 2554257803 2554235005 Bacteria 6457341
165 2585299202 2582581312 Bacteria 7308206
166 2585313541 2582581314 Bacteria 11452267
167 2616695019 2616644814 Bacteria 11555299
168 2616902244 2616644941 Bacteria 8510691
169 2643902523 2643221578 Bacteria 9213798
170 2644404968 2643221673 Bacteria 9196637
171 2785343235 2784746763 Bacteria 9783172
172 2808920633 2808606375 Bacteria 9466072
173 2809232235 2808606448 Bacteria 8656184
174 2811849114 2808606982 Bacteria 7791042
175 2812358027 2811994879 Bacteria 9313447
176 2852636595 2852635781 Bacteria 8251373
177 2862179423 2862178590 Bacteria 8583590
178 2862285719 2862281513 Bacteria 9621493
179 2862579202 2862574272 Bacteria 10567477
180 2867371947 2867369537 Bacteria 6501581
181 2873155674 2873151551 Bacteria 8625867
182 2875395683 2875391855 Bacteria 7600475
183 2912719891 2912715099 Bacteria 9460473
184 2912724297 2912723979 Bacteria 8557534
185 2912760842 2912757875 Bacteria 7940295
186 2946048957 2946045630 Bacteria 8527308
187 2946067816 2946064051 Bacteria 8957905
188 2947229174 2947224130 Bacteria 9938529
189 2990063137 2990059506 Bacteria 9321252
190 3006500813 3006493962 Bacteria 8825450
191 8008567234 8008558824 Bacteria 10610750
192 8008578832 8008574985 Bacteria 7815457
193 8025481852 8025478263 Bacteria 8209203
194 8025537969 8025530807 Bacteria 8495698
195 8048412693 8048406513 Bacteria 8936924
196 8056833567 8056829672 Bacteria 9045328
197 rootH1_10011459
198 rootH2_10012573
199 rootH1_10004479
200 rootH1_10023036
201 Ga0068868_100529276
202 Ga0068853_100372580
203 Ga0070665_100454988
204 Ga0105244_10061092
205 Ga0105245_10483719
206 Ga0105246_10001000
207 Ga0182006_1063761
208 Ga0182007_10005492
209 Ga0209758_1034411
210 Ga0207426_1016133
211 Ga0207687_10471096
212 Ga0207639_10102076
213 Ga0207678_10565799
214 Ga0307515_10000315
215 Ga0307515_10000732
216 Ga0307515_10338523
217 Ga0307511_10001033
218 Ga0307512_10002037
219 Ga0307512_10110777
220 Ga0307512_10142433
221 Ga0307513_10042373
222 Ga0307513_10299174
223 Ga0307508_10021767
224 Ga0307514_10151106
225 Ga0307514_10252193
226 Ga0307516_10003793
227 Ga0307516_10005429
228 Ga0307516_10024574
229 Ga0307516_10064168
230 Ga0307413_10368498
231 Ga0307518_10075451
232 Ga0307510_10005521
233 Ga0395900_0030175
234 Ga0395898_0007727
235 Ga0395898_0159894
236 Ga0395901_0031315
237 Ga0439436_0019223
238 Ga0439439_0037709
239 Ga0451853_3511591
240 Ga0439433_0007844
241 Ga0466972_0001145
242 Ga0466965_0010043
243 Ga0466966_0004330
244 Ga0466961_0003595
245 Ga0466963_0002564
246 Ga0466964_0003469
247 Ga0466971_0003308
248 Ga0466971_0069851
249 Ga0466971_0150637
250 Ga0466970_0002452
251 Ga0466960_0233372
252 Ga0466959_0000404
253 Ga0466958_0000992
254 Ga0466967_0139816
255 Ga0495603_0000900
256 Ga0495629_0006972
257 Ga0495629_0037718
258 Ga0495641_0162239
259 Ga0495605_0002215
260 Ga0495662_0038321
261 Ga0495664_0040433
262 Ga0495585_0062654
263 Ga0495585_0154553
264 Ga0495594_0002761
265 Ga0495594_0019673
266 Ga0495596_0163766
267 Ga0495607_0184566
268 Ga0495583_0022644
269 Ga0495606_0129251
270 Ga0495608_0029512
271 Ga0495610_0042533
272 Ga0495616_0021427
273 Ga0495620_0003173
274 Ga0495628_0088749
275 Ga0495643_0007450
276 Ga0495643_0047678
277 Ga0495648_0035699
278 Ga0495648_0049206
279 Ga0495642_0140255
280 Ga0495642_0159368
281 Ga0495652_0071546
282 Ga0495652_0282263
283 Ga0495640_0006969
284 Ga0495597_0023714
285 Ga0495622_0017617
286 Ga0495668_0039448
287 Ga0495625_0007428
288 Ga0495625_0102304
289 Ga0495635_0077641
290 Ga0495588_0006246
291 Ga0495588_0084418
292 Ga0495657_0041606
293 Ga0495657_0160425
294 Ga0495623_0074505
295 Ga0495613_0003620
296 Ga0495613_0048162
297 Ga0495613_0083438
298 Ga0495613_0096446
299 Ga0495613_0407563
300 Ga0495624_0024021
301 Ga0495624_0162398
302 Ga0495671_0014081
303 Ga0495671_0145816
304 Ga0495649_0038502
305 Ga0495649_0097785
306 Ga0495589_0034476
307 Ga0495589_0052386
308 Ga0495600_0145295
309 Ga0495660_0043477
310 Ga0495581_0159459
311 Ga0495604_0114677
312 Ga0495636_0035517
313 Ga0495674_0354077
314 Ga0495676_0003615
315 Ga0495676_0005286
316 Ga0495676_0144940
317 Ga0495680_0070194
318 Ga0495683_0068538
319 Ga0495687_020205
320 Ga0495687_032670
321 Ga0495687_038294
322 Ga0495687_043463
323 Ga0495685_005670
324 Ga0495685_051718
325 Ga0495685_122449
326 Ga0495681_0001415
327 Ga0495681_0012682
328 Ga0495684_0115492
329 Ga0495686_0029115
330 Ga0495593_0012884
331 Ga0495593_0099039
332 Ga0495602_0037703
333 Ga0495614_0004424
334 Ga0495614_0004619
335 Ga0496106_0048365
336 Ga0501032_0164540
337 Ga0501033_0063740
338 Ga0501034_0021234
339 Ga0501036_0002108
340 Ga0501036_0043538
341 Ga0501036_0529395
342 Ga0501037_0007483
343 Ga0501038_0003501
344 Ga0501042_0053143
345 Ga0501043_0019896
346 Ga0501043_0232739
347 Ga0501047_0001456
348 Ga0501047_0088324
349 Ga0501070_0002053
350 Ga0501074_0005958
351 Ga0501035_0032617
352 Ga0501035_0316009
353 Ga0501035_0483464
354 Ga0501044_0009465
355 Ga0501044_0124372
356 Ga0466962_0002246
357 Ga0466962_0076698
358 Ga0466962_0077871
359 3006393939
360 2554257803
361 2585299202
362 2585313541
363 2616695019
364 2616902244
365 2643902523
366 2644404968
367 2785343235
368 2808920633
369 2809232235
370 2811849114
371 2812358027
372 2852636595
373 2862179423
374 2862285719
375 2862579202
376 2867371947
377 2873155674
378 2875395683
379 2912719891
380 2912724297
381 2912760842
382 2946048957
383 2946067816
384 2947229174
385 2990063137
386 3006500813
387 8008567234
388 8008578832
389 8025481852
390 8025537969
391 8048412693
392 8056833567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03932

CutC

CutC family

1

202

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r9x-assembly1.cif.gz_B-2 crystal structure of putative copper homeostasis protein cutc from bacillus anthracis 0.9329 6 222
1x8c-assembly1.cif.gz_B crystal structure of the semet-derivative copper homeostasis protein (cutcm) with calcium binding from shigella flexneri 2a str. 301 0.9115 5 222
1twd-assembly1.cif.gz_A crystal structure of the putative copper homeostasis protein (cutc) from shigella flexneri, northeast structural genomics target sfr33 0.9113 5 222
3iwp-assembly6.cif.gz_E crystal structure of human copper homeostasis protein cutc 0.9094 5 222
3iwp-assembly5.cif.gz_C crystal structure of human copper homeostasis protein cutc 0.9074 5 220
ID Description Score Start End Superfamily
4r9xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.92 8 222 3.20.20.380
af_P67826_1_248_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9098 5 222 3.20.20.380
af_Q4E0C3_1_211_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9085 5 197 3.20.20.380
af_Q9VF71_10_262_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9052 6 224 3.20.20.380
af_Q9D8X1_24_272_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9012 5 222 3.20.20.380
ID Description Score Start End GO Terms
AF-A0A7H0IGR0-F1-model_v4 Copper homeostasis protein cutC homolog 0.9979 1 223 GO:0005507
AF-V6K6X5-F1-model_v4 Copper homeostasis protein cutC homolog 0.9967 1 223 GO:0005507
AF-A0A2R4K0P8-F1-model_v4 Copper homeostasis protein cutC homolog 0.9956 1 223 GO:0005507
AF-A0A4R1DDY1-F1-model_v4 deleted 0.9942 1 224
AF-A0A3D9QFC1-F1-model_v4 deleted 0.9939 1 224

Map